2R4HA

Crystal structure of a c1190s mutant of the 6th pdz domain of human membrane associated guanylate kinase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
MDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERSGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGETSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2r4hA01
3HPKA 3ID2A 3EGHC 3K1RA 4NXPA 1WI4A 4JOGA 2L4SA 4REYA 3PDVA 5HFFA 1WFVA 2EDPA 1X5RA 2HE2A 2CSJA 2V90A 2O2TA 3E17A 4AMHA 3QGLA 4OEPA 4Q2NA 5FB8C 3QDOA 1YBOA 1P1DA 5G1EA 2YUYA 4JOKA 1VAEA 1Q3PA 2I0LA 1Y8TA 2JINA 3NGHA 2W7RA 2OQSA 1WIFA 5E6PB 3K50A 3GDUA 1Q7XA 4HOPB 2H2BA 1UF1A 3B76A 1QAVB 4K75A 2BYGA 2QBWA 4NMSA 1VCWA 1V5QA 1R6JA 4Q2PA 2EXGA 2QG1A 2M0TA 2REYA 4N6XA 2IWOA 3DIWA 2IWPA 2KPKA 2FN5A 2KJKA 3MH6A 1B8QA 2R4HA 1UHPA 2LC6A 1KY9A 4RI0A 2I4SA 2FNEA 2JIKA 2ZPLA 3DORA 1OBYA 2QKVA 2YT8A 2QKUA 2Q3GA 2YT7A 2QT5A 4OEOA 2M10A 2LC7A 3R68A 2ENOA 2JXOA 1N6EA 2H3LA 2H2CA 1GM1A 2VPHA 3QJMA 4NXRA 2G2LA 1N7TA 1FCFA 1NF3C 2FCFA 1WHAA 4NMPA 3PV5A 1VJ6A 5F3XA 1TP3A 4WYUA 1W9EA 2EAQA 3LNYA 4HOPA 3OU0A 1Q3OA 1IHJA 3O5NA 1UEPA 1N99A 2PKTA 2ZPMA 4NMQA 3HPMA 1BFEA 3EGGC 5E11A 2RRMA 1GQ5A 3MH4A 5G1DA 1M5ZA 3CBYA 3SHUA 5E21A 5HF1A 3JXTA 5F67A 1KEFA 2K20A 4GVCA 4JOPA 3MH7A 4O06A 1WJLA 2EEGA 2F0AA 1TP5A 2KAWA 5HETA 1I92A 3STJA 4NMOA 5HFEA 4JOHA 3AXAA 2OSGA 2D90A 1Z86A 3O46A 1D5GA 2DB5A 1I16A 1NTEA 1ZOKA 3VQFA 2K1ZA 3GSLA 1T2MA 2LA8A 5JXBA 5HFCA 4JOFA 5HEYA 3K82A 1Z87A 1OZIA 3WKMA 4EDJA 1MFGA 3VQGA 1WHDA 4JOEA 1TE0A 3SUZA 2KL1A 3SOEA 1UM1A 3FY5A 2OZFA 2I6VA 3I4WA 2PZDA 2I04A 2D92A 1FC7A 4NNMA 3R0HA 4KFVA 2AWWA 2VSVA 2Z9IA 2Z17A 3I18A 3DJAA 3I1EA 5EYZA 3GCOA 2YTWA 2GZVA 4E3BA 4NMVA 3CC0A 4Q6SA 3GGEA 2KRGA 5EZ0A 2EGNA 4YDPA 4E35A 1IU2A 2VRFA 1N6DA 4GVDA 1SOZA 5A2PA 1U38A 1ZUBA 3ID3A 2L97A 3HVQC 1X5NA 2M0UA 2CS5A 4Q2QA 1BE9A 2EV8A 3LNXA 3PV4A 3QE1A 4NXQA 5HF4A 3QO6A 3CBXA 2FE5A 1X5QA 4Q6HA 2LUIA 4UU6A 3CBZA 1W9OA 1N7EA 2DM8A 3R69A 2JWEA 1WFGA 2EEJA 1QAUA 3RL7A 1WG6A 1UJDA 4FGMA 1QAVA 2AINA 1SOTA 2MX6A 2VZ5A 1LCYA 3CS0A 3GDSA 4XHVA 2EDVA 2PNTA 3ID1A 2AWXA 1WF8A 5FHTA 1FC9A 1OBXA 2EEHA 2W4FA 4WYTA 2OCSA 3KZDA 4P0CA 1V6BA 2M3MA 2UZCA 1OBZA 2X7ZA 3NFKA 4Q2OA 2OS6A 5DTHA 1Y7NA 1PDRA 4GHNA 4PQWA 2M0VA 1RY4A 2QKTA 1WH1A 2KV8A 2DLSA 2PKUA 1UEQA 1UM7A 2MHOA 2M0ZA 1GQ4A 2F5YA 2KJPA 2OGPA 2DLUA 3CH8A 2OPGA 4UU5A 4Z8JA 2PDZA 2KBSA 5E22A 3TSWA 3ZRTA 2V1WA 4F8KA 1QLCA 1UITA 3NFLA 2EEIA 3PS4A 2KPLA 2I1NA 2IWQA 1KWAA 4YYXA 2H3MA 3QIKA 4Q3HA 3GJ9A 1UJVA 4NNLA 3OTPA 5HDYA 3RL8A 3PDZA 4E34A 2WL7A 1UEWA 2OMJA 1RZXA 2P3WA 2VSPA 4KFWA 1IU0A 1U39A 2DKRA 1P1EA 1X6DA 4JL7A 1N6FA 1XZ9A 2JILA 1W9QA 3QJNA 5D13A 2HGAA 2IWNA 3WKLA 4MPAA 1WF7A 3KZEA 4H11A 2KJDA 5B6LA 2D8IA 1VB7A 1RGRA 1FC6A 2YUBA 3ID4A 4L8NA 1RGWA 3L4FD 5GNDA 2JREA 1UEZA 2Q9VA 1X8SA 3DJ3A 1UJUA 5HEDA 2EHRA 2EGOA 1V1TA 1U37A 2DMZA 1MC7A 4NMRA 2LOBA 2VWRA 3RLEA 4K76A 2KOJA 1TQ3A 4LMMA 2AWUA 3TSVA 2JOAA 2RCZA 2G5MB 4OAJA 1K32A 4Z33A 3CYYA 4K6YA 4IC6A 5E1YA 2PA1A 2HE4A 2EGKA 1UFXA 1V5LA 4K78A 2DAZA 3TSZA 5HFDA 3KHFA 3PV2A 2L4TA 3BPUA 2KOHA 2E7KA 2KOMA 3TMHA 2CSSA 1N7FA 2KG2A 1WI2A 2EDZA 5I7ZA 5HEBA 1L6OA 2DJTA 2DC2A 5HJ1A 4G69A 5GLJA 3SFJA 4JORA 1VA8A 2EJYA 5HFBA 3SHWA 1G9OA 4R2ZA 3GCNA 2R3YA 5H3JA 4P2AB 1MFLA 4NMTA 4K72A 1U3BA 1X45A 3GDVA 4JOJA 2I0IA 1V62A 2KQFA 2KYLA 3DJ1A 2KA9A
chains in the Genus database with same CATH superfamily
3HPKA 3ID2A 3EGHC 3K1RA 4NXPA 1WI4A 4JOGA 2L4SA 4REYA 3PDVA 5HFFA 1WFVA 2EDPA 1X5RA 2HE2A 2CSJA 2V90A 2O2TA 3E17A 4AMHA 3QGLA 4OEPA 4Q2NA 5FB8C 3QDOA 1YBOA 1P1DA 5G1EA 2YUYA 4JOKA 1VAEA 1Q3PA 2I0LA 1Y8TA 2JINA 3NGHA 2W7RA 2OQSA 1WIFA 5E6PB 3K50A 3GDUA 1Q7XA 4HOPB 2H2BA 1UF1A 3B76A 1QAVB 4K75A 2BYGA 2QBWA 4NMSA 1VCWA 1V5QA 1R6JA 4Q2PA 2EXGA 2QG1A 2M0TA 2REYA 4N6XA 2IWOA 3DIWA 2IWPA 2KPKA 2FN5A 2KJKA 3MH6A 1B8QA 2R4HA 1UHPA 2LC6A 1KY9A 4RI0A 2I4SA 2FNEA 4FLNA 2JIKA 2ZPLA 3DORA 1OBYA 2QKVA 2YT8A 2QKUA 2Q3GA 2YT7A 2QT5A 4OEOA 5B42A 2M10A 2LC7A 3R68A 2ENOA 2JXOA 1N6EA 2H3LA 2H2CA 1GM1A 2VPHA 3QJMA 4NXRA 2G2LA 1N7TA 1FCFA 1NF3C 2FCFA 1WHAA 4NMPA 3PV5A 1VJ6A 5F3XA 1TP3A 4WYUA 1W9EA 2EAQA 3LNYA 4HOPA 3OU0A 1Q3OA 1IHJA 3O5NA 1UEPA 1N99A 2PKTA 2ZPMA 4NMQA 3HPMA 1BFEA 3EGGC 5E11A 2RRMA 1GQ5A 3MH4A 5G1DA 1M5ZA 3CBYA 3SHUA 5E21A 5HF1A 3JXTA 5F67A 1KEFA 2K20A 4GVCA 4JOPA 3MH7A 4O06A 1WJLA 2EEGA 2F0AA 1TP5A 2KAWA 5HETA 1I92A 3STJA 4NMOA 5HFEA 4JOHA 3AXAA 3KDKA 2OSGA 2D90A 1Z86A 3O46A 1D5GA 2DB5A 1I16A 1NTEA 1ZOKA 3VQFA 3KDGA 2K1ZA 3GSLA 1T2MA 2LA8A 5JXBA 5HFCA 1X9ZA 4JOFA 5HEYA 3K82A 1Z87A 1OZIA 3WKMA 4EDJA 1MFGA 3VQGA 1WHDA 4JOEA 1TE0A 3SUZA 2KL1A 3SOEA 1UM1A 3FY5A 2OZFA 2I6VA 3I4WA 2PZDA 2I04A 2D92A 1FC7A 4NNMA 3R0HA 4KFVA 2AWWA 2VSVA 2Z9IA 2Z17A 3I18A 3DJAA 3I1EA 5EYZA 3GCOA 2YTWA 2GZVA 4E3BA 4NMVA 3CC0A 4Q6SA 3GGEA 2KRGA 5EZ0A 2EGNA 4YDPA 4E35A 1IU2A 2VRFA 1N6DA 4GVDA 1SOZA 5A2PA 1U38A 1ZUBA 3ID3A 2L97A 3HVQC 1X5NA 2M0UA 2CS5A 4Q2QA 1BE9A 2EV8A 3LNXA 3PV4A 3QE1A 4NXQA 5HF4A 3QO6A 3CBXA 2FE5A 1X5QA 4Q6HA 2LUIA 4UU6A 3CBZA 1W9OA 1N7EA 2DM8A 3R69A 2JWEA 1WFGA 2EEJA 1QAUA 3RL7A 1WG6A 1UJDA 4FGMA 1QAVA 2AINA 1SOTA 2MX6A 2VZ5A 1LCYA 3CS0A 3GDSA 4XHVA 2EDVA 2PNTA 3ID1A 2AWXA 1WF8A 5FHTA 1FC9A 1OBXA 2EEHA 2W4FA 4WYTA 2OCSA 3KZDA 4P0CA 1V6BA 2M3MA 2UZCA 1OBZA 2X7ZA 3NFKA 4Q2OA 2OS6A 5DTHA 1Y7NA 1PDRA 4GHNA 4PQWA 2M0VA 1RY4A 2QKTA 1WH1A 2KV8A 2DLSA 2PKUA 1UEQA 1UM7A 2MHOA 2M0ZA 2JSNA 1GQ4A 2F5YA 2KJPA 2OGPA 2DLUA 3CH8A 2OPGA 4UU5A 4Z8JA 2PDZA 3NCVA 2KBSA 5E22A 3TSWA 3ZRTA 2V1WA 4F8KA 1QLCA 1UITA 3NFLA 2EEIA 3PS4A 2KPLA 2I1NA 2IWQA 1KWAA 4YYXA 2H3MA 3QIKA 4Q3HA 3GJ9A 1UJVA 4NNLA 3OTPA 5HDYA 3RL8A 3PDZA 4E34A 2WL7A 1UEWA 2OMJA 1RZXA 2P3WA 2VSPA 4KFWA 1IU0A 1U39A 2DKRA 1P1EA 1X6DA 4JL7A 1N6FA 1XZ9A 2JILA 1W9QA 3QJNA 5D13A 2HGAA 2IWNA 3WKLA 4MPAA 1WF7A 3KZEA 4H11A 2KJDA 5B6LA 2D8IA 1VB7A 1RGRA 1FC6A 2YUBA 3ID4A 4L8NA 1RGWA 3L4FD 5GNDA 2JREA 1UEZA 2Q9VA 5ILBA 1X8SA 3DJ3A 1UJUA 5HEDA 2EHRA 2EGOA 2GEFA 1V1TA 1U37A 2DMZA 1MC7A 4NMRA 2LOBA 2VWRA 3RLEA 4JJ3A 4K76A 2KOJA 1TQ3A 4LMMA 2AWUA 3TSVA 2JOAA 2RCZA 2G5MB 4OAJA 1K32A 4Z33A 3CYYA 4K6YA 4IC6A 5E1YA 2PA1A 4JJ0A 2HE4A 3GABA 2EGKA 1UFXA 1V5LA 4K78A 2DAZA 3TSZA 5HFDA 3KHFA 3PV2A 2L4TA 3BPUA 2KOHA 2E7KA 2KOMA 3TMHA 2CSSA 1N7FA 2KG2A 1WI2A 2EDZA 5I7ZA 5HEBA 1L6OA 2DJTA 2DC2A 5HJ1A 4G69A 5GLJA 3SFJA 4JORA 1VA8A 2EJYA 5HFBA 3SHWA 1G9OA 4R2ZA 3GCNA 2R3YA 5H3JA 4P2AB 5IL9A 1MFLA 4NMTA 4K72A 1U3BA 1X45A 3GDVA 4JOJA 2I0IA 1V62A 2KQFA 2KYLA 3DJ1A 2KA9A
chains in the Genus database with same CATH topology
3HPKA 3ID2A 3EGHC 3K1RA 4NXPA 1WI4A 4JOGA 2L4SA 4REYA 3PDVA 5HFFA 1WFVA 2EDPA 1X5RA 2HE2A 2CSJA 2V90A 2O2TA 3E17A 4AMHA 3QGLA 4OEPA 4Q2NA 5FB8C 3QDOA 1YBOA 1P1DA 5G1EA 2YUYA 4JOKA 1VAEA 1Q3PA 2I0LA 1Y8TA 2JINA 3NGHA 2W7RA 2OQSA 1WIFA 5E6PB 3K50A 3GDUA 1Q7XA 4HOPB 2H2BA 1UF1A 3B76A 1QAVB 4K75A 2BYGA 2QBWA 4NMSA 1VCWA 1V5QA 1R6JA 4Q2PA 2EXGA 2QG1A 2M0TA 2REYA 4N6XA 2IWOA 3DIWA 2IWPA 2KPKA 2FN5A 2KJKA 3MH6A 1B8QA 2R4HA 1UHPA 2LC6A 1KY9A 4RI0A 2I4SA 2FNEA 4FLNA 2JIKA 2ZPLA 3DORA 1OBYA 2QKVA 2YT8A 2QKUA 2Q3GA 2YT7A 2QT5A 4OEOA 5B42A 2M10A 2LC7A 3R68A 2ENOA 2JXOA 1N6EA 2H3LA 2H2CA 1GM1A 2VPHA 3QJMA 4NXRA 2G2LA 1N7TA 1FCFA 1NF3C 2FCFA 1WHAA 4NMPA 3PV5A 1VJ6A 5F3XA 1TP3A 4WYUA 1W9EA 2EAQA 3LNYA 4HOPA 3OU0A 1Q3OA 1IHJA 3O5NA 1UEPA 1N99A 2PKTA 2ZPMA 4NMQA 3HPMA 1BFEA 3EGGC 5E11A 2RRMA 1GQ5A 3MH4A 5G1DA 1M5ZA 3CBYA 3SHUA 5E21A 5HF1A 3JXTA 5F67A 1KEFA 2K20A 4GVCA 4JOPA 3MH7A 4O06A 1WJLA 2EEGA 2F0AA 1TP5A 2KAWA 5HETA 1I92A 3STJA 4NMOA 5HFEA 4JOHA 3AXAA 3KDKA 2OSGA 2D90A 1Z86A 3O46A 1D5GA 2DB5A 1I16A 1NTEA 1ZOKA 3VQFA 3KDGA 2K1ZA 3GSLA 1T2MA 2LA8A 5JXBA 5HFCA 1X9ZA 4JOFA 5HEYA 3K82A 1Z87A 1OZIA 3WKMA 4EDJA 1MFGA 3VQGA 1WHDA 4JOEA 1TE0A 3SUZA 2KL1A 3SOEA 1UM1A 3FY5A 2OZFA 2I6VA 3I4WA 2PZDA 2I04A 2D92A 1FC7A 4NNMA 3R0HA 4KFVA 2AWWA 2VSVA 2Z9IA 2Z17A 3I18A 3DJAA 3I1EA 5EYZA 3GCOA 2YTWA 2GZVA 4E3BA 4NMVA 3CC0A 4Q6SA 3GGEA 2KRGA 5EZ0A 2EGNA 4YDPA 4E35A 1IU2A 2VRFA 1N6DA 4GVDA 1SOZA 5A2PA 1U38A 1ZUBA 3ID3A 2L97A 3HVQC 1X5NA 2M0UA 2CS5A 4Q2QA 1BE9A 2EV8A 3LNXA 3PV4A 3QE1A 4NXQA 5HF4A 3QO6A 3CBXA 2FE5A 1X5QA 4Q6HA 2LUIA 4UU6A 3CBZA 1W9OA 1N7EA 2DM8A 3R69A 2JWEA 1WFGA 2EEJA 1QAUA 3RL7A 1WG6A 1UJDA 4FGMA 1QAVA 2AINA 1SOTA 2MX6A 2VZ5A 1LCYA 3CS0A 3GDSA 4XHVA 2EDVA 2PNTA 3ID1A 2AWXA 1WF8A 5FHTA 1FC9A 1OBXA 2EEHA 2W4FA 4WYTA 2OCSA 3KZDA 4P0CA 1V6BA 2M3MA 2UZCA 1OBZA 2X7ZA 3NFKA 4Q2OA 2OS6A 5DTHA 1Y7NA 1PDRA 4GHNA 4PQWA 2M0VA 1RY4A 2QKTA 1WH1A 2KV8A 2DLSA 2PKUA 1UEQA 1UM7A 2MHOA 2M0ZA 2JSNA 1GQ4A 2F5YA 2KJPA 2OGPA 2DLUA 3CH8A 2OPGA 4UU5A 4Z8JA 2PDZA 3NCVA 2KBSA 5E22A 3TSWA 3ZRTA 2V1WA 4F8KA 1QLCA 1UITA 3NFLA 2EEIA 3PS4A 2KPLA 2I1NA 2IWQA 1KWAA 4YYXA 2H3MA 3QIKA 4Q3HA 3GJ9A 1UJVA 4NNLA 3OTPA 5HDYA 3RL8A 3PDZA 4E34A 2WL7A 1UEWA 2OMJA 1RZXA 2P3WA 2VSPA 4KFWA 1IU0A 1U39A 2DKRA 1P1EA 1X6DA 4JL7A 1N6FA 1XZ9A 2JILA 1W9QA 3QJNA 5D13A 2HGAA 2IWNA 3WKLA 4MPAA 1WF7A 3KZEA 4H11A 2KJDA 5B6LA 2D8IA 1VB7A 1RGRA 1FC6A 2YUBA 3ID4A 4L8NA 1RGWA 3L4FD 5GNDA 2JREA 1UEZA 2Q9VA 5ILBA 1X8SA 3DJ3A 1UJUA 5HEDA 2EHRA 2EGOA 2GEFA 1V1TA 1U37A 2DMZA 1MC7A 4NMRA 2LOBA 2VWRA 3RLEA 4JJ3A 4K76A 2KOJA 1TQ3A 4LMMA 2AWUA 3TSVA 2JOAA 2RCZA 2G5MB 4OAJA 1K32A 4Z33A 3CYYA 4K6YA 4IC6A 5E1YA 2PA1A 4JJ0A 2HE4A 3GABA 2EGKA 1UFXA 1V5LA 4K78A 2DAZA 3TSZA 5HFDA 3KHFA 3PV2A 2L4TA 3BPUA 2KOHA 2E7KA 2KOMA 3TMHA 2CSSA 1N7FA 2KG2A 1WI2A 2EDZA 5I7ZA 5HEBA 1L6OA 2DJTA 2DC2A 5HJ1A 4G69A 5GLJA 3SFJA 4JORA 1VA8A 2EJYA 5HFBA 3SHWA 1G9OA 4R2ZA 3GCNA 2R3YA 5H3JA 4P2AB 5IL9A 1MFLA 4NMTA 4K72A 1U3BA 1X45A 3GDVA 4JOJA 2I0IA 1V62A 2KQFA 2KYLA 3DJ1A 2KA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPK A;  3ID2 A;  3EGH C;  3K1R A;  4NXP A;  1WI4 A;  4JOG A;  2L4S A;  4REY A;  3PDV A;  5HFF A;  1WFV A;  2EDP A;  1X5R A;  2HE2 A;  2CSJ A;  2V90 A;  2O2T A;  3E17 A;  4AMH A;  3QGL A;  4OEP A;  4Q2N A;  5FB8 C;  3QDO A;  1YBO A;  1P1D A;  5G1E A;  2YUY A;  4JOK A;  1VAE A;  1Q3P A;  2I0L A;  1Y8T A;  2JIN A;  3NGH A;  2W7R A;  2OQS A;  1WIF A;  5E6P B;  3K50 A;  3GDU A;  1Q7X A;  4HOP B;  2H2B A;  1UF1 A;  3B76 A;  1QAV B;  4K75 A;  2BYG A;  2QBW A;  4NMS A;  1VCW A;  1V5Q A;  1R6J A;  4Q2P A;  2EXG A;  2QG1 A;  2M0T A;  2REY A;  4N6X A;  2IWO A;  3DIW A;  2IWP A;  2KPK A;  2FN5 A;  2KJK A;  3MH6 A;  1B8Q A;  2R4H A;  1UHP A;  2LC6 A;  1KY9 A;  4RI0 A;  2I4S A;  2FNE A;  2JIK A;  2ZPL A;  3DOR A;  1OBY A;  2QKV A;  2YT8 A;  2QKU A;  2Q3G A;  2YT7 A;  2QT5 A;  4OEO A;  2M10 A;  2LC7 A;  3R68 A;  2ENO A;  2JXO A;  1N6E A;  2H3L A;  2H2C A;  1GM1 A;  2VPH A;  3QJM A;  4NXR A;  2G2L A;  1N7T A;  1FCF A;  1NF3 C;  2FCF A;  1WHA A;  4NMP A;  3PV5 A;  1VJ6 A;  5F3X A;  1TP3 A;  4WYU A;  1W9E A;  2EAQ A;  3LNY A;  4HOP A;  3OU0 A;  1Q3O A;  1IHJ A;  3O5N A;  1UEP A;  1N99 A;  2PKT A;  2ZPM A;  4NMQ A;  3HPM A;  1BFE A;  3EGG C;  5E11 A;  2RRM A;  1GQ5 A;  3MH4 A;  5G1D A;  1M5Z A;  3CBY A;  3SHU A;  5E21 A;  5HF1 A;  3JXT A;  5F67 A;  1KEF A;  2K20 A;  4GVC A;  4JOP A;  3MH7 A;  4O06 A;  1WJL A;  2EEG A;  2F0A A;  1TP5 A;  2KAW A;  5HET A;  1I92 A;  3STJ A;  4NMO A;  5HFE A;  4JOH A;  3AXA A;  2OSG A;  2D90 A;  1Z86 A;  3O46 A;  1D5G A;  2DB5 A;  1I16 A;  1NTE A;  1ZOK A;  3VQF A;  2K1Z A;  3GSL A;  1T2M A;  2LA8 A;  5JXB A;  5HFC A;  4JOF A;  5HEY A;  3K82 A;  1Z87 A;  1OZI A;  3WKM A;  4EDJ A;  1MFG A;  3VQG A;  1WHD A;  4JOE A;  1TE0 A;  3SUZ A;  2KL1 A;  3SOE A;  1UM1 A;  3FY5 A;  2OZF A;  2I6V A;  3I4W A;  2PZD A;  2I04 A;  2D92 A;  1FC7 A;  4NNM A;  3R0H A;  4KFV A;  2AWW A;  2VSV A;  2Z9I A;  2Z17 A;  3I18 A;  3DJA A;  3I1E A;  5EYZ A;  3GCO A;  2YTW A;  2GZV A;  4E3B A;  4NMV A;  3CC0 A;  4Q6S A;  3GGE A;  2KRG A;  5EZ0 A;  2EGN A;  4YDP A;  4E35 A;  1IU2 A;  2VRF A;  1N6D A;  4GVD A;  1SOZ A;  5A2P A;  1U38 A;  1ZUB A;  3ID3 A;  2L97 A;  3HVQ C;  1X5N A;  2M0U A;  2CS5 A;  4Q2Q A;  1BE9 A;  2EV8 A;  3LNX A;  3PV4 A;  3QE1 A;  4NXQ A;  5HF4 A;  3QO6 A;  3CBX A;  2FE5 A;  1X5Q A;  4Q6H A;  2LUI A;  4UU6 A;  3CBZ A;  1W9O A;  1N7E A;  2DM8 A;  3R69 A;  2JWE A;  1WFG A;  2EEJ A;  1QAU A;  3RL7 A;  1WG6 A;  1UJD A;  4FGM A;  1QAV A;  2AIN A;  1SOT A;  2MX6 A;  2VZ5 A;  1LCY A;  3CS0 A;  3GDS A;  4XHV A;  2EDV A;  2PNT A;  3ID1 A;  2AWX A;  1WF8 A;  5FHT A;  1FC9 A;  1OBX A;  2EEH A;  2W4F A;  4WYT A;  2OCS A;  3KZD A;  4P0C A;  1V6B A;  2M3M A;  2UZC A;  1OBZ A;  2X7Z A;  3NFK A;  4Q2O A;  2OS6 A;  5DTH A;  1Y7N A;  1PDR A;  4GHN A;  4PQW A;  2M0V A;  1RY4 A;  2QKT A;  1WH1 A;  2KV8 A;  2DLS A;  2PKU A;  1UEQ A;  1UM7 A;  2MHO A;  2M0Z A;  1GQ4 A;  2F5Y A;  2KJP A;  2OGP A;  2DLU A;  3CH8 A;  2OPG A;  4UU5 A;  4Z8J A;  2PDZ A;  2KBS A;  5E22 A;  3TSW A;  3ZRT A;  2V1W A;  4F8K A;  1QLC A;  1UIT A;  3NFL A;  2EEI A;  3PS4 A;  2KPL A;  2I1N A;  2IWQ A;  1KWA A;  4YYX A;  2H3M A;  3QIK A;  4Q3H A;  3GJ9 A;  1UJV A;  4NNL A;  3OTP A;  5HDY A;  3RL8 A;  3PDZ A;  4E34 A;  2WL7 A;  1UEW A;  2OMJ A;  1RZX A;  2P3W A;  2VSP A;  4KFW A;  1IU0 A;  1U39 A;  2DKR A;  1P1E A;  1X6D A;  4JL7 A;  1N6F A;  1XZ9 A;  2JIL A;  1W9Q A;  3QJN A;  5D13 A;  2HGA A;  2IWN A;  3WKL A;  4MPA A;  1WF7 A;  3KZE A;  4H11 A;  2KJD A;  5B6L A;  2D8I A;  1VB7 A;  1RGR A;  1FC6 A;  2YUB A;  3ID4 A;  4L8N A;  1RGW A;  3L4F D;  5GND A;  2JRE A;  1UEZ A;  2Q9V A;  1X8S A;  3DJ3 A;  1UJU A;  5HED A;  2EHR A;  2EGO A;  1V1T A;  1U37 A;  2DMZ A;  1MC7 A;  4NMR A;  2LOB A;  2VWR A;  3RLE A;  4K76 A;  2KOJ A;  1TQ3 A;  4LMM A;  2AWU A;  3TSV A;  2JOA A;  2RCZ A;  2G5M B;  4OAJ A;  1K32 A;  4Z33 A;  3CYY A;  4K6Y A;  4IC6 A;  5E1Y A;  2PA1 A;  2HE4 A;  2EGK A;  1UFX A;  1V5L A;  4K78 A;  2DAZ A;  3TSZ A;  5HFD A;  3KHF A;  3PV2 A;  2L4T A;  3BPU A;  2KOH A;  2E7K A;  2KOM A;  3TMH A;  2CSS A;  1N7F A;  2KG2 A;  1WI2 A;  2EDZ A;  5I7Z A;  5HEB A;  1L6O A;  2DJT A;  2DC2 A;  5HJ1 A;  4G69 A;  5GLJ A;  3SFJ A;  4JOR A;  1VA8 A;  2EJY A;  5HFB A;  3SHW A;  1G9O A;  4R2Z A;  3GCN A;  2R3Y A;  5H3J A;  4P2A B;  1MFL A;  4NMT A;  4K72 A;  1U3B A;  1X45 A;  3GDV A;  4JOJ A;  2I0I A;  1V62 A;  2KQF A;  2KYL A;  3DJ1 A;  2KA9 A; 
#chains in the Genus database with same CATH topology
 3HPK A;  3ID2 A;  3EGH C;  3K1R A;  4NXP A;  1WI4 A;  4JOG A;  2L4S A;  4REY A;  3PDV A;  5HFF A;  1WFV A;  2EDP A;  1X5R A;  2HE2 A;  2CSJ A;  2V90 A;  2O2T A;  3E17 A;  4AMH A;  3QGL A;  4OEP A;  4Q2N A;  5FB8 C;  3QDO A;  1YBO A;  1P1D A;  5G1E A;  2YUY A;  4JOK A;  1VAE A;  1Q3P A;  2I0L A;  1Y8T A;  2JIN A;  3NGH A;  2W7R A;  2OQS A;  1WIF A;  5E6P B;  3K50 A;  3GDU A;  1Q7X A;  4HOP B;  2H2B A;  1UF1 A;  3B76 A;  1QAV B;  4K75 A;  2BYG A;  2QBW A;  4NMS A;  1VCW A;  1V5Q A;  1R6J A;  4Q2P A;  2EXG A;  2QG1 A;  2M0T A;  2REY A;  4N6X A;  2IWO A;  3DIW A;  2IWP A;  2KPK A;  2FN5 A;  2KJK A;  3MH6 A;  1B8Q A;  2R4H A;  1UHP A;  2LC6 A;  1KY9 A;  4RI0 A;  2I4S A;  2FNE A;  4FLN A;  2JIK A;  2ZPL A;  3DOR A;  1OBY A;  2QKV A;  2YT8 A;  2QKU A;  2Q3G A;  2YT7 A;  2QT5 A;  4OEO A;  5B42 A;  2M10 A;  2LC7 A;  3R68 A;  2ENO A;  2JXO A;  1N6E A;  2H3L A;  2H2C A;  1GM1 A;  2VPH A;  3QJM A;  4NXR A;  2G2L A;  1N7T A;  1FCF A;  1NF3 C;  2FCF A;  1WHA A;  4NMP A;  3PV5 A;  1VJ6 A;  5F3X A;  1TP3 A;  4WYU A;  1W9E A;  2EAQ A;  3LNY A;  4HOP A;  3OU0 A;  1Q3O A;  1IHJ A;  3O5N A;  1UEP A;  1N99 A;  2PKT A;  2ZPM A;  4NMQ A;  3HPM A;  1BFE A;  3EGG C;  5E11 A;  2RRM A;  1GQ5 A;  3MH4 A;  5G1D A;  1M5Z A;  3CBY A;  3SHU A;  5E21 A;  5HF1 A;  3JXT A;  5F67 A;  1KEF A;  2K20 A;  4GVC A;  4JOP A;  3MH7 A;  4O06 A;  1WJL A;  2EEG A;  2F0A A;  1TP5 A;  2KAW A;  5HET A;  1I92 A;  3STJ A;  4NMO A;  5HFE A;  4JOH A;  3AXA A;  3KDK A;  2OSG A;  2D90 A;  1Z86 A;  3O46 A;  1D5G A;  2DB5 A;  1I16 A;  1NTE A;  1ZOK A;  3VQF A;  3KDG A;  2K1Z A;  3GSL A;  1T2M A;  2LA8 A;  5JXB A;  5HFC A;  1X9Z A;  4JOF A;  5HEY A;  3K82 A;  1Z87 A;  1OZI A;  3WKM A;  4EDJ A;  1MFG A;  3VQG A;  1WHD A;  4JOE A;  1TE0 A;  3SUZ A;  2KL1 A;  3SOE A;  1UM1 A;  3FY5 A;  2OZF A;  2I6V A;  3I4W A;  2PZD A;  2I04 A;  2D92 A;  1FC7 A;  4NNM A;  3R0H A;  4KFV A;  2AWW A;  2VSV A;  2Z9I A;  2Z17 A;  3I18 A;  3DJA A;  3I1E A;  5EYZ A;  3GCO A;  2YTW A;  2GZV A;  4E3B A;  4NMV A;  3CC0 A;  4Q6S A;  3GGE A;  2KRG A;  5EZ0 A;  2EGN A;  4YDP A;  4E35 A;  1IU2 A;  2VRF A;  1N6D A;  4GVD A;  1SOZ A;  5A2P A;  1U38 A;  1ZUB A;  3ID3 A;  2L97 A;  3HVQ C;  1X5N A;  2M0U A;  2CS5 A;  4Q2Q A;  1BE9 A;  2EV8 A;  3LNX A;  3PV4 A;  3QE1 A;  4NXQ A;  5HF4 A;  3QO6 A;  3CBX A;  2FE5 A;  1X5Q A;  4Q6H A;  2LUI A;  4UU6 A;  3CBZ A;  1W9O A;  1N7E A;  2DM8 A;  3R69 A;  2JWE A;  1WFG A;  2EEJ A;  1QAU A;  3RL7 A;  1WG6 A;  1UJD A;  4FGM A;  1QAV A;  2AIN A;  1SOT A;  2MX6 A;  2VZ5 A;  1LCY A;  3CS0 A;  3GDS A;  4XHV A;  2EDV A;  2PNT A;  3ID1 A;  2AWX A;  1WF8 A;  5FHT A;  1FC9 A;  1OBX A;  2EEH A;  2W4F A;  4WYT A;  2OCS A;  3KZD A;  4P0C A;  1V6B A;  2M3M A;  2UZC A;  1OBZ A;  2X7Z A;  3NFK A;  4Q2O A;  2OS6 A;  5DTH A;  1Y7N A;  1PDR A;  4GHN A;  4PQW A;  2M0V A;  1RY4 A;  2QKT A;  1WH1 A;  2KV8 A;  2DLS A;  2PKU A;  1UEQ A;  1UM7 A;  2MHO A;  2M0Z A;  2JSN A;  1GQ4 A;  2F5Y A;  2KJP A;  2OGP A;  2DLU A;  3CH8 A;  2OPG A;  4UU5 A;  4Z8J A;  2PDZ A;  3NCV A;  2KBS A;  5E22 A;  3TSW A;  3ZRT A;  2V1W A;  4F8K A;  1QLC A;  1UIT A;  3NFL A;  2EEI A;  3PS4 A;  2KPL A;  2I1N A;  2IWQ A;  1KWA A;  4YYX A;  2H3M A;  3QIK A;  4Q3H A;  3GJ9 A;  1UJV A;  4NNL A;  3OTP A;  5HDY A;  3RL8 A;  3PDZ A;  4E34 A;  2WL7 A;  1UEW A;  2OMJ A;  1RZX A;  2P3W A;  2VSP A;  4KFW A;  1IU0 A;  1U39 A;  2DKR A;  1P1E A;  1X6D A;  4JL7 A;  1N6F A;  1XZ9 A;  2JIL A;  1W9Q A;  3QJN A;  5D13 A;  2HGA A;  2IWN A;  3WKL A;  4MPA A;  1WF7 A;  3KZE A;  4H11 A;  2KJD A;  5B6L A;  2D8I A;  1VB7 A;  1RGR A;  1FC6 A;  2YUB A;  3ID4 A;  4L8N A;  1RGW A;  3L4F D;  5GND A;  2JRE A;  1UEZ A;  2Q9V A;  5ILB A;  1X8S A;  3DJ3 A;  1UJU A;  5HED A;  2EHR A;  2EGO A;  2GEF A;  1V1T A;  1U37 A;  2DMZ A;  1MC7 A;  4NMR A;  2LOB A;  2VWR A;  3RLE A;  4JJ3 A;  4K76 A;  2KOJ A;  1TQ3 A;  4LMM A;  2AWU A;  3TSV A;  2JOA A;  2RCZ A;  2G5M B;  4OAJ A;  1K32 A;  4Z33 A;  3CYY A;  4K6Y A;  4IC6 A;  5E1Y A;  2PA1 A;  4JJ0 A;  2HE4 A;  3GAB A;  2EGK A;  1UFX A;  1V5L A;  4K78 A;  2DAZ A;  3TSZ A;  5HFD A;  3KHF A;  3PV2 A;  2L4T A;  3BPU A;  2KOH A;  2E7K A;  2KOM A;  3TMH A;  2CSS A;  1N7F A;  2KG2 A;  1WI2 A;  2EDZ A;  5I7Z A;  5HEB A;  1L6O A;  2DJT A;  2DC2 A;  5HJ1 A;  4G69 A;  5GLJ A;  3SFJ A;  4JOR A;  1VA8 A;  2EJY A;  5HFB A;  3SHW A;  1G9O A;  4R2Z A;  3GCN A;  2R3Y A;  5H3J A;  4P2A B;  5IL9 A;  1MFL A;  4NMT A;  4K72 A;  1U3B A;  1X45 A;  3GDV A;  4JOJ A;  2I0I A;  1V62 A;  2KQF A;  2KYL A;  3DJ1 A;  2KA9 A; 
#chains in the Genus database with same CATH homology
 3HPK A;  3ID2 A;  3EGH C;  3K1R A;  4NXP A;  1WI4 A;  4JOG A;  2L4S A;  4REY A;  3PDV A;  5HFF A;  1WFV A;  2EDP A;  1X5R A;  2HE2 A;  2CSJ A;  2V90 A;  2O2T A;  3E17 A;  4AMH A;  3QGL A;  4OEP A;  4Q2N A;  5FB8 C;  3QDO A;  1YBO A;  1P1D A;  5G1E A;  2YUY A;  4JOK A;  1VAE A;  1Q3P A;  2I0L A;  1Y8T A;  2JIN A;  3NGH A;  2W7R A;  2OQS A;  1WIF A;  5E6P B;  3K50 A;  3GDU A;  1Q7X A;  4HOP B;  2H2B A;  1UF1 A;  3B76 A;  1QAV B;  4K75 A;  2BYG A;  2QBW A;  4NMS A;  1VCW A;  1V5Q A;  1R6J A;  4Q2P A;  2EXG A;  2QG1 A;  2M0T A;  2REY A;  4N6X A;  2IWO A;  3DIW A;  2IWP A;  2KPK A;  2FN5 A;  2KJK A;  3MH6 A;  1B8Q A;  2R4H A;  1UHP A;  2LC6 A;  1KY9 A;  4RI0 A;  2I4S A;  2FNE A;  4FLN A;  2JIK A;  2ZPL A;  3DOR A;  1OBY A;  2QKV A;  2YT8 A;  2QKU A;  2Q3G A;  2YT7 A;  2QT5 A;  4OEO A;  5B42 A;  2M10 A;  2LC7 A;  3R68 A;  2ENO A;  2JXO A;  1N6E A;  2H3L A;  2H2C A;  1GM1 A;  2VPH A;  3QJM A;  4NXR A;  2G2L A;  1N7T A;  1FCF A;  1NF3 C;  2FCF A;  1WHA A;  4NMP A;  3PV5 A;  1VJ6 A;  5F3X A;  1TP3 A;  4WYU A;  1W9E A;  2EAQ A;  3LNY A;  4HOP A;  3OU0 A;  1Q3O A;  1IHJ A;  3O5N A;  1UEP A;  1N99 A;  2PKT A;  2ZPM A;  4NMQ A;  3HPM A;  1BFE A;  3EGG C;  5E11 A;  2RRM A;  1GQ5 A;  3MH4 A;  5G1D A;  1M5Z A;  3CBY A;  3SHU A;  5E21 A;  5HF1 A;  3JXT A;  5F67 A;  1KEF A;  2K20 A;  4GVC A;  4JOP A;  3MH7 A;  4O06 A;  1WJL A;  2EEG A;  2F0A A;  1TP5 A;  2KAW A;  5HET A;  1I92 A;  3STJ A;  4NMO A;  5HFE A;  4JOH A;  3AXA A;  3KDK A;  2OSG A;  2D90 A;  1Z86 A;  3O46 A;  1D5G A;  2DB5 A;  1I16 A;  1NTE A;  1ZOK A;  3VQF A;  3KDG A;  2K1Z A;  3GSL A;  1T2M A;  2LA8 A;  5JXB A;  5HFC A;  1X9Z A;  4JOF A;  5HEY A;  3K82 A;  1Z87 A;  1OZI A;  3WKM A;  4EDJ A;  1MFG A;  3VQG A;  1WHD A;  4JOE A;  1TE0 A;  3SUZ A;  2KL1 A;  3SOE A;  1UM1 A;  3FY5 A;  2OZF A;  2I6V A;  3I4W A;  2PZD A;  2I04 A;  2D92 A;  1FC7 A;  4NNM A;  3R0H A;  4KFV A;  2AWW A;  2VSV A;  2Z9I A;  2Z17 A;  3I18 A;  3DJA A;  3I1E A;  5EYZ A;  3GCO A;  2YTW A;  2GZV A;  4E3B A;  4NMV A;  3CC0 A;  4Q6S A;  3GGE A;  2KRG A;  5EZ0 A;  2EGN A;  4YDP A;  4E35 A;  1IU2 A;  2VRF A;  1N6D A;  4GVD A;  1SOZ A;  5A2P A;  1U38 A;  1ZUB A;  3ID3 A;  2L97 A;  3HVQ C;  1X5N A;  2M0U A;  2CS5 A;  4Q2Q A;  1BE9 A;  2EV8 A;  3LNX A;  3PV4 A;  3QE1 A;  4NXQ A;  5HF4 A;  3QO6 A;  3CBX A;  2FE5 A;  1X5Q A;  4Q6H A;  2LUI A;  4UU6 A;  3CBZ A;  1W9O A;  1N7E A;  2DM8 A;  3R69 A;  2JWE A;  1WFG A;  2EEJ A;  1QAU A;  3RL7 A;  1WG6 A;  1UJD A;  4FGM A;  1QAV A;  2AIN A;  1SOT A;  2MX6 A;  2VZ5 A;  1LCY A;  3CS0 A;  3GDS A;  4XHV A;  2EDV A;  2PNT A;  3ID1 A;  2AWX A;  1WF8 A;  5FHT A;  1FC9 A;  1OBX A;  2EEH A;  2W4F A;  4WYT A;  2OCS A;  3KZD A;  4P0C A;  1V6B A;  2M3M A;  2UZC A;  1OBZ A;  2X7Z A;  3NFK A;  4Q2O A;  2OS6 A;  5DTH A;  1Y7N A;  1PDR A;  4GHN A;  4PQW A;  2M0V A;  1RY4 A;  2QKT A;  1WH1 A;  2KV8 A;  2DLS A;  2PKU A;  1UEQ A;  1UM7 A;  2MHO A;  2M0Z A;  2JSN A;  1GQ4 A;  2F5Y A;  2KJP A;  2OGP A;  2DLU A;  3CH8 A;  2OPG A;  4UU5 A;  4Z8J A;  2PDZ A;  3NCV A;  2KBS A;  5E22 A;  3TSW A;  3ZRT A;  2V1W A;  4F8K A;  1QLC A;  1UIT A;  3NFL A;  2EEI A;  3PS4 A;  2KPL A;  2I1N A;  2IWQ A;  1KWA A;  4YYX A;  2H3M A;  3QIK A;  4Q3H A;  3GJ9 A;  1UJV A;  4NNL A;  3OTP A;  5HDY A;  3RL8 A;  3PDZ A;  4E34 A;  2WL7 A;  1UEW A;  2OMJ A;  1RZX A;  2P3W A;  2VSP A;  4KFW A;  1IU0 A;  1U39 A;  2DKR A;  1P1E A;  1X6D A;  4JL7 A;  1N6F A;  1XZ9 A;  2JIL A;  1W9Q A;  3QJN A;  5D13 A;  2HGA A;  2IWN A;  3WKL A;  4MPA A;  1WF7 A;  3KZE A;  4H11 A;  2KJD A;  5B6L A;  2D8I A;  1VB7 A;  1RGR A;  1FC6 A;  2YUB A;  3ID4 A;  4L8N A;  1RGW A;  3L4F D;  5GND A;  2JRE A;  1UEZ A;  2Q9V A;  5ILB A;  1X8S A;  3DJ3 A;  1UJU A;  5HED A;  2EHR A;  2EGO A;  2GEF A;  1V1T A;  1U37 A;  2DMZ A;  1MC7 A;  4NMR A;  2LOB A;  2VWR A;  3RLE A;  4JJ3 A;  4K76 A;  2KOJ A;  1TQ3 A;  4LMM A;  2AWU A;  3TSV A;  2JOA A;  2RCZ A;  2G5M B;  4OAJ A;  1K32 A;  4Z33 A;  3CYY A;  4K6Y A;  4IC6 A;  5E1Y A;  2PA1 A;  4JJ0 A;  2HE4 A;  3GAB A;  2EGK A;  1UFX A;  1V5L A;  4K78 A;  2DAZ A;  3TSZ A;  5HFD A;  3KHF A;  3PV2 A;  2L4T A;  3BPU A;  2KOH A;  2E7K A;  2KOM A;  3TMH A;  2CSS A;  1N7F A;  2KG2 A;  1WI2 A;  2EDZ A;  5I7Z A;  5HEB A;  1L6O A;  2DJT A;  2DC2 A;  5HJ1 A;  4G69 A;  5GLJ A;  3SFJ A;  4JOR A;  1VA8 A;  2EJY A;  5HFB A;  3SHW A;  1G9O A;  4R2Z A;  3GCN A;  2R3Y A;  5H3J A;  4P2A B;  5IL9 A;  1MFL A;  4NMT A;  4K72 A;  1U3B A;  1X45 A;  3GDV A;  4JOJ A;  2I0I A;  1V62 A;  2KQF A;  2KYL A;  3DJ1 A;  2KA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...