1ZOKA

Pdz1 domain of synapse associated protein 97
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
93
Chain Sequence
EYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic protein SAP97
publication title Structural Characterization of the Intermolecular Interactions of Synapse-associated Protein-97 with the NR2B Subunit of N-Methyl-D-aspartate Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 8
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1zokA00
1W9QA 2D90A 3MH7A 3QJNA 2H3MA 1UJUA 3DJ1A 1IU2A 4NMVA 1UM1A 4PQWA 4JOGA 4NXQA 5HETA 3DORA 5I7ZA 5HFDA 1OBYA 2KOHA 2QKVA 2R3YA 4HOPA 1WIFA 4GVDA 3RL8A 2W7RA 1M5ZA 3PS4A 3GDUA 3GDSA 4NMOA 1W9OA 3MH4A 1G9OA 2LC6A 3ZRTA 2DLUA 1UM7A 2CSJA 3GCNA 3STJA 3QDOA 1TP5A 3JXTA 2Q9VA 1U37A 4OEOA 2OZFA 3I1EA 2KJKA 1RY4A 2RCZA 5B6LA 4FGMA 4K6YA 2AINA 5E1YA 2UZCA 2EEGA 2YUBA 2X7ZA 1WFGA 3O46A 2KL1A 4NXPA 5DTHA 1UITA 4KFWA 1Y7NA 3ID4A 4E35A 1N7TA 1X6DA 3I18A 4G69A 2PNTA 3RLEA 3VQFA 2FN5A 4N6XA 2IWPA 5F3XA 2DB5A 1V1TA 1NF3C 2FE5A 3PDZA 2AWUA 2AWXA 2WL7A 1P1EA 1TE0A 5G1EA 2YUYA 4NNLA 3HPMA 3K50A 2PA1A 3LNXA 1X5QA 2OGPA 2KRGA 2M0TA 3NFKA 4K76A 2V90A 2KV8A 4Q2OA 2IWQA 3TSVA 3AXAA 2KAWA 1WHDA 2JINA 4NMQA 4O06A 1U39A 2HE4A 2QKTA 1R6JA 2LUIA 1SOZA 3R0HA 1IHJA 2VRFA 5F67A 5HEBA 3QO6A 1N6EA 3CBYA 2YTWA 3VQGA 4L8NA 4Q6HA 2ZPLA 5HFBA 3GCOA 1UJVA 1VB7A 2VWRA 3TSZA 2K1ZA 3L4FD 1MC7A 2IWOA 3CS0A 1W9EA 2KBSA 2G2LA 2QKUA 4KFVA 4WYTA 5HDYA 2M10A 2I0LA 3K82A 1QAUA 1VJ6A 2EEHA 2OPGA 3NGHA 2VPHA 2H2BA 3QIKA 4F8KA 3SOEA 2L97A 2P3WA 2EV8A 2LA8A 4UU5A 4JOEA 1WH1A 4Z8JA 1ZOKA 1FC7A 1X5NA 4GVCA 3PDVA 1FC6A 4WYUA 4Q2PA 2CS5A 4OAJA 1KWAA 3GSLA 2VSPA 1Z86A 4R2ZA 1WHAA 1XZ9A 4EDJA 3O5NA 1UEWA 1UEZA 2OSGA 5JXBA 2KPLA 2I0IA 3QGLA 5E21A 2M3MA 3GDVA 2LC7A 3B76A 4YDPA 2VSVA 2DM8A 1TQ3A 2D92A 2V1WA 4E34A 2K20A 3I4WA 2PDZA 2F0AA 2L4SA 4JOJA 2Z17A 1U38A 1X45A 3HPKA 5HEDA 1KEFA 2DKRA 4NMSA 2HE2A 2QBWA 1QAVB 2KOMA 3KHFA 1N6DA 3R68A 4LMMA 3EGHC 4IC6A 1FCFA 1VCWA 4UU6A 1UHPA 4K78A 1N7EA 1ZUBA 5D13A 4NNMA 2ENOA 2JXOA 1WG6A 3HVQC 2EDVA 2KG2A 4NMTA 1BE9A 2F5YA 1Z87A 4REYA 5E6PB 2O2TA 1TP3A 2JIKA 2ZPMA 1PDRA 4OEPA 4JL7A 3E17A 3SFJA 1K32A 3WKMA 5FHTA 1V62A 1WI2A 5HFEA 2CSSA 4H11A 2QT5A 1N99A 2AWWA 4P2AB 4JOKA 3TMHA 5HF4A 1MFGA 1RZXA 2KQFA 1IU0A 3GJ9A 2DAZA 4XHVA 3ID2A 1OBZA 4K75A 2L4TA 5EZ0A 2PKTA 1D5GA 2JWEA 2KPKA 2OMJA 4GHNA 1UFXA 4NXRA 1WF8A 4AMHA 5HJ1A 2EGKA 1QAVA 2REYA 1RGWA 1OBXA 2IWNA 4P0CA 1QLCA 1X8SA 4NMPA 2DC2A 5G1DA 1KY9A 4Q2NA 1WF7A 4Q3HA 2OS6A 2PKUA 3DJ3A 2GZVA 1MFLA 1U3BA 3KZDA 3RL7A 2W4FA 1OZIA 2LOBA 2I6VA 5E22A 2KJDA 2JILA 2BYGA 3OU0A 5A2PA 2EXGA 1V5QA 2EEIA 2MHOA 3CBXA 1L6OA 3MH6A 1UEQA 2I4SA 5HFCA 1V5LA 3ID1A 2D8IA 2EHRA 5GLJA 2H2CA 2Q3GA 3DJAA 1Q7XA 1Y8TA 3PV5A 4K72A 1GQ5A 3CBZA 3DIWA 2EDPA 5H3JA 4E3BA 4RI0A 3QE1A 4Q2QA 4NMRA 2M0ZA 2Z9IA 5EYZA 1Q3PA 2DMZA 1NTEA 2E7KA 2PZDA 4JOPA 4MPAA 2MX6A 2EGOA 1N7FA 1VA8A 3FY5A 1B8QA 1FC9A 2EJYA 2OQSA 3OTPA 1WFVA 3R69A 1GM1A 2QG1A 5FB8C 1WI4A 1I16A 2EDZA 2R4HA 2FNEA 3ID3A 5E11A 3CH8A 1Q3OA 2FCFA 2YT8A 2HGAA 5GNDA 2I1NA 3CYYA 3PV2A 1I92A 1V6BA 3GGEA 3SHWA 1P1DA 2VZ5A 3QJMA 2EGNA 1UJDA 4JORA 3NFLA 2OCSA 1T2MA 2EEJA 2YT7A 4HOPB 5HF1A 2H3LA 2DLSA 3SUZA 2I04A 4Q6SA 1SOTA 2M0VA 2KJPA 3EGGC 5HEYA 1VAEA 5HFFA 1YBOA 2G5MB 2M0UA 3K1RA 1N6FA 1LCYA 3LNYA 3TSWA 3BPUA 2KA9A 4JOHA 2RRMA 3SHUA 2KYLA 2DJTA 1RGRA 1UEPA 1UF1A 4JOFA 1GQ4A 3CC0A 1BFEA 2JOAA 2JREA 2EAQA 4Z33A 3PV4A 4YYXA 1WJLA 3KZEA 1X5RA 2KOJA 3WKLA
chains in the Genus database with same CATH superfamily
1W9QA 2D90A 3MH7A 3QJNA 2H3MA 1UJUA 3DJ1A 1IU2A 4NMVA 1UM1A 4PQWA 4JOGA 4NXQA 5HETA 3DORA 5I7ZA 5HFDA 1OBYA 2KOHA 2QKVA 2R3YA 4HOPA 1WIFA 4GVDA 3RL8A 2W7RA 2GEFA 1M5ZA 3PS4A 3GDUA 3GDSA 4NMOA 1W9OA 3MH4A 1G9OA 2LC6A 3ZRTA 2DLUA 1UM7A 2CSJA 3GCNA 3STJA 3QDOA 1TP5A 3JXTA 2Q9VA 1U37A 4OEOA 2OZFA 3I1EA 2KJKA 1RY4A 2RCZA 5B6LA 4FGMA 4K6YA 2AINA 5E1YA 2UZCA 2EEGA 2YUBA 2X7ZA 1WFGA 3O46A 2KL1A 4NXPA 5DTHA 1UITA 4KFWA 1Y7NA 3ID4A 4E35A 1N7TA 1X6DA 3I18A 4G69A 2PNTA 3RLEA 3VQFA 2FN5A 4N6XA 2IWPA 5B42A 5F3XA 2DB5A 1V1TA 1NF3C 2FE5A 3PDZA 2AWUA 2AWXA 2WL7A 1P1EA 1TE0A 5G1EA 2YUYA 4NNLA 3HPMA 3K50A 2PA1A 3LNXA 1X5QA 2OGPA 2KRGA 2M0TA 3NFKA 4K76A 2V90A 2KV8A 4Q2OA 2IWQA 3TSVA 3AXAA 2KAWA 1WHDA 3GABA 2JINA 4NMQA 4O06A 1U39A 2HE4A 2QKTA 1R6JA 2LUIA 1SOZA 3R0HA 1IHJA 2VRFA 5F67A 5HEBA 3QO6A 1N6EA 3CBYA 2YTWA 3VQGA 4L8NA 4Q6HA 2ZPLA 5HFBA 3GCOA 1UJVA 1VB7A 2VWRA 3TSZA 2K1ZA 3L4FD 1MC7A 2IWOA 3CS0A 1W9EA 2KBSA 2G2LA 2QKUA 4KFVA 4WYTA 5HDYA 2M10A 2I0LA 3K82A 1QAUA 1VJ6A 2EEHA 2OPGA 3NGHA 2VPHA 2H2BA 3QIKA 4F8KA 3SOEA 2L97A 2P3WA 2EV8A 2LA8A 4UU5A 4JOEA 1WH1A 4Z8JA 1ZOKA 1FC7A 1X5NA 4GVCA 3PDVA 1FC6A 4WYUA 4FLNA 4Q2PA 2CS5A 3KDGA 4OAJA 1KWAA 3GSLA 2VSPA 1Z86A 4R2ZA 1WHAA 1XZ9A 4EDJA 3O5NA 1UEWA 1UEZA 2OSGA 5JXBA 2KPLA 2I0IA 3QGLA 5E21A 2M3MA 3GDVA 2LC7A 3B76A 4YDPA 2VSVA 2DM8A 3KDKA 1TQ3A 2D92A 2V1WA 4E34A 2K20A 3I4WA 2PDZA 2F0AA 2L4SA 4JOJA 2Z17A 1U38A 1X45A 3HPKA 5HEDA 1KEFA 2DKRA 2JSNA 4NMSA 2HE2A 2QBWA 1QAVB 2KOMA 3KHFA 1N6DA 3R68A 4LMMA 3EGHC 4IC6A 1FCFA 1VCWA 4UU6A 1UHPA 4K78A 1N7EA 1ZUBA 5D13A 4NNMA 2ENOA 2JXOA 1WG6A 3HVQC 2EDVA 2KG2A 4NMTA 1BE9A 2F5YA 1Z87A 4REYA 5E6PB 2O2TA 1TP3A 2JIKA 2ZPMA 1PDRA 4OEPA 4JL7A 3E17A 3SFJA 1K32A 3WKMA 5FHTA 1V62A 1WI2A 5HFEA 2CSSA 4H11A 2QT5A 1N99A 2AWWA 4P2AB 4JOKA 3TMHA 5HF4A 1MFGA 1RZXA 2KQFA 1IU0A 3GJ9A 2DAZA 4XHVA 3ID2A 1OBZA 4K75A 2L4TA 5EZ0A 2PKTA 1D5GA 2JWEA 2KPKA 2OMJA 4GHNA 1UFXA 4NXRA 1WF8A 4AMHA 5HJ1A 2EGKA 1QAVA 2REYA 1RGWA 1OBXA 2IWNA 4P0CA 1QLCA 1X8SA 4NMPA 2DC2A 5G1DA 1KY9A 4Q2NA 1WF7A 4Q3HA 2OS6A 2PKUA 3DJ3A 2GZVA 1MFLA 1U3BA 3KZDA 3RL7A 2W4FA 1OZIA 2LOBA 2I6VA 5E22A 2KJDA 2JILA 2BYGA 3OU0A 5A2PA 2EXGA 1V5QA 2EEIA 1X9ZA 5ILBA 2MHOA 3CBXA 1L6OA 3MH6A 1UEQA 2I4SA 5HFCA 1V5LA 3ID1A 2D8IA 2EHRA 5GLJA 2H2CA 2Q3GA 3DJAA 1Q7XA 1Y8TA 4JJ0A 3PV5A 4K72A 1GQ5A 3CBZA 3DIWA 2EDPA 5H3JA 4E3BA 4RI0A 3QE1A 4Q2QA 4NMRA 2M0ZA 2Z9IA 5EYZA 1Q3PA 2DMZA 1NTEA 2E7KA 2PZDA 4JOPA 4MPAA 2MX6A 2EGOA 1N7FA 1VA8A 3FY5A 1B8QA 1FC9A 2EJYA 2OQSA 3OTPA 1WFVA 3R69A 1GM1A 2QG1A 5FB8C 1WI4A 1I16A 2EDZA 2R4HA 2FNEA 3ID3A 5E11A 3CH8A 1Q3OA 2FCFA 2YT8A 2HGAA 5GNDA 2I1NA 3CYYA 3PV2A 1I92A 1V6BA 3GGEA 3SHWA 1P1DA 2VZ5A 3QJMA 2EGNA 1UJDA 4JORA 3NFLA 2OCSA 1T2MA 2EEJA 2YT7A 4HOPB 5HF1A 2H3LA 2DLSA 3SUZA 2I04A 4Q6SA 1SOTA 2M0VA 2KJPA 3EGGC 5HEYA 1VAEA 5HFFA 1YBOA 2G5MB 2M0UA 3K1RA 1N6FA 4JJ3A 1LCYA 3LNYA 3TSWA 3BPUA 2KA9A 4JOHA 2RRMA 3SHUA 2KYLA 2DJTA 1RGRA 1UEPA 1UF1A 3NCVA 4JOFA 1GQ4A 3CC0A 1BFEA 2JOAA 2JREA 2EAQA 4Z33A 5IL9A 3PV4A 4YYXA 1WJLA 3KZEA 1X5RA 2KOJA 3WKLA
chains in the Genus database with same CATH topology
1W9QA 2D90A 3MH7A 3QJNA 2H3MA 1UJUA 3DJ1A 1IU2A 4NMVA 1UM1A 4PQWA 4JOGA 4NXQA 5HETA 3DORA 5I7ZA 5HFDA 1OBYA 2KOHA 2QKVA 2R3YA 4HOPA 1WIFA 4GVDA 3RL8A 2W7RA 2GEFA 1M5ZA 3PS4A 3GDUA 3GDSA 4NMOA 1W9OA 3MH4A 1G9OA 2LC6A 3ZRTA 2DLUA 1UM7A 2CSJA 3GCNA 3STJA 3QDOA 1TP5A 3JXTA 2Q9VA 1U37A 4OEOA 2OZFA 3I1EA 2KJKA 1RY4A 2RCZA 5B6LA 4FGMA 4K6YA 2AINA 5E1YA 2UZCA 2EEGA 2YUBA 2X7ZA 1WFGA 3O46A 2KL1A 4NXPA 5DTHA 1UITA 4KFWA 1Y7NA 3ID4A 4E35A 1N7TA 1X6DA 3I18A 4G69A 2PNTA 3RLEA 3VQFA 2FN5A 4N6XA 2IWPA 5B42A 5F3XA 2DB5A 1V1TA 1NF3C 2FE5A 3PDZA 2AWUA 2AWXA 2WL7A 1P1EA 1TE0A 5G1EA 2YUYA 4NNLA 3HPMA 3K50A 2PA1A 3LNXA 1X5QA 2OGPA 2KRGA 2M0TA 3NFKA 4K76A 2V90A 2KV8A 4Q2OA 2IWQA 3TSVA 3AXAA 2KAWA 1WHDA 3GABA 2JINA 4NMQA 4O06A 1U39A 2HE4A 2QKTA 1R6JA 2LUIA 1SOZA 3R0HA 1IHJA 2VRFA 5F67A 5HEBA 3QO6A 1N6EA 3CBYA 2YTWA 3VQGA 4L8NA 4Q6HA 2ZPLA 5HFBA 3GCOA 1UJVA 1VB7A 2VWRA 3TSZA 2K1ZA 3L4FD 1MC7A 2IWOA 3CS0A 1W9EA 2KBSA 2G2LA 2QKUA 4KFVA 4WYTA 5HDYA 2M10A 2I0LA 3K82A 1QAUA 1VJ6A 2EEHA 2OPGA 3NGHA 2VPHA 2H2BA 3QIKA 4F8KA 3SOEA 2L97A 2P3WA 2EV8A 2LA8A 4UU5A 4JOEA 1WH1A 4Z8JA 1ZOKA 1FC7A 1X5NA 4GVCA 3PDVA 1FC6A 4WYUA 4FLNA 4Q2PA 2CS5A 3KDGA 4OAJA 1KWAA 3GSLA 2VSPA 1Z86A 4R2ZA 1WHAA 1XZ9A 4EDJA 3O5NA 1UEWA 1UEZA 2OSGA 5JXBA 2KPLA 2I0IA 3QGLA 5E21A 2M3MA 3GDVA 2LC7A 3B76A 4YDPA 2VSVA 2DM8A 3KDKA 1TQ3A 2D92A 2V1WA 4E34A 2K20A 3I4WA 2PDZA 2F0AA 2L4SA 4JOJA 2Z17A 1U38A 1X45A 3HPKA 5HEDA 1KEFA 2DKRA 2JSNA 4NMSA 2HE2A 2QBWA 1QAVB 2KOMA 3KHFA 1N6DA 3R68A 4LMMA 3EGHC 4IC6A 1FCFA 1VCWA 4UU6A 1UHPA 4K78A 1N7EA 1ZUBA 5D13A 4NNMA 2ENOA 2JXOA 1WG6A 3HVQC 2EDVA 2KG2A 4NMTA 1BE9A 2F5YA 1Z87A 4REYA 5E6PB 2O2TA 1TP3A 2JIKA 2ZPMA 1PDRA 4OEPA 4JL7A 3E17A 3SFJA 1K32A 3WKMA 5FHTA 1V62A 1WI2A 5HFEA 2CSSA 4H11A 2QT5A 1N99A 2AWWA 4P2AB 4JOKA 3TMHA 5HF4A 1MFGA 1RZXA 2KQFA 1IU0A 3GJ9A 2DAZA 4XHVA 3ID2A 1OBZA 4K75A 2L4TA 5EZ0A 2PKTA 1D5GA 2JWEA 2KPKA 2OMJA 4GHNA 1UFXA 4NXRA 1WF8A 4AMHA 5HJ1A 2EGKA 1QAVA 2REYA 1RGWA 1OBXA 2IWNA 4P0CA 1QLCA 1X8SA 4NMPA 2DC2A 5G1DA 1KY9A 4Q2NA 1WF7A 4Q3HA 2OS6A 2PKUA 3DJ3A 2GZVA 1MFLA 1U3BA 3KZDA 3RL7A 2W4FA 1OZIA 2LOBA 2I6VA 5E22A 2KJDA 2JILA 2BYGA 3OU0A 5A2PA 2EXGA 1V5QA 2EEIA 1X9ZA 5ILBA 2MHOA 3CBXA 1L6OA 3MH6A 1UEQA 2I4SA 5HFCA 1V5LA 3ID1A 2D8IA 2EHRA 5GLJA 2H2CA 2Q3GA 3DJAA 1Q7XA 1Y8TA 4JJ0A 3PV5A 4K72A 1GQ5A 3CBZA 3DIWA 2EDPA 5H3JA 4E3BA 4RI0A 3QE1A 4Q2QA 4NMRA 2M0ZA 2Z9IA 5EYZA 1Q3PA 2DMZA 1NTEA 2E7KA 2PZDA 4JOPA 4MPAA 2MX6A 2EGOA 1N7FA 1VA8A 3FY5A 1B8QA 1FC9A 2EJYA 2OQSA 3OTPA 1WFVA 3R69A 1GM1A 2QG1A 5FB8C 1WI4A 1I16A 2EDZA 2R4HA 2FNEA 3ID3A 5E11A 3CH8A 1Q3OA 2FCFA 2YT8A 2HGAA 5GNDA 2I1NA 3CYYA 3PV2A 1I92A 1V6BA 3GGEA 3SHWA 1P1DA 2VZ5A 3QJMA 2EGNA 1UJDA 4JORA 3NFLA 2OCSA 1T2MA 2EEJA 2YT7A 4HOPB 5HF1A 2H3LA 2DLSA 3SUZA 2I04A 4Q6SA 1SOTA 2M0VA 2KJPA 3EGGC 5HEYA 1VAEA 5HFFA 1YBOA 2G5MB 2M0UA 3K1RA 1N6FA 4JJ3A 1LCYA 3LNYA 3TSWA 3BPUA 2KA9A 4JOHA 2RRMA 3SHUA 2KYLA 2DJTA 1RGRA 1UEPA 1UF1A 3NCVA 4JOFA 1GQ4A 3CC0A 1BFEA 2JOAA 2JREA 2EAQA 4Z33A 5IL9A 3PV4A 4YYXA 1WJLA 3KZEA 1X5RA 2KOJA 3WKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9Q A;  2D90 A;  3MH7 A;  3QJN A;  2H3M A;  1UJU A;  3DJ1 A;  1IU2 A;  4NMV A;  1UM1 A;  4PQW A;  4JOG A;  4NXQ A;  5HET A;  3DOR A;  5I7Z A;  5HFD A;  1OBY A;  2KOH A;  2QKV A;  2R3Y A;  4HOP A;  1WIF A;  4GVD A;  3RL8 A;  2W7R A;  1M5Z A;  3PS4 A;  3GDU A;  3GDS A;  4NMO A;  1W9O A;  3MH4 A;  1G9O A;  2LC6 A;  3ZRT A;  2DLU A;  1UM7 A;  2CSJ A;  3GCN A;  3STJ A;  3QDO A;  1TP5 A;  3JXT A;  2Q9V A;  1U37 A;  4OEO A;  2OZF A;  3I1E A;  2KJK A;  1RY4 A;  2RCZ A;  5B6L A;  4FGM A;  4K6Y A;  2AIN A;  5E1Y A;  2UZC A;  2EEG A;  2YUB A;  2X7Z A;  1WFG A;  3O46 A;  2KL1 A;  4NXP A;  5DTH A;  1UIT A;  4KFW A;  1Y7N A;  3ID4 A;  4E35 A;  1N7T A;  1X6D A;  3I18 A;  4G69 A;  2PNT A;  3RLE A;  3VQF A;  2FN5 A;  4N6X A;  2IWP A;  5F3X A;  2DB5 A;  1V1T A;  1NF3 C;  2FE5 A;  3PDZ A;  2AWU A;  2AWX A;  2WL7 A;  1P1E A;  1TE0 A;  5G1E A;  2YUY A;  4NNL A;  3HPM A;  3K50 A;  2PA1 A;  3LNX A;  1X5Q A;  2OGP A;  2KRG A;  2M0T A;  3NFK A;  4K76 A;  2V90 A;  2KV8 A;  4Q2O A;  2IWQ A;  3TSV A;  3AXA A;  2KAW A;  1WHD A;  2JIN A;  4NMQ A;  4O06 A;  1U39 A;  2HE4 A;  2QKT A;  1R6J A;  2LUI A;  1SOZ A;  3R0H A;  1IHJ A;  2VRF A;  5F67 A;  5HEB A;  3QO6 A;  1N6E A;  3CBY A;  2YTW A;  3VQG A;  4L8N A;  4Q6H A;  2ZPL A;  5HFB A;  3GCO A;  1UJV A;  1VB7 A;  2VWR A;  3TSZ A;  2K1Z A;  3L4F D;  1MC7 A;  2IWO A;  3CS0 A;  1W9E A;  2KBS A;  2G2L A;  2QKU A;  4KFV A;  4WYT A;  5HDY A;  2M10 A;  2I0L A;  3K82 A;  1QAU A;  1VJ6 A;  2EEH A;  2OPG A;  3NGH A;  2VPH A;  2H2B A;  3QIK A;  4F8K A;  3SOE A;  2L97 A;  2P3W A;  2EV8 A;  2LA8 A;  4UU5 A;  4JOE A;  1WH1 A;  4Z8J A;  1ZOK A;  1FC7 A;  1X5N A;  4GVC A;  3PDV A;  1FC6 A;  4WYU A;  4Q2P A;  2CS5 A;  4OAJ A;  1KWA A;  3GSL A;  2VSP A;  1Z86 A;  4R2Z A;  1WHA A;  1XZ9 A;  4EDJ A;  3O5N A;  1UEW A;  1UEZ A;  2OSG A;  5JXB A;  2KPL A;  2I0I A;  3QGL A;  5E21 A;  2M3M A;  3GDV A;  2LC7 A;  3B76 A;  4YDP A;  2VSV A;  2DM8 A;  1TQ3 A;  2D92 A;  2V1W A;  4E34 A;  2K20 A;  3I4W A;  2PDZ A;  2F0A A;  2L4S A;  4JOJ A;  2Z17 A;  1U38 A;  1X45 A;  3HPK A;  5HED A;  1KEF A;  2DKR A;  4NMS A;  2HE2 A;  2QBW A;  1QAV B;  2KOM A;  3KHF A;  1N6D A;  3R68 A;  4LMM A;  3EGH C;  4IC6 A;  1FCF A;  1VCW A;  4UU6 A;  1UHP A;  4K78 A;  1N7E A;  1ZUB A;  5D13 A;  4NNM A;  2ENO A;  2JXO A;  1WG6 A;  3HVQ C;  2EDV A;  2KG2 A;  4NMT A;  1BE9 A;  2F5Y A;  1Z87 A;  4REY A;  5E6P B;  2O2T A;  1TP3 A;  2JIK A;  2ZPM A;  1PDR A;  4OEP A;  4JL7 A;  3E17 A;  3SFJ A;  1K32 A;  3WKM A;  5FHT A;  1V62 A;  1WI2 A;  5HFE A;  2CSS A;  4H11 A;  2QT5 A;  1N99 A;  2AWW A;  4P2A B;  4JOK A;  3TMH A;  5HF4 A;  1MFG A;  1RZX A;  2KQF A;  1IU0 A;  3GJ9 A;  2DAZ A;  4XHV A;  3ID2 A;  1OBZ A;  4K75 A;  2L4T A;  5EZ0 A;  2PKT A;  1D5G A;  2JWE A;  2KPK A;  2OMJ A;  4GHN A;  1UFX A;  4NXR A;  1WF8 A;  4AMH A;  5HJ1 A;  2EGK A;  1QAV A;  2REY A;  1RGW A;  1OBX A;  2IWN A;  4P0C A;  1QLC A;  1X8S A;  4NMP A;  2DC2 A;  5G1D A;  1KY9 A;  4Q2N A;  1WF7 A;  4Q3H A;  2OS6 A;  2PKU A;  3DJ3 A;  2GZV A;  1MFL A;  1U3B A;  3KZD A;  3RL7 A;  2W4F A;  1OZI A;  2LOB A;  2I6V A;  5E22 A;  2KJD A;  2JIL A;  2BYG A;  3OU0 A;  5A2P A;  2EXG A;  1V5Q A;  2EEI A;  2MHO A;  3CBX A;  1L6O A;  3MH6 A;  1UEQ A;  2I4S A;  5HFC A;  1V5L A;  3ID1 A;  2D8I A;  2EHR A;  5GLJ A;  2H2C A;  2Q3G A;  3DJA A;  1Q7X A;  1Y8T A;  3PV5 A;  4K72 A;  1GQ5 A;  3CBZ A;  3DIW A;  2EDP A;  5H3J A;  4E3B A;  4RI0 A;  3QE1 A;  4Q2Q A;  4NMR A;  2M0Z A;  2Z9I A;  5EYZ A;  1Q3P A;  2DMZ A;  1NTE A;  2E7K A;  2PZD A;  4JOP A;  4MPA A;  2MX6 A;  2EGO A;  1N7F A;  1VA8 A;  3FY5 A;  1B8Q A;  1FC9 A;  2EJY A;  2OQS A;  3OTP A;  1WFV A;  3R69 A;  1GM1 A;  2QG1 A;  5FB8 C;  1WI4 A;  1I16 A;  2EDZ A;  2R4H A;  2FNE A;  3ID3 A;  5E11 A;  3CH8 A;  1Q3O A;  2FCF A;  2YT8 A;  2HGA A;  5GND A;  2I1N A;  3CYY A;  3PV2 A;  1I92 A;  1V6B A;  3GGE A;  3SHW A;  1P1D A;  2VZ5 A;  3QJM A;  2EGN A;  1UJD A;  4JOR A;  3NFL A;  2OCS A;  1T2M A;  2EEJ A;  2YT7 A;  4HOP B;  5HF1 A;  2H3L A;  2DLS A;  3SUZ A;  2I04 A;  4Q6S A;  1SOT A;  2M0V A;  2KJP A;  3EGG C;  5HEY A;  1VAE A;  5HFF A;  1YBO A;  2G5M B;  2M0U A;  3K1R A;  1N6F A;  1LCY A;  3LNY A;  3TSW A;  3BPU A;  2KA9 A;  4JOH A;  2RRM A;  3SHU A;  2KYL A;  2DJT A;  1RGR A;  1UEP A;  1UF1 A;  4JOF A;  1GQ4 A;  3CC0 A;  1BFE A;  2JOA A;  2JRE A;  2EAQ A;  4Z33 A;  3PV4 A;  4YYX A;  1WJL A;  3KZE A;  1X5R A;  2KOJ A;  3WKL A; 
#chains in the Genus database with same CATH topology
 1W9Q A;  2D90 A;  3MH7 A;  3QJN A;  2H3M A;  1UJU A;  3DJ1 A;  1IU2 A;  4NMV A;  1UM1 A;  4PQW A;  4JOG A;  4NXQ A;  5HET A;  3DOR A;  5I7Z A;  5HFD A;  1OBY A;  2KOH A;  2QKV A;  2R3Y A;  4HOP A;  1WIF A;  4GVD A;  3RL8 A;  2W7R A;  2GEF A;  1M5Z A;  3PS4 A;  3GDU A;  3GDS A;  4NMO A;  1W9O A;  3MH4 A;  1G9O A;  2LC6 A;  3ZRT A;  2DLU A;  1UM7 A;  2CSJ A;  3GCN A;  3STJ A;  3QDO A;  1TP5 A;  3JXT A;  2Q9V A;  1U37 A;  4OEO A;  2OZF A;  3I1E A;  2KJK A;  1RY4 A;  2RCZ A;  5B6L A;  4FGM A;  4K6Y A;  2AIN A;  5E1Y A;  2UZC A;  2EEG A;  2YUB A;  2X7Z A;  1WFG A;  3O46 A;  2KL1 A;  4NXP A;  5DTH A;  1UIT A;  4KFW A;  1Y7N A;  3ID4 A;  4E35 A;  1N7T A;  1X6D A;  3I18 A;  4G69 A;  2PNT A;  3RLE A;  3VQF A;  2FN5 A;  4N6X A;  2IWP A;  5B42 A;  5F3X A;  2DB5 A;  1V1T A;  1NF3 C;  2FE5 A;  3PDZ A;  2AWU A;  2AWX A;  2WL7 A;  1P1E A;  1TE0 A;  5G1E A;  2YUY A;  4NNL A;  3HPM A;  3K50 A;  2PA1 A;  3LNX A;  1X5Q A;  2OGP A;  2KRG A;  2M0T A;  3NFK A;  4K76 A;  2V90 A;  2KV8 A;  4Q2O A;  2IWQ A;  3TSV A;  3AXA A;  2KAW A;  1WHD A;  3GAB A;  2JIN A;  4NMQ A;  4O06 A;  1U39 A;  2HE4 A;  2QKT A;  1R6J A;  2LUI A;  1SOZ A;  3R0H A;  1IHJ A;  2VRF A;  5F67 A;  5HEB A;  3QO6 A;  1N6E A;  3CBY A;  2YTW A;  3VQG A;  4L8N A;  4Q6H A;  2ZPL A;  5HFB A;  3GCO A;  1UJV A;  1VB7 A;  2VWR A;  3TSZ A;  2K1Z A;  3L4F D;  1MC7 A;  2IWO A;  3CS0 A;  1W9E A;  2KBS A;  2G2L A;  2QKU A;  4KFV A;  4WYT A;  5HDY A;  2M10 A;  2I0L A;  3K82 A;  1QAU A;  1VJ6 A;  2EEH A;  2OPG A;  3NGH A;  2VPH A;  2H2B A;  3QIK A;  4F8K A;  3SOE A;  2L97 A;  2P3W A;  2EV8 A;  2LA8 A;  4UU5 A;  4JOE A;  1WH1 A;  4Z8J A;  1ZOK A;  1FC7 A;  1X5N A;  4GVC A;  3PDV A;  1FC6 A;  4WYU A;  4FLN A;  4Q2P A;  2CS5 A;  3KDG A;  4OAJ A;  1KWA A;  3GSL A;  2VSP A;  1Z86 A;  4R2Z A;  1WHA A;  1XZ9 A;  4EDJ A;  3O5N A;  1UEW A;  1UEZ A;  2OSG A;  5JXB A;  2KPL A;  2I0I A;  3QGL A;  5E21 A;  2M3M A;  3GDV A;  2LC7 A;  3B76 A;  4YDP A;  2VSV A;  2DM8 A;  3KDK A;  1TQ3 A;  2D92 A;  2V1W A;  4E34 A;  2K20 A;  3I4W A;  2PDZ A;  2F0A A;  2L4S A;  4JOJ A;  2Z17 A;  1U38 A;  1X45 A;  3HPK A;  5HED A;  1KEF A;  2DKR A;  2JSN A;  4NMS A;  2HE2 A;  2QBW A;  1QAV B;  2KOM A;  3KHF A;  1N6D A;  3R68 A;  4LMM A;  3EGH C;  4IC6 A;  1FCF A;  1VCW A;  4UU6 A;  1UHP A;  4K78 A;  1N7E A;  1ZUB A;  5D13 A;  4NNM A;  2ENO A;  2JXO A;  1WG6 A;  3HVQ C;  2EDV A;  2KG2 A;  4NMT A;  1BE9 A;  2F5Y A;  1Z87 A;  4REY A;  5E6P B;  2O2T A;  1TP3 A;  2JIK A;  2ZPM A;  1PDR A;  4OEP A;  4JL7 A;  3E17 A;  3SFJ A;  1K32 A;  3WKM A;  5FHT A;  1V62 A;  1WI2 A;  5HFE A;  2CSS A;  4H11 A;  2QT5 A;  1N99 A;  2AWW A;  4P2A B;  4JOK A;  3TMH A;  5HF4 A;  1MFG A;  1RZX A;  2KQF A;  1IU0 A;  3GJ9 A;  2DAZ A;  4XHV A;  3ID2 A;  1OBZ A;  4K75 A;  2L4T A;  5EZ0 A;  2PKT A;  1D5G A;  2JWE A;  2KPK A;  2OMJ A;  4GHN A;  1UFX A;  4NXR A;  1WF8 A;  4AMH A;  5HJ1 A;  2EGK A;  1QAV A;  2REY A;  1RGW A;  1OBX A;  2IWN A;  4P0C A;  1QLC A;  1X8S A;  4NMP A;  2DC2 A;  5G1D A;  1KY9 A;  4Q2N A;  1WF7 A;  4Q3H A;  2OS6 A;  2PKU A;  3DJ3 A;  2GZV A;  1MFL A;  1U3B A;  3KZD A;  3RL7 A;  2W4F A;  1OZI A;  2LOB A;  2I6V A;  5E22 A;  2KJD A;  2JIL A;  2BYG A;  3OU0 A;  5A2P A;  2EXG A;  1V5Q A;  2EEI A;  1X9Z A;  5ILB A;  2MHO A;  3CBX A;  1L6O A;  3MH6 A;  1UEQ A;  2I4S A;  5HFC A;  1V5L A;  3ID1 A;  2D8I A;  2EHR A;  5GLJ A;  2H2C A;  2Q3G A;  3DJA A;  1Q7X A;  1Y8T A;  4JJ0 A;  3PV5 A;  4K72 A;  1GQ5 A;  3CBZ A;  3DIW A;  2EDP A;  5H3J A;  4E3B A;  4RI0 A;  3QE1 A;  4Q2Q A;  4NMR A;  2M0Z A;  2Z9I A;  5EYZ A;  1Q3P A;  2DMZ A;  1NTE A;  2E7K A;  2PZD A;  4JOP A;  4MPA A;  2MX6 A;  2EGO A;  1N7F A;  1VA8 A;  3FY5 A;  1B8Q A;  1FC9 A;  2EJY A;  2OQS A;  3OTP A;  1WFV A;  3R69 A;  1GM1 A;  2QG1 A;  5FB8 C;  1WI4 A;  1I16 A;  2EDZ A;  2R4H A;  2FNE A;  3ID3 A;  5E11 A;  3CH8 A;  1Q3O A;  2FCF A;  2YT8 A;  2HGA A;  5GND A;  2I1N A;  3CYY A;  3PV2 A;  1I92 A;  1V6B A;  3GGE A;  3SHW A;  1P1D A;  2VZ5 A;  3QJM A;  2EGN A;  1UJD A;  4JOR A;  3NFL A;  2OCS A;  1T2M A;  2EEJ A;  2YT7 A;  4HOP B;  5HF1 A;  2H3L A;  2DLS A;  3SUZ A;  2I04 A;  4Q6S A;  1SOT A;  2M0V A;  2KJP A;  3EGG C;  5HEY A;  1VAE A;  5HFF A;  1YBO A;  2G5M B;  2M0U A;  3K1R A;  1N6F A;  4JJ3 A;  1LCY A;  3LNY A;  3TSW A;  3BPU A;  2KA9 A;  4JOH A;  2RRM A;  3SHU A;  2KYL A;  2DJT A;  1RGR A;  1UEP A;  1UF1 A;  3NCV A;  4JOF A;  1GQ4 A;  3CC0 A;  1BFE A;  2JOA A;  2JRE A;  2EAQ A;  4Z33 A;  5IL9 A;  3PV4 A;  4YYX A;  1WJL A;  3KZE A;  1X5R A;  2KOJ A;  3WKL A; 
#chains in the Genus database with same CATH homology
 1W9Q A;  2D90 A;  3MH7 A;  3QJN A;  2H3M A;  1UJU A;  3DJ1 A;  1IU2 A;  4NMV A;  1UM1 A;  4PQW A;  4JOG A;  4NXQ A;  5HET A;  3DOR A;  5I7Z A;  5HFD A;  1OBY A;  2KOH A;  2QKV A;  2R3Y A;  4HOP A;  1WIF A;  4GVD A;  3RL8 A;  2W7R A;  2GEF A;  1M5Z A;  3PS4 A;  3GDU A;  3GDS A;  4NMO A;  1W9O A;  3MH4 A;  1G9O A;  2LC6 A;  3ZRT A;  2DLU A;  1UM7 A;  2CSJ A;  3GCN A;  3STJ A;  3QDO A;  1TP5 A;  3JXT A;  2Q9V A;  1U37 A;  4OEO A;  2OZF A;  3I1E A;  2KJK A;  1RY4 A;  2RCZ A;  5B6L A;  4FGM A;  4K6Y A;  2AIN A;  5E1Y A;  2UZC A;  2EEG A;  2YUB A;  2X7Z A;  1WFG A;  3O46 A;  2KL1 A;  4NXP A;  5DTH A;  1UIT A;  4KFW A;  1Y7N A;  3ID4 A;  4E35 A;  1N7T A;  1X6D A;  3I18 A;  4G69 A;  2PNT A;  3RLE A;  3VQF A;  2FN5 A;  4N6X A;  2IWP A;  5B42 A;  5F3X A;  2DB5 A;  1V1T A;  1NF3 C;  2FE5 A;  3PDZ A;  2AWU A;  2AWX A;  2WL7 A;  1P1E A;  1TE0 A;  5G1E A;  2YUY A;  4NNL A;  3HPM A;  3K50 A;  2PA1 A;  3LNX A;  1X5Q A;  2OGP A;  2KRG A;  2M0T A;  3NFK A;  4K76 A;  2V90 A;  2KV8 A;  4Q2O A;  2IWQ A;  3TSV A;  3AXA A;  2KAW A;  1WHD A;  3GAB A;  2JIN A;  4NMQ A;  4O06 A;  1U39 A;  2HE4 A;  2QKT A;  1R6J A;  2LUI A;  1SOZ A;  3R0H A;  1IHJ A;  2VRF A;  5F67 A;  5HEB A;  3QO6 A;  1N6E A;  3CBY A;  2YTW A;  3VQG A;  4L8N A;  4Q6H A;  2ZPL A;  5HFB A;  3GCO A;  1UJV A;  1VB7 A;  2VWR A;  3TSZ A;  2K1Z A;  3L4F D;  1MC7 A;  2IWO A;  3CS0 A;  1W9E A;  2KBS A;  2G2L A;  2QKU A;  4KFV A;  4WYT A;  5HDY A;  2M10 A;  2I0L A;  3K82 A;  1QAU A;  1VJ6 A;  2EEH A;  2OPG A;  3NGH A;  2VPH A;  2H2B A;  3QIK A;  4F8K A;  3SOE A;  2L97 A;  2P3W A;  2EV8 A;  2LA8 A;  4UU5 A;  4JOE A;  1WH1 A;  4Z8J A;  1ZOK A;  1FC7 A;  1X5N A;  4GVC A;  3PDV A;  1FC6 A;  4WYU A;  4FLN A;  4Q2P A;  2CS5 A;  3KDG A;  4OAJ A;  1KWA A;  3GSL A;  2VSP A;  1Z86 A;  4R2Z A;  1WHA A;  1XZ9 A;  4EDJ A;  3O5N A;  1UEW A;  1UEZ A;  2OSG A;  5JXB A;  2KPL A;  2I0I A;  3QGL A;  5E21 A;  2M3M A;  3GDV A;  2LC7 A;  3B76 A;  4YDP A;  2VSV A;  2DM8 A;  3KDK A;  1TQ3 A;  2D92 A;  2V1W A;  4E34 A;  2K20 A;  3I4W A;  2PDZ A;  2F0A A;  2L4S A;  4JOJ A;  2Z17 A;  1U38 A;  1X45 A;  3HPK A;  5HED A;  1KEF A;  2DKR A;  2JSN A;  4NMS A;  2HE2 A;  2QBW A;  1QAV B;  2KOM A;  3KHF A;  1N6D A;  3R68 A;  4LMM A;  3EGH C;  4IC6 A;  1FCF A;  1VCW A;  4UU6 A;  1UHP A;  4K78 A;  1N7E A;  1ZUB A;  5D13 A;  4NNM A;  2ENO A;  2JXO A;  1WG6 A;  3HVQ C;  2EDV A;  2KG2 A;  4NMT A;  1BE9 A;  2F5Y A;  1Z87 A;  4REY A;  5E6P B;  2O2T A;  1TP3 A;  2JIK A;  2ZPM A;  1PDR A;  4OEP A;  4JL7 A;  3E17 A;  3SFJ A;  1K32 A;  3WKM A;  5FHT A;  1V62 A;  1WI2 A;  5HFE A;  2CSS A;  4H11 A;  2QT5 A;  1N99 A;  2AWW A;  4P2A B;  4JOK A;  3TMH A;  5HF4 A;  1MFG A;  1RZX A;  2KQF A;  1IU0 A;  3GJ9 A;  2DAZ A;  4XHV A;  3ID2 A;  1OBZ A;  4K75 A;  2L4T A;  5EZ0 A;  2PKT A;  1D5G A;  2JWE A;  2KPK A;  2OMJ A;  4GHN A;  1UFX A;  4NXR A;  1WF8 A;  4AMH A;  5HJ1 A;  2EGK A;  1QAV A;  2REY A;  1RGW A;  1OBX A;  2IWN A;  4P0C A;  1QLC A;  1X8S A;  4NMP A;  2DC2 A;  5G1D A;  1KY9 A;  4Q2N A;  1WF7 A;  4Q3H A;  2OS6 A;  2PKU A;  3DJ3 A;  2GZV A;  1MFL A;  1U3B A;  3KZD A;  3RL7 A;  2W4F A;  1OZI A;  2LOB A;  2I6V A;  5E22 A;  2KJD A;  2JIL A;  2BYG A;  3OU0 A;  5A2P A;  2EXG A;  1V5Q A;  2EEI A;  1X9Z A;  5ILB A;  2MHO A;  3CBX A;  1L6O A;  3MH6 A;  1UEQ A;  2I4S A;  5HFC A;  1V5L A;  3ID1 A;  2D8I A;  2EHR A;  5GLJ A;  2H2C A;  2Q3G A;  3DJA A;  1Q7X A;  1Y8T A;  4JJ0 A;  3PV5 A;  4K72 A;  1GQ5 A;  3CBZ A;  3DIW A;  2EDP A;  5H3J A;  4E3B A;  4RI0 A;  3QE1 A;  4Q2Q A;  4NMR A;  2M0Z A;  2Z9I A;  5EYZ A;  1Q3P A;  2DMZ A;  1NTE A;  2E7K A;  2PZD A;  4JOP A;  4MPA A;  2MX6 A;  2EGO A;  1N7F A;  1VA8 A;  3FY5 A;  1B8Q A;  1FC9 A;  2EJY A;  2OQS A;  3OTP A;  1WFV A;  3R69 A;  1GM1 A;  2QG1 A;  5FB8 C;  1WI4 A;  1I16 A;  2EDZ A;  2R4H A;  2FNE A;  3ID3 A;  5E11 A;  3CH8 A;  1Q3O A;  2FCF A;  2YT8 A;  2HGA A;  5GND A;  2I1N A;  3CYY A;  3PV2 A;  1I92 A;  1V6B A;  3GGE A;  3SHW A;  1P1D A;  2VZ5 A;  3QJM A;  2EGN A;  1UJD A;  4JOR A;  3NFL A;  2OCS A;  1T2M A;  2EEJ A;  2YT7 A;  4HOP B;  5HF1 A;  2H3L A;  2DLS A;  3SUZ A;  2I04 A;  4Q6S A;  1SOT A;  2M0V A;  2KJP A;  3EGG C;  5HEY A;  1VAE A;  5HFF A;  1YBO A;  2G5M B;  2M0U A;  3K1R A;  1N6F A;  4JJ3 A;  1LCY A;  3LNY A;  3TSW A;  3BPU A;  2KA9 A;  4JOH A;  2RRM A;  3SHU A;  2KYL A;  2DJT A;  1RGR A;  1UEP A;  1UF1 A;  3NCV A;  4JOF A;  1GQ4 A;  3CC0 A;  1BFE A;  2JOA A;  2JRE A;  2EAQ A;  4Z33 A;  5IL9 A;  3PV4 A;  4YYX A;  1WJL A;  3KZE A;  1X5R A;  2KOJ A;  3WKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...