2I0IA

X-ray crystal structure of sap97 pdz3 bound to the c-terminal peptide of hpv18 e6
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
EPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 13
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i0iA00
2OPGA 2EDZA 3MH6A 4L8NA 2KJPA 2D90A 2LOBA 4E35A 2OCSA 3SUZA 4K72A 1TQ3A 2QBWA 2M3MA 1QAUA 4YDPA 1P1DA 1B8QA 3DJ1A 2JIKA 1VA8A 1Q3PA 5E6PB 4Z33A 3RL8A 4F8KA 4YYXA 2VSPA 3NGHA 2I04A 3QE1A 2QT5A 4PQWA 2KBSA 5HJ1A 5F67A 1RGRA 2QG1A 1SOZA 4Q2QA 2KG2A 2PNTA 3TSVA 2EHRA 1N99A 1WHDA 3I4WA 2W4FA 3CYYA 1WG6A 4NXPA 4NNMA 4K76A 4NMVA 3TSZA 2KA9A 4Q6HA 1KY9A 1U38A 1WHAA 3R68A 4K78A 2DLUA 2H3MA 4P2AB 5HFEA 3DORA 2O2TA 4WYUA 1UJVA 3K1RA 3CBXA 1MFGA 5G1EA 4Q6SA 4N6XA 3RLEA 2YT7A 2QKUA 2F0AA 1UEWA 2KYLA 2W7RA 5E22A 3HPMA 3GDVA 1ZUBA 2DJTA 3PS4A 4HOPA 2HE2A 3HPKA 1WI2A 2AWXA 2M0ZA 1IU0A 1OZIA 1RGWA 3PV2A 2KPLA 1Q3OA 2ZPLA 2EV8A 3CH8A 2M0VA 4E34A 2OMJA 4NXQA 2JWEA 4K6YA 3SHWA 3ID2A 4JOFA 1UEQA 3MH7A 1V62A 3B76A 1SOTA 4REYA 2EGOA 2G2LA 2I4SA 2VZ5A 5G1DA 1PDRA 5HEBA 4WYTA 5GLJA 5FB8C 5EZ0A 2V90A 4KFVA 3K50A 2RCZA 1TE0A 1FC7A 1WF7A 4O06A 4NMPA 2PDZA 1GQ5A 3I18A 1LCYA 2OSGA 4NMRA 2K20A 2DC2A 1K32A 2K1ZA 3EGHC 2P3WA 5H3JA 2I0LA 4JOHA 3PDZA 1GM1A 2FNEA 3R69A 2AWUA 1X5NA 1Z86A 4GVCA 2PKUA 3QJMA 3HVQC 2EJYA 1QLCA 2YTWA 2DB5A 2E7KA 2BYGA 1R6JA 4NMOA 4R2ZA 2H2CA 1W9QA 2I1NA 2JREA 1TP3A 3DJAA 3ID4A 5A2PA 2IWOA 2EXGA 1GQ4A 1L6OA 1KWAA 1OBXA 1BE9A 3GDUA 3KZDA 4E3BA 1WI4A 1QAVB 2YT8A 3QIKA 4G69A 1RZXA 2KQFA 3TSWA 1W9OA 2FCFA 2CS5A 1N7FA 2H2BA 5HFFA 3CBYA 1QAVA 5HF4A 5I7ZA 2EAQA 5B6LA 3L4FD 3PV4A 1Y7NA 1UM1A 3KHFA 2EDPA 3E17A 2REYA 4OEOA 2VWRA 3LNYA 1UITA 1YBOA 1TP5A 1X8SA 3KZEA 4NMQA 2KOHA 2JOAA 3AXAA 3GSLA 2KL1A 4IC6A 1FC9A 2G5MB 3WKMA 4Q2PA 2M0UA 2ENOA 1X45A 1G9OA 2R3YA 2IWQA 4JORA 2V1WA 3WKLA 2AWWA 5HEDA 4RI0A 1FC6A 2Q9VA 1X5RA 3PV5A 3DJ3A 1M5ZA 1FCFA 1W9EA 1N6FA 2YUBA 2WL7A 4JOEA 5F3XA 2KJKA 1V6BA 3OU0A 1U37A 2M10A 5E11A 1WJLA 2Z17A 1N6DA 3GCOA 3GDSA 3I1EA 2DLSA 1XZ9A 2IWNA 2EGKA 2KOMA 3RL7A 2EEIA 3TMHA 2EEJA 2I0IA 4XHVA 2KPKA 2VPHA 2KOJA 1RY4A 5EYZA 2PKTA 2Q3GA 2R4HA 4P0CA 4K75A 5E21A 2JXOA 2I6VA 3JXTA 2FN5A 2DKRA 4JOKA 3VQFA 3ID1A 3CC0A 2OZFA 2OGPA 5FHTA 3QGLA 3GJ9A 1X6DA 2CSJA 4Q3HA 2JINA 2L4SA 4NNLA 2L4TA 1UM7A 1WIFA 1WFGA 3NFKA 1MC7A 3GGEA 2DM8A 2HE4A 5HF1A 2PA1A 1X5QA 4EDJA 2H3LA 1UHPA 1KEFA 4NMSA 2IWPA 2PZDA 2KV8A 2EDVA 5DTHA 2UZCA 5HFBA 3NFLA 5HEYA 2Z9IA 1VCWA 1NTEA 3QDOA 2LA8A 2KAWA 2ZPMA 5HDYA 3MH4A 4AMHA 1ZOKA 2OS6A 4OEPA 4Z8JA 2JILA 2EGNA 2QKVA 2MX6A 4JOPA 2D92A 2FE5A 2EEGA 3STJA 1UJUA 2EEHA 3QO6A 1N7TA 1T2MA 2OQSA 2F5YA 3GCNA 1WFVA 4UU5A 5D13A 2HGAA 3K82A 1WH1A 1N7EA 3VQGA 1VJ6A 5HETA 2DMZA 2LUIA 2VRFA 2KRGA 4Q2OA 3SHUA 1I92A 3SOEA 1Y8TA 1UFXA 2QKTA 1I16A 1Z87A 2L97A 4HOPB 2DAZA 5HFDA 4UU6A 5GNDA 1V1TA 4NMTA 1VAEA 2LC6A 4GHNA 3R0HA 1VB7A 4KFWA 4H11A 4NXRA 3ZRTA 1IHJA 1P1EA 4MPAA 1UF1A 2LC7A 1MFLA 2YUYA 3EGGC 5HFCA 2D8IA 4Q2NA 3OTPA 3QJNA 3CBZA 1V5LA 2RRMA 3DIWA 3O46A 1NF3C 3LNXA 1Q7XA 5JXBA 2KJDA 2M0TA 1U3BA 1N6EA 2VSVA 4GVDA 1U39A 2CSSA 1UEZA 5E1YA 1UEPA 3BPUA 4JL7A 4FGMA 2AINA 4OAJA 1UJDA 1BFEA 2MHOA 2X7ZA 3SFJA 4JOJA 1V5QA 1IU2A 1D5GA 1OBZA 3CS0A 3PDVA 3ID3A 2GZVA 1OBYA 3FY5A 4LMMA 4JOGA 3O5NA 1WF8A
chains in the Genus database with same CATH superfamily
2OPGA 2EDZA 3MH6A 3KDGA 4L8NA 2KJPA 2D90A 2LOBA 4E35A 2OCSA 3SUZA 4K72A 1TQ3A 2QBWA 2M3MA 1QAUA 4YDPA 1P1DA 1B8QA 3DJ1A 2JIKA 1VA8A 1Q3PA 5E6PB 4Z33A 5B42A 3RL8A 4F8KA 4YYXA 2VSPA 3NGHA 2I04A 3QE1A 2QT5A 4PQWA 2KBSA 5HJ1A 5F67A 1RGRA 2QG1A 1SOZA 4Q2QA 2KG2A 2PNTA 3TSVA 2EHRA 1N99A 1WHDA 3I4WA 2W4FA 3CYYA 1WG6A 4JJ3A 4NXPA 4NNMA 4K76A 4NMVA 3TSZA 2KA9A 4Q6HA 1KY9A 1U38A 1WHAA 3R68A 4K78A 2DLUA 2H3MA 4P2AB 5HFEA 3DORA 2O2TA 4WYUA 1UJVA 3K1RA 3CBXA 1MFGA 5G1EA 4Q6SA 4N6XA 3RLEA 2YT7A 2QKUA 2F0AA 1UEWA 2KYLA 2W7RA 5E22A 3HPMA 3GDVA 1ZUBA 2DJTA 3PS4A 4HOPA 2HE2A 3HPKA 1WI2A 2AWXA 2M0ZA 1IU0A 1OZIA 1RGWA 3PV2A 2KPLA 1Q3OA 2ZPLA 2EV8A 3CH8A 2M0VA 4E34A 2OMJA 4NXQA 2JWEA 4K6YA 3SHWA 3ID2A 4JOFA 1UEQA 3MH7A 1V62A 3B76A 1SOTA 4REYA 2EGOA 2G2LA 2I4SA 2VZ5A 5G1DA 1PDRA 2JSNA 5HEBA 3KDKA 4WYTA 5GLJA 5FB8C 5EZ0A 2V90A 4KFVA 3K50A 2RCZA 1TE0A 1FC7A 1WF7A 4O06A 4NMPA 2PDZA 1GQ5A 3I18A 1LCYA 2OSGA 4NMRA 2K20A 2DC2A 1K32A 2K1ZA 3EGHC 2P3WA 5H3JA 2I0LA 5IL9A 4JOHA 3PDZA 1GM1A 2FNEA 3R69A 2AWUA 1X5NA 1Z86A 4GVCA 2PKUA 3QJMA 3HVQC 2EJYA 1QLCA 2YTWA 2DB5A 2E7KA 2BYGA 1R6JA 4NMOA 4R2ZA 2H2CA 1W9QA 2I1NA 2JREA 1TP3A 3DJAA 3ID4A 5A2PA 2IWOA 2EXGA 1GQ4A 1L6OA 1KWAA 1OBXA 1BE9A 3GDUA 3KZDA 4E3BA 1WI4A 1QAVB 2YT8A 3QIKA 4G69A 1RZXA 2KQFA 3TSWA 1W9OA 2FCFA 2CS5A 1N7FA 2H2BA 5HFFA 3CBYA 1QAVA 3GABA 4JJ0A 5HF4A 5I7ZA 2EAQA 5B6LA 3L4FD 3PV4A 1Y7NA 1UM1A 3KHFA 2EDPA 3E17A 5ILBA 2REYA 4OEOA 2VWRA 3LNYA 1UITA 1YBOA 1TP5A 1X8SA 3KZEA 4NMQA 2KOHA 2JOAA 3AXAA 3GSLA 2KL1A 4IC6A 1FC9A 2G5MB 3WKMA 4Q2PA 2M0UA 2ENOA 1X45A 1G9OA 2R3YA 2IWQA 4JORA 2V1WA 3WKLA 2AWWA 5HEDA 4RI0A 1FC6A 2Q9VA 1X5RA 3PV5A 3DJ3A 1M5ZA 1FCFA 1W9EA 1N6FA 2YUBA 2WL7A 4JOEA 5F3XA 2KJKA 1V6BA 3OU0A 1U37A 2M10A 5E11A 1WJLA 2Z17A 1N6DA 3GCOA 3GDSA 3I1EA 2DLSA 1XZ9A 2IWNA 2EGKA 2KOMA 3RL7A 2EEIA 3TMHA 2EEJA 2I0IA 4XHVA 2KPKA 2VPHA 2KOJA 1RY4A 5EYZA 2PKTA 2Q3GA 2R4HA 4P0CA 4K75A 5E21A 2JXOA 2I6VA 3JXTA 2FN5A 2DKRA 4JOKA 3VQFA 3ID1A 3CC0A 2OZFA 2OGPA 5FHTA 3QGLA 3GJ9A 1X6DA 2CSJA 4Q3HA 2JINA 2L4SA 4NNLA 2L4TA 1UM7A 1WIFA 1WFGA 3NFKA 1MC7A 3GGEA 2DM8A 2HE4A 5HF1A 2PA1A 1X5QA 4EDJA 2H3LA 1UHPA 1KEFA 4NMSA 2IWPA 2PZDA 2KV8A 2EDVA 5DTHA 2UZCA 5HFBA 3NFLA 5HEYA 2Z9IA 1VCWA 1NTEA 3QDOA 2LA8A 2KAWA 2ZPMA 5HDYA 3MH4A 4AMHA 1ZOKA 2OS6A 4OEPA 4Z8JA 2JILA 2EGNA 2QKVA 2MX6A 4JOPA 2D92A 2FE5A 2EEGA 1X9ZA 1UJUA 3STJA 2EEHA 2GEFA 3QO6A 1N7TA 1T2MA 2OQSA 2F5YA 3GCNA 1WFVA 4UU5A 5D13A 2HGAA 3K82A 1WH1A 1N7EA 3VQGA 1VJ6A 5HETA 2DMZA 2LUIA 2VRFA 2KRGA 4Q2OA 3SHUA 1I92A 3SOEA 1Y8TA 1UFXA 2QKTA 1I16A 1Z87A 2L97A 4HOPB 2DAZA 5HFDA 4UU6A 5GNDA 1V1TA 4NMTA 1VAEA 2LC6A 4GHNA 3R0HA 1VB7A 4KFWA 4H11A 4NXRA 3ZRTA 1IHJA 1P1EA 4MPAA 1UF1A 2LC7A 1MFLA 2YUYA 3EGGC 5HFCA 2D8IA 4Q2NA 3OTPA 3QJNA 3CBZA 1V5LA 2RRMA 3DIWA 3O46A 1NF3C 3LNXA 1Q7XA 5JXBA 2KJDA 4FLNA 2M0TA 1U3BA 1N6EA 2VSVA 4GVDA 3NCVA 1U39A 2CSSA 1UEZA 5E1YA 1UEPA 3BPUA 4JL7A 4FGMA 2AINA 4OAJA 1UJDA 1BFEA 2MHOA 2X7ZA 3SFJA 4JOJA 1V5QA 1IU2A 1D5GA 1OBZA 3CS0A 3PDVA 3ID3A 2GZVA 1OBYA 3FY5A 4LMMA 4JOGA 3O5NA 1WF8A
chains in the Genus database with same CATH topology
2OPGA 2EDZA 3MH6A 3KDGA 4L8NA 2KJPA 2D90A 2LOBA 4E35A 2OCSA 3SUZA 4K72A 1TQ3A 2QBWA 2M3MA 1QAUA 4YDPA 1P1DA 1B8QA 3DJ1A 2JIKA 1VA8A 1Q3PA 5E6PB 4Z33A 5B42A 3RL8A 4F8KA 4YYXA 2VSPA 3NGHA 2I04A 3QE1A 2QT5A 4PQWA 2KBSA 5HJ1A 5F67A 1RGRA 2QG1A 1SOZA 4Q2QA 2KG2A 2PNTA 3TSVA 2EHRA 1N99A 1WHDA 3I4WA 2W4FA 3CYYA 1WG6A 4JJ3A 4NXPA 4NNMA 4K76A 4NMVA 3TSZA 2KA9A 4Q6HA 1KY9A 1U38A 1WHAA 3R68A 4K78A 2DLUA 2H3MA 4P2AB 5HFEA 3DORA 2O2TA 4WYUA 1UJVA 3K1RA 3CBXA 1MFGA 5G1EA 4Q6SA 4N6XA 3RLEA 2YT7A 2QKUA 2F0AA 1UEWA 2KYLA 2W7RA 5E22A 3HPMA 3GDVA 1ZUBA 2DJTA 3PS4A 4HOPA 2HE2A 3HPKA 1WI2A 2AWXA 2M0ZA 1IU0A 1OZIA 1RGWA 3PV2A 2KPLA 1Q3OA 2ZPLA 2EV8A 3CH8A 2M0VA 4E34A 2OMJA 4NXQA 2JWEA 4K6YA 3SHWA 3ID2A 4JOFA 1UEQA 3MH7A 1V62A 3B76A 1SOTA 4REYA 2EGOA 2G2LA 2I4SA 2VZ5A 5G1DA 1PDRA 2JSNA 5HEBA 3KDKA 4WYTA 5GLJA 5FB8C 5EZ0A 2V90A 4KFVA 3K50A 2RCZA 1TE0A 1FC7A 1WF7A 4O06A 4NMPA 2PDZA 1GQ5A 3I18A 1LCYA 2OSGA 4NMRA 2K20A 2DC2A 1K32A 2K1ZA 3EGHC 2P3WA 5H3JA 2I0LA 5IL9A 4JOHA 3PDZA 1GM1A 2FNEA 3R69A 2AWUA 1X5NA 1Z86A 4GVCA 2PKUA 3QJMA 3HVQC 2EJYA 1QLCA 2YTWA 2DB5A 2E7KA 2BYGA 1R6JA 4NMOA 4R2ZA 2H2CA 1W9QA 2I1NA 2JREA 1TP3A 3DJAA 3ID4A 5A2PA 2IWOA 2EXGA 1GQ4A 1L6OA 1KWAA 1OBXA 1BE9A 3GDUA 3KZDA 4E3BA 1WI4A 1QAVB 2YT8A 3QIKA 4G69A 1RZXA 2KQFA 3TSWA 1W9OA 2FCFA 2CS5A 1N7FA 2H2BA 5HFFA 3CBYA 1QAVA 3GABA 4JJ0A 5HF4A 5I7ZA 2EAQA 5B6LA 3L4FD 3PV4A 1Y7NA 1UM1A 3KHFA 2EDPA 3E17A 5ILBA 2REYA 4OEOA 2VWRA 3LNYA 1UITA 1YBOA 1TP5A 1X8SA 3KZEA 4NMQA 2KOHA 2JOAA 3AXAA 3GSLA 2KL1A 4IC6A 1FC9A 2G5MB 3WKMA 4Q2PA 2M0UA 2ENOA 1X45A 1G9OA 2R3YA 2IWQA 4JORA 2V1WA 3WKLA 2AWWA 5HEDA 4RI0A 1FC6A 2Q9VA 1X5RA 3PV5A 3DJ3A 1M5ZA 1FCFA 1W9EA 1N6FA 2YUBA 2WL7A 4JOEA 5F3XA 2KJKA 1V6BA 3OU0A 1U37A 2M10A 5E11A 1WJLA 2Z17A 1N6DA 3GCOA 3GDSA 3I1EA 2DLSA 1XZ9A 2IWNA 2EGKA 2KOMA 3RL7A 2EEIA 3TMHA 2EEJA 2I0IA 4XHVA 2KPKA 2VPHA 2KOJA 1RY4A 5EYZA 2PKTA 2Q3GA 2R4HA 4P0CA 4K75A 5E21A 2JXOA 2I6VA 3JXTA 2FN5A 2DKRA 4JOKA 3VQFA 3ID1A 3CC0A 2OZFA 2OGPA 5FHTA 3QGLA 3GJ9A 1X6DA 2CSJA 4Q3HA 2JINA 2L4SA 4NNLA 2L4TA 1UM7A 1WIFA 1WFGA 3NFKA 1MC7A 3GGEA 2DM8A 2HE4A 5HF1A 2PA1A 1X5QA 4EDJA 2H3LA 1UHPA 1KEFA 4NMSA 2IWPA 2PZDA 2KV8A 2EDVA 5DTHA 2UZCA 5HFBA 3NFLA 5HEYA 2Z9IA 1VCWA 1NTEA 3QDOA 2LA8A 2KAWA 2ZPMA 5HDYA 3MH4A 4AMHA 1ZOKA 2OS6A 4OEPA 4Z8JA 2JILA 2EGNA 2QKVA 2MX6A 4JOPA 2D92A 2FE5A 2EEGA 1X9ZA 1UJUA 3STJA 2EEHA 2GEFA 3QO6A 1N7TA 1T2MA 2OQSA 2F5YA 3GCNA 1WFVA 4UU5A 5D13A 2HGAA 3K82A 1WH1A 1N7EA 3VQGA 1VJ6A 5HETA 2DMZA 2LUIA 2VRFA 2KRGA 4Q2OA 3SHUA 1I92A 3SOEA 1Y8TA 1UFXA 2QKTA 1I16A 1Z87A 2L97A 4HOPB 2DAZA 5HFDA 4UU6A 5GNDA 1V1TA 4NMTA 1VAEA 2LC6A 4GHNA 3R0HA 1VB7A 4KFWA 4H11A 4NXRA 3ZRTA 1IHJA 1P1EA 4MPAA 1UF1A 2LC7A 1MFLA 2YUYA 3EGGC 5HFCA 2D8IA 4Q2NA 3OTPA 3QJNA 3CBZA 1V5LA 2RRMA 3DIWA 3O46A 1NF3C 3LNXA 1Q7XA 5JXBA 2KJDA 4FLNA 2M0TA 1U3BA 1N6EA 2VSVA 4GVDA 3NCVA 1U39A 2CSSA 1UEZA 5E1YA 1UEPA 3BPUA 4JL7A 4FGMA 2AINA 4OAJA 1UJDA 1BFEA 2MHOA 2X7ZA 3SFJA 4JOJA 1V5QA 1IU2A 1D5GA 1OBZA 3CS0A 3PDVA 3ID3A 2GZVA 1OBYA 3FY5A 4LMMA 4JOGA 3O5NA 1WF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPG A;  2EDZ A;  3MH6 A;  4L8N A;  2KJP A;  2D90 A;  2LOB A;  4E35 A;  2OCS A;  3SUZ A;  4K72 A;  1TQ3 A;  2QBW A;  2M3M A;  1QAU A;  4YDP A;  1P1D A;  1B8Q A;  3DJ1 A;  2JIK A;  1VA8 A;  1Q3P A;  5E6P B;  4Z33 A;  3RL8 A;  4F8K A;  4YYX A;  2VSP A;  3NGH A;  2I04 A;  3QE1 A;  2QT5 A;  4PQW A;  2KBS A;  5HJ1 A;  5F67 A;  1RGR A;  2QG1 A;  1SOZ A;  4Q2Q A;  2KG2 A;  2PNT A;  3TSV A;  2EHR A;  1N99 A;  1WHD A;  3I4W A;  2W4F A;  3CYY A;  1WG6 A;  4NXP A;  4NNM A;  4K76 A;  4NMV A;  3TSZ A;  2KA9 A;  4Q6H A;  1KY9 A;  1U38 A;  1WHA A;  3R68 A;  4K78 A;  2DLU A;  2H3M A;  4P2A B;  5HFE A;  3DOR A;  2O2T A;  4WYU A;  1UJV A;  3K1R A;  3CBX A;  1MFG A;  5G1E A;  4Q6S A;  4N6X A;  3RLE A;  2YT7 A;  2QKU A;  2F0A A;  1UEW A;  2KYL A;  2W7R A;  5E22 A;  3HPM A;  3GDV A;  1ZUB A;  2DJT A;  3PS4 A;  4HOP A;  2HE2 A;  3HPK A;  1WI2 A;  2AWX A;  2M0Z A;  1IU0 A;  1OZI A;  1RGW A;  3PV2 A;  2KPL A;  1Q3O A;  2ZPL A;  2EV8 A;  3CH8 A;  2M0V A;  4E34 A;  2OMJ A;  4NXQ A;  2JWE A;  4K6Y A;  3SHW A;  3ID2 A;  4JOF A;  1UEQ A;  3MH7 A;  1V62 A;  3B76 A;  1SOT A;  4REY A;  2EGO A;  2G2L A;  2I4S A;  2VZ5 A;  5G1D A;  1PDR A;  5HEB A;  4WYT A;  5GLJ A;  5FB8 C;  5EZ0 A;  2V90 A;  4KFV A;  3K50 A;  2RCZ A;  1TE0 A;  1FC7 A;  1WF7 A;  4O06 A;  4NMP A;  2PDZ A;  1GQ5 A;  3I18 A;  1LCY A;  2OSG A;  4NMR A;  2K20 A;  2DC2 A;  1K32 A;  2K1Z A;  3EGH C;  2P3W A;  5H3J A;  2I0L A;  4JOH A;  3PDZ A;  1GM1 A;  2FNE A;  3R69 A;  2AWU A;  1X5N A;  1Z86 A;  4GVC A;  2PKU A;  3QJM A;  3HVQ C;  2EJY A;  1QLC A;  2YTW A;  2DB5 A;  2E7K A;  2BYG A;  1R6J A;  4NMO A;  4R2Z A;  2H2C A;  1W9Q A;  2I1N A;  2JRE A;  1TP3 A;  3DJA A;  3ID4 A;  5A2P A;  2IWO A;  2EXG A;  1GQ4 A;  1L6O A;  1KWA A;  1OBX A;  1BE9 A;  3GDU A;  3KZD A;  4E3B A;  1WI4 A;  1QAV B;  2YT8 A;  3QIK A;  4G69 A;  1RZX A;  2KQF A;  3TSW A;  1W9O A;  2FCF A;  2CS5 A;  1N7F A;  2H2B A;  5HFF A;  3CBY A;  1QAV A;  5HF4 A;  5I7Z A;  2EAQ A;  5B6L A;  3L4F D;  3PV4 A;  1Y7N A;  1UM1 A;  3KHF A;  2EDP A;  3E17 A;  2REY A;  4OEO A;  2VWR A;  3LNY A;  1UIT A;  1YBO A;  1TP5 A;  1X8S A;  3KZE A;  4NMQ A;  2KOH A;  2JOA A;  3AXA A;  3GSL A;  2KL1 A;  4IC6 A;  1FC9 A;  2G5M B;  3WKM A;  4Q2P A;  2M0U A;  2ENO A;  1X45 A;  1G9O A;  2R3Y A;  2IWQ A;  4JOR A;  2V1W A;  3WKL A;  2AWW A;  5HED A;  4RI0 A;  1FC6 A;  2Q9V A;  1X5R A;  3PV5 A;  3DJ3 A;  1M5Z A;  1FCF A;  1W9E A;  1N6F A;  2YUB A;  2WL7 A;  4JOE A;  5F3X A;  2KJK A;  1V6B A;  3OU0 A;  1U37 A;  2M10 A;  5E11 A;  1WJL A;  2Z17 A;  1N6D A;  3GCO A;  3GDS A;  3I1E A;  2DLS A;  1XZ9 A;  2IWN A;  2EGK A;  2KOM A;  3RL7 A;  2EEI A;  3TMH A;  2EEJ A;  2I0I A;  4XHV A;  2KPK A;  2VPH A;  2KOJ A;  1RY4 A;  5EYZ A;  2PKT A;  2Q3G A;  2R4H A;  4P0C A;  4K75 A;  5E21 A;  2JXO A;  2I6V A;  3JXT A;  2FN5 A;  2DKR A;  4JOK A;  3VQF A;  3ID1 A;  3CC0 A;  2OZF A;  2OGP A;  5FHT A;  3QGL A;  3GJ9 A;  1X6D A;  2CSJ A;  4Q3H A;  2JIN A;  2L4S A;  4NNL A;  2L4T A;  1UM7 A;  1WIF A;  1WFG A;  3NFK A;  1MC7 A;  3GGE A;  2DM8 A;  2HE4 A;  5HF1 A;  2PA1 A;  1X5Q A;  4EDJ A;  2H3L A;  1UHP A;  1KEF A;  4NMS A;  2IWP A;  2PZD A;  2KV8 A;  2EDV A;  5DTH A;  2UZC A;  5HFB A;  3NFL A;  5HEY A;  2Z9I A;  1VCW A;  1NTE A;  3QDO A;  2LA8 A;  2KAW A;  2ZPM A;  5HDY A;  3MH4 A;  4AMH A;  1ZOK A;  2OS6 A;  4OEP A;  4Z8J A;  2JIL A;  2EGN A;  2QKV A;  2MX6 A;  4JOP A;  2D92 A;  2FE5 A;  2EEG A;  3STJ A;  1UJU A;  2EEH A;  3QO6 A;  1N7T A;  1T2M A;  2OQS A;  2F5Y A;  3GCN A;  1WFV A;  4UU5 A;  5D13 A;  2HGA A;  3K82 A;  1WH1 A;  1N7E A;  3VQG A;  1VJ6 A;  5HET A;  2DMZ A;  2LUI A;  2VRF A;  2KRG A;  4Q2O A;  3SHU A;  1I92 A;  3SOE A;  1Y8T A;  1UFX A;  2QKT A;  1I16 A;  1Z87 A;  2L97 A;  4HOP B;  2DAZ A;  5HFD A;  4UU6 A;  5GND A;  1V1T A;  4NMT A;  1VAE A;  2LC6 A;  4GHN A;  3R0H A;  1VB7 A;  4KFW A;  4H11 A;  4NXR A;  3ZRT A;  1IHJ A;  1P1E A;  4MPA A;  1UF1 A;  2LC7 A;  1MFL A;  2YUY A;  3EGG C;  5HFC A;  2D8I A;  4Q2N A;  3OTP A;  3QJN A;  3CBZ A;  1V5L A;  2RRM A;  3DIW A;  3O46 A;  1NF3 C;  3LNX A;  1Q7X A;  5JXB A;  2KJD A;  2M0T A;  1U3B A;  1N6E A;  2VSV A;  4GVD A;  1U39 A;  2CSS A;  1UEZ A;  5E1Y A;  1UEP A;  3BPU A;  4JL7 A;  4FGM A;  2AIN A;  4OAJ A;  1UJD A;  1BFE A;  2MHO A;  2X7Z A;  3SFJ A;  4JOJ A;  1V5Q A;  1IU2 A;  1D5G A;  1OBZ A;  3CS0 A;  3PDV A;  3ID3 A;  2GZV A;  1OBY A;  3FY5 A;  4LMM A;  4JOG A;  3O5N A;  1WF8 A; 
#chains in the Genus database with same CATH topology
 2OPG A;  2EDZ A;  3MH6 A;  3KDG A;  4L8N A;  2KJP A;  2D90 A;  2LOB A;  4E35 A;  2OCS A;  3SUZ A;  4K72 A;  1TQ3 A;  2QBW A;  2M3M A;  1QAU A;  4YDP A;  1P1D A;  1B8Q A;  3DJ1 A;  2JIK A;  1VA8 A;  1Q3P A;  5E6P B;  4Z33 A;  5B42 A;  3RL8 A;  4F8K A;  4YYX A;  2VSP A;  3NGH A;  2I04 A;  3QE1 A;  2QT5 A;  4PQW A;  2KBS A;  5HJ1 A;  5F67 A;  1RGR A;  2QG1 A;  1SOZ A;  4Q2Q A;  2KG2 A;  2PNT A;  3TSV A;  2EHR A;  1N99 A;  1WHD A;  3I4W A;  2W4F A;  3CYY A;  1WG6 A;  4JJ3 A;  4NXP A;  4NNM A;  4K76 A;  4NMV A;  3TSZ A;  2KA9 A;  4Q6H A;  1KY9 A;  1U38 A;  1WHA A;  3R68 A;  4K78 A;  2DLU A;  2H3M A;  4P2A B;  5HFE A;  3DOR A;  2O2T A;  4WYU A;  1UJV A;  3K1R A;  3CBX A;  1MFG A;  5G1E A;  4Q6S A;  4N6X A;  3RLE A;  2YT7 A;  2QKU A;  2F0A A;  1UEW A;  2KYL A;  2W7R A;  5E22 A;  3HPM A;  3GDV A;  1ZUB A;  2DJT A;  3PS4 A;  4HOP A;  2HE2 A;  3HPK A;  1WI2 A;  2AWX A;  2M0Z A;  1IU0 A;  1OZI A;  1RGW A;  3PV2 A;  2KPL A;  1Q3O A;  2ZPL A;  2EV8 A;  3CH8 A;  2M0V A;  4E34 A;  2OMJ A;  4NXQ A;  2JWE A;  4K6Y A;  3SHW A;  3ID2 A;  4JOF A;  1UEQ A;  3MH7 A;  1V62 A;  3B76 A;  1SOT A;  4REY A;  2EGO A;  2G2L A;  2I4S A;  2VZ5 A;  5G1D A;  1PDR A;  2JSN A;  5HEB A;  3KDK A;  4WYT A;  5GLJ A;  5FB8 C;  5EZ0 A;  2V90 A;  4KFV A;  3K50 A;  2RCZ A;  1TE0 A;  1FC7 A;  1WF7 A;  4O06 A;  4NMP A;  2PDZ A;  1GQ5 A;  3I18 A;  1LCY A;  2OSG A;  4NMR A;  2K20 A;  2DC2 A;  1K32 A;  2K1Z A;  3EGH C;  2P3W A;  5H3J A;  2I0L A;  5IL9 A;  4JOH A;  3PDZ A;  1GM1 A;  2FNE A;  3R69 A;  2AWU A;  1X5N A;  1Z86 A;  4GVC A;  2PKU A;  3QJM A;  3HVQ C;  2EJY A;  1QLC A;  2YTW A;  2DB5 A;  2E7K A;  2BYG A;  1R6J A;  4NMO A;  4R2Z A;  2H2C A;  1W9Q A;  2I1N A;  2JRE A;  1TP3 A;  3DJA A;  3ID4 A;  5A2P A;  2IWO A;  2EXG A;  1GQ4 A;  1L6O A;  1KWA A;  1OBX A;  1BE9 A;  3GDU A;  3KZD A;  4E3B A;  1WI4 A;  1QAV B;  2YT8 A;  3QIK A;  4G69 A;  1RZX A;  2KQF A;  3TSW A;  1W9O A;  2FCF A;  2CS5 A;  1N7F A;  2H2B A;  5HFF A;  3CBY A;  1QAV A;  3GAB A;  4JJ0 A;  5HF4 A;  5I7Z A;  2EAQ A;  5B6L A;  3L4F D;  3PV4 A;  1Y7N A;  1UM1 A;  3KHF A;  2EDP A;  3E17 A;  5ILB A;  2REY A;  4OEO A;  2VWR A;  3LNY A;  1UIT A;  1YBO A;  1TP5 A;  1X8S A;  3KZE A;  4NMQ A;  2KOH A;  2JOA A;  3AXA A;  3GSL A;  2KL1 A;  4IC6 A;  1FC9 A;  2G5M B;  3WKM A;  4Q2P A;  2M0U A;  2ENO A;  1X45 A;  1G9O A;  2R3Y A;  2IWQ A;  4JOR A;  2V1W A;  3WKL A;  2AWW A;  5HED A;  4RI0 A;  1FC6 A;  2Q9V A;  1X5R A;  3PV5 A;  3DJ3 A;  1M5Z A;  1FCF A;  1W9E A;  1N6F A;  2YUB A;  2WL7 A;  4JOE A;  5F3X A;  2KJK A;  1V6B A;  3OU0 A;  1U37 A;  2M10 A;  5E11 A;  1WJL A;  2Z17 A;  1N6D A;  3GCO A;  3GDS A;  3I1E A;  2DLS A;  1XZ9 A;  2IWN A;  2EGK A;  2KOM A;  3RL7 A;  2EEI A;  3TMH A;  2EEJ A;  2I0I A;  4XHV A;  2KPK A;  2VPH A;  2KOJ A;  1RY4 A;  5EYZ A;  2PKT A;  2Q3G A;  2R4H A;  4P0C A;  4K75 A;  5E21 A;  2JXO A;  2I6V A;  3JXT A;  2FN5 A;  2DKR A;  4JOK A;  3VQF A;  3ID1 A;  3CC0 A;  2OZF A;  2OGP A;  5FHT A;  3QGL A;  3GJ9 A;  1X6D A;  2CSJ A;  4Q3H A;  2JIN A;  2L4S A;  4NNL A;  2L4T A;  1UM7 A;  1WIF A;  1WFG A;  3NFK A;  1MC7 A;  3GGE A;  2DM8 A;  2HE4 A;  5HF1 A;  2PA1 A;  1X5Q A;  4EDJ A;  2H3L A;  1UHP A;  1KEF A;  4NMS A;  2IWP A;  2PZD A;  2KV8 A;  2EDV A;  5DTH A;  2UZC A;  5HFB A;  3NFL A;  5HEY A;  2Z9I A;  1VCW A;  1NTE A;  3QDO A;  2LA8 A;  2KAW A;  2ZPM A;  5HDY A;  3MH4 A;  4AMH A;  1ZOK A;  2OS6 A;  4OEP A;  4Z8J A;  2JIL A;  2EGN A;  2QKV A;  2MX6 A;  4JOP A;  2D92 A;  2FE5 A;  2EEG A;  1X9Z A;  1UJU A;  3STJ A;  2EEH A;  2GEF A;  3QO6 A;  1N7T A;  1T2M A;  2OQS A;  2F5Y A;  3GCN A;  1WFV A;  4UU5 A;  5D13 A;  2HGA A;  3K82 A;  1WH1 A;  1N7E A;  3VQG A;  1VJ6 A;  5HET A;  2DMZ A;  2LUI A;  2VRF A;  2KRG A;  4Q2O A;  3SHU A;  1I92 A;  3SOE A;  1Y8T A;  1UFX A;  2QKT A;  1I16 A;  1Z87 A;  2L97 A;  4HOP B;  2DAZ A;  5HFD A;  4UU6 A;  5GND A;  1V1T A;  4NMT A;  1VAE A;  2LC6 A;  4GHN A;  3R0H A;  1VB7 A;  4KFW A;  4H11 A;  4NXR A;  3ZRT A;  1IHJ A;  1P1E A;  4MPA A;  1UF1 A;  2LC7 A;  1MFL A;  2YUY A;  3EGG C;  5HFC A;  2D8I A;  4Q2N A;  3OTP A;  3QJN A;  3CBZ A;  1V5L A;  2RRM A;  3DIW A;  3O46 A;  1NF3 C;  3LNX A;  1Q7X A;  5JXB A;  2KJD A;  4FLN A;  2M0T A;  1U3B A;  1N6E A;  2VSV A;  4GVD A;  3NCV A;  1U39 A;  2CSS A;  1UEZ A;  5E1Y A;  1UEP A;  3BPU A;  4JL7 A;  4FGM A;  2AIN A;  4OAJ A;  1UJD A;  1BFE A;  2MHO A;  2X7Z A;  3SFJ A;  4JOJ A;  1V5Q A;  1IU2 A;  1D5G A;  1OBZ A;  3CS0 A;  3PDV A;  3ID3 A;  2GZV A;  1OBY A;  3FY5 A;  4LMM A;  4JOG A;  3O5N A;  1WF8 A; 
#chains in the Genus database with same CATH homology
 2OPG A;  2EDZ A;  3MH6 A;  3KDG A;  4L8N A;  2KJP A;  2D90 A;  2LOB A;  4E35 A;  2OCS A;  3SUZ A;  4K72 A;  1TQ3 A;  2QBW A;  2M3M A;  1QAU A;  4YDP A;  1P1D A;  1B8Q A;  3DJ1 A;  2JIK A;  1VA8 A;  1Q3P A;  5E6P B;  4Z33 A;  5B42 A;  3RL8 A;  4F8K A;  4YYX A;  2VSP A;  3NGH A;  2I04 A;  3QE1 A;  2QT5 A;  4PQW A;  2KBS A;  5HJ1 A;  5F67 A;  1RGR A;  2QG1 A;  1SOZ A;  4Q2Q A;  2KG2 A;  2PNT A;  3TSV A;  2EHR A;  1N99 A;  1WHD A;  3I4W A;  2W4F A;  3CYY A;  1WG6 A;  4JJ3 A;  4NXP A;  4NNM A;  4K76 A;  4NMV A;  3TSZ A;  2KA9 A;  4Q6H A;  1KY9 A;  1U38 A;  1WHA A;  3R68 A;  4K78 A;  2DLU A;  2H3M A;  4P2A B;  5HFE A;  3DOR A;  2O2T A;  4WYU A;  1UJV A;  3K1R A;  3CBX A;  1MFG A;  5G1E A;  4Q6S A;  4N6X A;  3RLE A;  2YT7 A;  2QKU A;  2F0A A;  1UEW A;  2KYL A;  2W7R A;  5E22 A;  3HPM A;  3GDV A;  1ZUB A;  2DJT A;  3PS4 A;  4HOP A;  2HE2 A;  3HPK A;  1WI2 A;  2AWX A;  2M0Z A;  1IU0 A;  1OZI A;  1RGW A;  3PV2 A;  2KPL A;  1Q3O A;  2ZPL A;  2EV8 A;  3CH8 A;  2M0V A;  4E34 A;  2OMJ A;  4NXQ A;  2JWE A;  4K6Y A;  3SHW A;  3ID2 A;  4JOF A;  1UEQ A;  3MH7 A;  1V62 A;  3B76 A;  1SOT A;  4REY A;  2EGO A;  2G2L A;  2I4S A;  2VZ5 A;  5G1D A;  1PDR A;  2JSN A;  5HEB A;  3KDK A;  4WYT A;  5GLJ A;  5FB8 C;  5EZ0 A;  2V90 A;  4KFV A;  3K50 A;  2RCZ A;  1TE0 A;  1FC7 A;  1WF7 A;  4O06 A;  4NMP A;  2PDZ A;  1GQ5 A;  3I18 A;  1LCY A;  2OSG A;  4NMR A;  2K20 A;  2DC2 A;  1K32 A;  2K1Z A;  3EGH C;  2P3W A;  5H3J A;  2I0L A;  5IL9 A;  4JOH A;  3PDZ A;  1GM1 A;  2FNE A;  3R69 A;  2AWU A;  1X5N A;  1Z86 A;  4GVC A;  2PKU A;  3QJM A;  3HVQ C;  2EJY A;  1QLC A;  2YTW A;  2DB5 A;  2E7K A;  2BYG A;  1R6J A;  4NMO A;  4R2Z A;  2H2C A;  1W9Q A;  2I1N A;  2JRE A;  1TP3 A;  3DJA A;  3ID4 A;  5A2P A;  2IWO A;  2EXG A;  1GQ4 A;  1L6O A;  1KWA A;  1OBX A;  1BE9 A;  3GDU A;  3KZD A;  4E3B A;  1WI4 A;  1QAV B;  2YT8 A;  3QIK A;  4G69 A;  1RZX A;  2KQF A;  3TSW A;  1W9O A;  2FCF A;  2CS5 A;  1N7F A;  2H2B A;  5HFF A;  3CBY A;  1QAV A;  3GAB A;  4JJ0 A;  5HF4 A;  5I7Z A;  2EAQ A;  5B6L A;  3L4F D;  3PV4 A;  1Y7N A;  1UM1 A;  3KHF A;  2EDP A;  3E17 A;  5ILB A;  2REY A;  4OEO A;  2VWR A;  3LNY A;  1UIT A;  1YBO A;  1TP5 A;  1X8S A;  3KZE A;  4NMQ A;  2KOH A;  2JOA A;  3AXA A;  3GSL A;  2KL1 A;  4IC6 A;  1FC9 A;  2G5M B;  3WKM A;  4Q2P A;  2M0U A;  2ENO A;  1X45 A;  1G9O A;  2R3Y A;  2IWQ A;  4JOR A;  2V1W A;  3WKL A;  2AWW A;  5HED A;  4RI0 A;  1FC6 A;  2Q9V A;  1X5R A;  3PV5 A;  3DJ3 A;  1M5Z A;  1FCF A;  1W9E A;  1N6F A;  2YUB A;  2WL7 A;  4JOE A;  5F3X A;  2KJK A;  1V6B A;  3OU0 A;  1U37 A;  2M10 A;  5E11 A;  1WJL A;  2Z17 A;  1N6D A;  3GCO A;  3GDS A;  3I1E A;  2DLS A;  1XZ9 A;  2IWN A;  2EGK A;  2KOM A;  3RL7 A;  2EEI A;  3TMH A;  2EEJ A;  2I0I A;  4XHV A;  2KPK A;  2VPH A;  2KOJ A;  1RY4 A;  5EYZ A;  2PKT A;  2Q3G A;  2R4H A;  4P0C A;  4K75 A;  5E21 A;  2JXO A;  2I6V A;  3JXT A;  2FN5 A;  2DKR A;  4JOK A;  3VQF A;  3ID1 A;  3CC0 A;  2OZF A;  2OGP A;  5FHT A;  3QGL A;  3GJ9 A;  1X6D A;  2CSJ A;  4Q3H A;  2JIN A;  2L4S A;  4NNL A;  2L4T A;  1UM7 A;  1WIF A;  1WFG A;  3NFK A;  1MC7 A;  3GGE A;  2DM8 A;  2HE4 A;  5HF1 A;  2PA1 A;  1X5Q A;  4EDJ A;  2H3L A;  1UHP A;  1KEF A;  4NMS A;  2IWP A;  2PZD A;  2KV8 A;  2EDV A;  5DTH A;  2UZC A;  5HFB A;  3NFL A;  5HEY A;  2Z9I A;  1VCW A;  1NTE A;  3QDO A;  2LA8 A;  2KAW A;  2ZPM A;  5HDY A;  3MH4 A;  4AMH A;  1ZOK A;  2OS6 A;  4OEP A;  4Z8J A;  2JIL A;  2EGN A;  2QKV A;  2MX6 A;  4JOP A;  2D92 A;  2FE5 A;  2EEG A;  1X9Z A;  1UJU A;  3STJ A;  2EEH A;  2GEF A;  3QO6 A;  1N7T A;  1T2M A;  2OQS A;  2F5Y A;  3GCN A;  1WFV A;  4UU5 A;  5D13 A;  2HGA A;  3K82 A;  1WH1 A;  1N7E A;  3VQG A;  1VJ6 A;  5HET A;  2DMZ A;  2LUI A;  2VRF A;  2KRG A;  4Q2O A;  3SHU A;  1I92 A;  3SOE A;  1Y8T A;  1UFX A;  2QKT A;  1I16 A;  1Z87 A;  2L97 A;  4HOP B;  2DAZ A;  5HFD A;  4UU6 A;  5GND A;  1V1T A;  4NMT A;  1VAE A;  2LC6 A;  4GHN A;  3R0H A;  1VB7 A;  4KFW A;  4H11 A;  4NXR A;  3ZRT A;  1IHJ A;  1P1E A;  4MPA A;  1UF1 A;  2LC7 A;  1MFL A;  2YUY A;  3EGG C;  5HFC A;  2D8I A;  4Q2N A;  3OTP A;  3QJN A;  3CBZ A;  1V5L A;  2RRM A;  3DIW A;  3O46 A;  1NF3 C;  3LNX A;  1Q7X A;  5JXB A;  2KJD A;  4FLN A;  2M0T A;  1U3B A;  1N6E A;  2VSV A;  4GVD A;  3NCV A;  1U39 A;  2CSS A;  1UEZ A;  5E1Y A;  1UEP A;  3BPU A;  4JL7 A;  4FGM A;  2AIN A;  4OAJ A;  1UJD A;  1BFE A;  2MHO A;  2X7Z A;  3SFJ A;  4JOJ A;  1V5Q A;  1IU2 A;  1D5G A;  1OBZ A;  3CS0 A;  3PDV A;  3ID3 A;  2GZV A;  1OBY A;  3FY5 A;  4LMM A;  4JOG A;  3O5N A;  1WF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...