1SOTA

Crystal structure of the degs stress sensor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
312
structure length
283
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 54
structure length 283
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sotA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA02
2IJOB 2ZDMA 1Y3XA 5E11A 1TRYA 2LC7A 1HB0B 5C1YA 1C2IA 2NWNA 4LXBH 2HE2A 1UK4A 1AHTH 4D8NA 1NN6A 5K0HA 2VPHA 1O3IA 4JK6A 5F8XA 3GYMA 1A7SA 2FYQA 4H42U 1IQGA 3QK1A 2PTCE 2P59A 1UEQA 1IHTH 2BVSH 4DGJA 2ZA5A 2ZG0H 4ZHAA 1THPB 1V6DA 4CR9A 1NY22 1TP5A 2VIQA 1UEZA 2OCVB 1ACBE 1AVWA 1A61H 4NFEA 2OPGA 4IW4E 1G9IE 4NA8A 2BYGA 1P06A 5GJ4B 1FN6A 1ANEA 4AYYB 1VGCC 1FZZA 1DSUA 3AASA 3U69H 3VFEA 2AERH 1NFWA 4Y79A 3DFJA 3BEFB 5FBEA 1QBNA 3AVZA 1WHAA 1TNHA 2KBSA 1O2ZA 3P95A 4AGKA 5G4BA 2H3LA 1CU1A 3LH1A 1HAHH 5CHAC 1LDTT 4QT8C 2UWPA 4JYTA 3A8DA 2ANKH 4ABFA 4WMFA 3A82A 4I32A 2A45B 1O5BB 1UTKA 5AFZH 3SI4H 3M3TA 3K9XB 4Q7ZA 4ZXYH 3PLKA 3EGGC 4NZLA 2FIRH 2VH0A 2VIWA 4GVCA 2STBE 3GY6A 3TMHA 4FUBA 2HALA 1OPHB 3RU4E 2D8IA 1ZMNA 4JORA 2DM8A 2D8WA 3SJIA 2XWAA 3HKIB 3PMBB 3SNBA 1OSSA 3S9AA 4LOYH 1ABIH 1TPOA 1HIAA 1YF4A 4I8LA 4ZHMU 5T6FA 4AN7A 1H9HE 3MFJA 3EE0B 2HNTC 5E0HA 3SI3H 2SGAA 3HVQC 4K78A 1NT1A 3PWCA 5CMXH 1GMHF 4RSPA 3V13A 4K75A 1Z71A 2GV6A 1MU6B 1L6OA 2ZECA 5FCRA 3MU0A 5IDKA 3ZZ6A 2A7CA 2UUFB 4MQAA 1DVAH 3E0PB 4I8HA 4MNWA 2AIPA 1WBGB 1MTNB 1UM7A 4K76A 2XCFA 1C1PA 1CGHA 5HM2A 1AWHB 2PW8H 3VB6A 2ZU1A 1Y59T 2I6VA 2BDYA 3SV6A 3R69A 1DSTA 2OS6A 3VB4A 1XUIA 1D3DB 1MC7A 2J95A 3PM3A 3M7TA 2PKAB 1B0FA 1QLCA 2GCTB 4OGXA 2AWWA 1QB1A 1CGIE 3CS7A 2ZHQH 1C1OA 2K20A 5DK1A 3GICB 2AGGX 3GSLA 2F9NA 1EJNA 4WXIA 4K6YA 1XUFA 3I77A 2Z7FE 1WI4A 4Q2PA 5FPYA 2FXRA 4X2WA 2ZP0H 3L3TA 2UUKB 1MBQA 1ELTA 3EYDA 3MH5A 4YYXA 5T6GA 3WKMA 4Y7BA 4IMQA 2B0FA 2CJIA 3U8OH 3TJVA 4UFEH 2LC6A 1A5IA 2VVCA 3MU1A 1H9LB 3IITA 4INLA 4R8TB 5HYOA 3DA9B 3PLPA 1P09A 2ZGBH 1W9EA 4DY7B 1OS8A 1YPLH 1DY8A 1HJ9A 3I18A 1C1WH 8KME2 1X5QA 3K6ZA 1HJ8A 4FUIA 4WMEA 2BD4A 3EA9A 1DY9A 2VVVA 2I0IA 2JXOA 2RG3A 1FONA 1ZUBA 4OS4A 1T4UH 4O9VA 2O8LA 1AI8H 2C93B 1GBAA 2XBYA 4MTBA 1C5RA 4XFQA 3TGKE 1GPZA 1V2ST 2F0AA 4L8NA 1A5GH 1WU1A 1FLEE 3ID1A 1S0RA 4BANB 3UQVA 1LVOA 2Q6DA 3K6YA 1TABE 1XXDA 1EAXA 1ORFA 1XM1A 2KG2A 1BCUH 2OC0A 3S9CA 5EW1H 3S0NA 2QG1A 1ELFA 2W26A 2DC2A 2OC8A 4AG2A 3SU4A 2C8ZB 2YT8A 1WF8A 1GBIA 4MLFB 4ZXXH 1W13U 1J17T 3RXGA 3ZZ4A 3QGNB 4HZHA 1C5QA 2VIOA 1AVXA 1YC0A 3QLPH 4X2VA 5K7RA 1W0YH 2G5NA 3BSQA 1IU2A 1D3QB 1WHDA 5SGAE 1QB6A 1S5SA 3MI4A 3UUZA 2VSPA 2LPRA 2VWNA 1OYQA 2KPKA 3NZIA 1AY6H 1GVZA 5EW2H 3NUMA 3GOVB 3QZQA 1O2NA 1T32A 1F5RA 1SG8B 4UONA 1AMHA 4U2WA 1YBOA 3E6PH 1O2IA 1OP0A 3PMJA 4K60A 4HFPB 1N7FA 1E38B 4E06H 4JZEH 2JILA 2JH0D 2JIKA 3QWCH 1O2SA 1TYNA 1GBEA 1QAVB 2TIOA 5E1YA 2AYWA 2J2UA 5DP5A 3ZVBA 5JB8S 1V2MT 4AZ2B 2Z3CA 1HUTH 2A1DB 1B7XB 1ABJH 1QY6A 4FU9A 3MU4A 3U8RH 3R3GB 2ZHWH 2OUAA 1MU8B 2BTCE 4X1QU 4XDEA 1NU9A 2SGDE 1ARCA 1O3FA 1SLWB 1Q3PA 3ZRTA 3C27B 1TX6A 1MQ5A 1O3HA 3SHWA 1V5LA 4B75A 3E3TA 2FE5A 3H7TA 2NU3E 2GDEH 3E0NB 1HAVB 4ZAEA 3BTWE 1X45A 3SU1A 1LKBA 4RI0A 4H6SB 3KZEA 1Y3WA 1O2JA 1OYTH 5J4QA 4REYA 4SGAE 1GMCF 3A7YA 1A46H 1EPTC 1UITA 3VEQB 1H8IH 2XWBI 2OZFA 1YPHC 1YKTA 3SUGA 4GCHF 1KY9A 4AMHA 4X6MA 1QCPA 1AD8H 2BLQA 2FX6A 1QAUA 1F7ZA 2Q6FA 3MWIU 4GPGA 1O5FH 2Z17A 2UWOA 3KHFA 3CYYA 1P01A 1RIWC 3P8GA 3FP6E 3ZZ8A 1VZQH 3Q3KA 2OQSA 4AFSA 2ZHFH 2ZCLP 4JOHA 5LGOA 1X5NA 2MHOA 2QC2A 2WPKS 5AFYH 4NCYA 3MHWU 3HPTB 1OWJA 1TFXA 1C2HA 1NZQH 2EDVA 1S81A 3RM0H 4JL7A 2OQUA 3A7VA 1NFXA 1BTZA 4K8BA 1GCDA 1YBWA 4DIHH 1IQHA 2KPLA 2OXSA 4X1NU 4XOJA 2Y6TA 1TALA 2A2QH 1A0HB 1DXPA 1YCPH 2WPMS 4LZ1H 4J1YA 1SOTA 1K1OA 2LUIA 1TMBH 2ZKSA 2BLOA 4WMDA 5B6LA 4BXWA 1D5GA 1RTLA 3TH2H 2BDGA 3RDZA 1HGTH 1NTPA 2A5IA 2FLRH 1GL1A 2C8WB 5T3HA 2GV7A 2AS9A 2P3UB 4O3UA 4A92A 5JPMH 1GCTC 1GI9B 3A89A 3SN8A 2B9LA 4YT6H 1DS2E 3RLYH 4K2YA 2D1JA 2XNIA 2SGFE 3CC0A 1X5RA 2KL1A 2PDZA 2VNTA 3TVJB 1GM1A 2ZO3H 3PMAB 3SU6A 1YYY1 1CGJE 3A8AA 4JYVH 1GHZA 5L2ZH 1OZIA 1BA8B 3M61U 1CSOE 1KLJH 1W11U 4ISLA 1LQEA 2THFB 2SNVA 2WPJS 1W9OA 4N6XA 2H9EH 4CBOA 1PDRA 3F1SB 1MFLA 1B0EA 4FGMA 1C5PA 1UEWA 3RXTA 1V2NT 2YUYA 2BM2A 4WYTA 3TPIZ 3RXPA 1KXCA 2EXGA 2BD7A 2SGEE 3IG6B 3UR9A 1BRBE 1FC9A 1C2KA 4TY6A 2ZDLA 3E90B 5A8ZA 1KYNA 2NU2E 4NFFA 1K1MA 1FN8A 1BTYA 2Q9VA 1LHDH 5E8EH 1CA8B 1GWAA 1ANBA 1WG6A 3ESTA 2GMTC 5GWZA 1G9OA 2WL7A 2DLUA 1TNIA 3PTNA 4KP0A 4F4OC 3HK3B 1O3CA 4ABHA 1FCFA 3UWIA 2BD9A 4Q2NA 4UE7H 3BEUA 3GCTG 1O2KA 5C67A 1HRTH 4Z33A 5DP6A 1W14U 1PPHE 2I4SA 3LGUA 3GGEA 1QJ1B 3D23A 3JZ1B 5FHTA 1XXFA 3QTVH 3M37A 1TQ3A 4E3BA 2CXVA 1GQ4A 1EZQA 1IAUA 1JRSA 1S6HA 1SR5C 1W10U 3CBYA 1P0SH 1ZTKA 3BEIB 4NA9H 1ELVA 4GUXA 3DIWA 2QKVA 2IWPA 3M5MA 4ISHH 3BPUA 5B6OA 3TJOA 1OKXA 2P3WA 3GY8A 1J9CH 2EI8A 4ABJA 4NXPA 4H11A 4YM9A 4TWWA 2QV1A 1C4Y2 1H8DH 1OWEA 3SU2A 1MZAA 3D62A 1E37B 3SO3A 5HJ1A 1C4V2 1FC7A 1C5XB 3R68A 2ZU4A 2PA1A 1G3BA 1G3EA 1L0ZA 1O2UA 3M5LA 1TLDA 1WYKA 2XBVA 3EQ0H 5IYTA 5GLJA 1TBZH 2LOBA 1LTOA 2WPHS 3FP8E 1GI1A 3AAUA 4WH6A 1ID5H 4NA7A 1TIOA 1O3DA 1C2GA 3BF6H 1OBZA 1BZXE 1TBQH 2FLBH 1MAYA 1UVTH 1CA0B 1G30B 4E7RG 8GCHF 2VGCC 1SGEE 1K2I1 3RL7A 2PFEA 3GY5A 2XCNA 4R2ZA 2Y80A 3F6UH 1P9SA 1O2WA 2G81E 1EP5A 5EXLA 3VXFH 1HNEE 5GXPA 3RC5A 5GDSH 1EXFA 4KTCA 1LPKB 1F0TA 2ZPLA 3VPKA 4ZHLU 4GHQA 2WUCA 4IBLH 3TK9A 3QN7A 4MPUA 2V3HH 1AO5A 2OTVA 1XVOA 3Q77A 5ESBA 2WPLS 3ZVGA 4X6NA 3ID3A 1TGNA 1QL8A 1VJAU 4GLYA 5HMAA 3E17A 1TPSA 1GBTA 1PYTD 1DFPA 1O2OA 5JBBS 3KGPA 2F5YA 5BRRE 1EKBB 2BQ6B 2G2LA 3V12A 1M9UA 2KOHA 3A8BA 1L1NA 5E0JA 2P3FH 2ZQ1A 1GI2A 3PV4A 5E22A 2A5AA 2BOKA 5HEBA 1AKSB 1QRWA 1GL0E 4WJG2 7KMEH 2PV9B 4RKJB 1O0DH 2FOAA 4B1TA 5L6NH 1QBVH 5EYZA 2ZDKA 1O5CB 2UWLA 1UTPA 4I33A 3QTOH 1WOFA 1GHYH 1UMAH 2BD8A 4BAKB 1UK2A 2PKSB 1QURH 5EXNA 2J9NA 3ATLA 1SOZA 1GHBF 1N8OB 3U98H 2VH6A 3PDZA 1HYLA 3ATKA 4D76A 2CHAB 5FXLA 3TNSA 4ABBA 4ESTE 1ZOMA 3LKWA 1PPZA 3LIWA 1HJAC 1FUJA 3R0FA 1G3CA 4ISOA 3ZZ5A 1CHGA 3NFKA 2P93A 2W5EA 3O8DA 1WSSH 2QXGA 3L33A 4WXVA 3TH3H 4YO9A 1RRKA 2ZEBA 7LPRA 1KDQA 5L2YH 1LMWB 1YPGH 1OWKA 1P10A 1YPEH 2PUQH 1VCQA 4E7NA 3RXLA 2BB4A 3BTTE 4X8SH 5LPRA 5AF9H 1D6RA 2EEJA 1T8LA 4NIYA 1PJPA 4G69A 1QAVA 1P1DA 1DWEH 3PV2A 5DJ7A 2Y7ZA 1GVKB 1Z1IA 2Z9JA 2ZU5A 1SGFG 2KQFA 3HPMA 1Y3VA 1YLCA 2ZU2A 1ELDE 4WWYA 5A0CA 1MD7A 2PR3A 2KV8A 1XZ9A 1GHWH 2G5VA 1BJUA 1K1PA 3T2NA 1SHHB 1TMTH 3ZVAA 1ZTLA 3BTGE 3HGPA 4D9RA 1GMCG 1P03A 3PO1B 2BLVA 1SGTA 2H5DA 4X1PU 1HAVA 4X8VH 2O8WA 3RXVA 4NXRA 4GCHG 1S83A 4A1VA 3GCHB 1I16A 1ZPZA 2FOFA 1Y5BT 1BE9A 2DUCA 1TRMA 1RTFB 3S69A 1K1IA 2QXHA 5EQSA 3DHKH 2BY6X 3LGVA 2TGAA 3GCNA 1GBLA 3O8BA 4ABEA 2BLWA 1NU7B 1CT2E 2KJDA 1WTHD 3A88A 1N1LA 4HGCA 2OQ5A 2R3YA 3MU5A 1UVOA 4U32A 3KL6A 9LPRA 3D65E 1QFKH 1AB9C 3SJ8A 1K28D 1DXWA 3BG4C 1XVMA 4U01A 1O5DH 3VQFA 3UWJH 1O37A 1O3AA 1DDJA 2BQ7B 2SFAA 1O39A 2ZFPH 1EATA 3PROA 3BV9B 1U39A 1RGQA 1DUEA 4Z0KA 2SNWA 2QYIA 2TGPZ 1GBKA 2XW9A 1WTGH 2BDHA 1HPGA 1C5NH 1O3JA 3F9EA 4YOIA 4Q80A 1BFEA 3SJ9A 1BHXB 1WQSA 1HBTH 3ATWA 4I8GA 1CQQA 2VIVA 2OBOA 1UK3A 1SGFA 1NTEA 1BUIA 2ZWLH 3NK8A 2C3SA 4XBCA 4JOKA 1DOJA 1LHEH 2DE9A 3TITA 1ZRBA 1O5GH 2Y5FA 1HAYB 3GCTF 2PKUA 2Y82A 4ABAA 2E7KA 1W7GH 2P8OC 1SSXA 3M7QA 1A5HA 4FUJA 1VJ6A 2QA9E 2BDBA 3S7KB 1O3NA 1PPBH 2ALPA 1GBFA 2FDAA 2P16A 2NU4E 1MKXK 2O9QA 1W8BH 4BXSA 3ZVEA 1A1RA 1MQ6A 3ZVDA 1C5WB 1VGCB 1KEFA 1P2QA 2ZDVH 3MNCA 1WAYB 3QE1A 4NNMA 1XKBC 1O2VA 2V3OH 1Z6EA 2WPIS 1GQ5A 1LPZB 1EJAA 1XUHA 5DP8A 1EZXC 6GCHG 1QIXB 3STJA 1UVUH 1O2LA 1X7AC 3RLEA 2NU0E 2BOHB 1THSH 3SHCH 5A2MH 5FPSA 1UHBB 5F03A 1CBWC 2A4OA 5CHAB 2BD2A 6CHAC 2A5KA 1RY4A 1C5SA 1AUJA 4HOPA 3KN2A 2H1UA 2JETC 2EEHA 1FY8E 5HFCA 4Y8ZA 3ZZ3A 3U1IB 3ODFA 1V2PT 1NM6A 2ZPSA 1ZYOA 1RXPA 1W0ZU 1PPCE 1Y3YA 4YT7H 3RU4T 4OS6A 2VU8E 3VGCC 1GDNA 2KOMA 1Y5UT 2M0VA 4XE4A 2ZFFH 3O8CA 1C1NA 3V0XA 3BTHE 2PNTA 1MKXH 1UTLM 1HV7A 5JYIA 1OBXA 2ZI2H 2OLGA 2TPIZ 4AFZA 1ESBA 1PQ5A 4WY3A 2G55A 4Y0ZE 3URDA 3SQEE 1SI5H 3A7ZA 4WYUA 4ZKSU 1DX5M 2K1QA 2STAE 1WJLA 1PYTC 4JOGA 4Y8XA 3URCA 3DORA 1TPPA 1FY5A 1EX3A 1XUJA 4NIVA 4X2XA 4CRFA 3T27A 1ZRKA 1MMJN 4E35A 1UJUA 1O2TA 3KEEA 1FDPA 1JIMA 1CO7E 3KQBA 4YZUA 5AHGH 2XRCA 4THNH 1LQDB 2UUJB 3BTKE 1ETTH 1SLVB 3AW1A 4CBNA 1CE5A 3QIKA 3E91A 4BAMB 4ZH8A 1DANH 1EB1H 1HAZB 1O5EH 4CREA 1TX7A 3SUDA 2ANYA 3CBXA 1VCPA 5F6MA 1QRXA 1CHOG 1GHVH 2AGEX 4K1SA 3MH6A 3EDXB 3LH3A 4UFGH 3SU5A 1QBOA 4SGBE 2HWLB 3LNXA 1O3KA 2OD3B 1Z8GA 1U38A 4FUDA 3MO9A 5HF4A 2VWMA 4YDPA 4K1EA 3H5CB 4O06A 3AXAA 4NMOA 1BMNH 2QN5T 3PB1E 3UQOA 1BRUP 3H7OA 4INHA 5I46H 1KDQB 1KSNA 1DWCH 5DO4H 1Y5AT 3L6PA 4Y71A 5H3JA 2BD5A 2VIDA 3LJOA 2ZC9H 2FYRA 1FQ3A 1NROH 1O3LA 4AORA 1BMLA 4AB9A 3DT0H 2XBXA 1P05A 3SV9A 5C1XA 3QUMP 1RS0A 2P94A 5GIBA 1FY1A 2AH4X 4MPWA 3MO3A 2A4RA 1GMDF 3G01A 1RZXA 2F9PA 2RCZA 3NKKA 4AOQA 3UNSA 1BB0B 2EHRA 1C4U2 1E34B 2JH6D 3I29A 2HOBA 4BTUB 1VA8A 2Z9KA 1OP8A 2RA0A 1WF7A 4NIXA 4MPVA 2XC0A 3DFLA 1SGNE 1T8NA 1WQVH 3RU4D 1SFQB 3PYHA 1J14A 2Z9IA 3LGYA 1N6YA 2EI6A 2QAAA 1Z8RA 3BG8A 1UTMA 2JOAA 2QT5A 3BTME 1W7XH 1GI0A 2FTMA 2ZFQH 1QA0A 3KF2A 1GI4A 4PQWA 4I31A 2EI7A 1KWAA 3I1EA 2QIQA 5G1EA 1YCPK 1BDAA 3NGHA 1GGDC 2P3TB 2PGQB 1NESE 3KQDA 1S82A 2A4QA 3M35A 2O8MA 2H5CA 4AFUA 3SZNA 1AKSA 3M3SA 1GHBG 4TYDA 7ESTE 2ASUB 2ILNA 5GNDA 1D3PB 1ZHPA 3QGLA 1G2MA 2EDZA 2V90A 4A7IB 3MNBA 2ZPMA 3TSVA 2GCHG 4K1TA 4B71A 1FIZA 1N6DA 2H6MA 4NMTA 3LPRA 2NU1E 2W7RA 2WINI 1A0JA 2J4IA 2RCEA 1MD8A 3FZDA 1O35A 5DP7A 1P12E 4ZKOU 1SB1H 1O3EA 4DG4A 2R0LA 4JZFH 2AGIX 2PWXA 1AWFH 1UF1A 1KTTB 1O5AB 3BIVH 4B76A 3RXAA 1V2RT 3EA8A 1TBRH 1LVMA 1P2IA 2ODYB 1AQ7A 3HPKA 2KAWA 2UUYA 2ZTZA 5DP4A 3S9BA 1MZDA 1SGYE 3FP7E 2FM2A 2PZDA 4DW2U 4ISIH 2LA8A 1N6EA 3MH7A 3I78A 5DPAA 2OC7A 1T31A 1YPKH 2IWNA 1SVPA 2ZDNA 2R2MB 1FMGA 2GDDA 3PLBA 4B2CA 2BDIA 1UVSH 2G4UA 2D92A 4CRAA 1WIFA 3M7UA 1MTUA 1N6FA 1C1TA 5HXFA 3B9FH 4NMPA 4E05H 5JB9S 1TWXB 1BTHH 4KGAA 2A7JA 1TE0A 1GJ9B 3KIDU 1EZSC 1NRQH 4Z8JA 4Q2KA 3O5NA 4FUCA 5DG6A 4NMSA 2CV3A 1MTSA 5A09A 2H2ZA 5TCCA 2D26C 4ZMAH 1O2YA 2O8UA 3A85A 1DLEA 3RXSA 1O2HA 1G37A 1UTNA 4KELA 3SOEA 2TRMA 2F9UA 3OU0A 1DWDH 1SC8U 1BQYA 1DPOA 2ZFTA 2ZTXA 2GGVB 3GDUA 1TGTA 2ODQA 3LGTA 2Z9LA 1MTWA 1EPTB 2O8TA 2ZHEH 1SGDE 2BDCA 1Z86A 2QXJA 3MTYA 1EZUC 1XKAC 2R2WU 4NXQA 1BTPA 2CSSA 1S0QA 1GBHA 1MTVA 1EASA 1JIRA 3SHAH 3RMNH 5GCHG 2D2DA 5E2OA 1RIWB 1NPMA 2WV5A 6GCHF 1C5YB 4RN6A 5C3NA 1C5TA 3ZV8A 1TGBA 4HOPB 3GJ9A 1NF3C 1V2LT 3ZYEA 5F67A 1O3GA 3HGNA 4X2YA 2FPZA 3OTPA 2H2BA 5F8TA 4DIIH 2I6QA 2GTBA 4IGDA 1WUNH 1H1BA 1P57B 1L1JA 3GY3A 4A1XA 3RXKA 5ABWA 3SGAE 2XC5A 5HDYA 3OYPA 2FN5A 1QHRB 2DAZA 1FY4A 2EEIA 3FAOA 4VGCC 1C2JA 1A3EH 5ESTE 5T6DA 1C1MA 3RXHA 1JBUH 2ZFSA 4WF8A 3WKLA 1ELGA 1ELBA 2VRFA 3DD2H 4AX9H 1SQAA 1BBRH 1UFXA 1ETSH 1FAXA 1H9IE 1YM0A 4JZDH 1K1NA 3VXEH 3M36A 2CN0H 5C2ZA 2VWLA 1BJVA 4ZUHA 4FUEA 3PMHB 3ZVFA 2BQWB 3KNXA 2AINA 5LH8A 2I1NA 1HCGA 1TMUH 3PV5A 1FPCH 3K50A 1W9QA 1GCTB 1QRZA 3LGIA 1ANCA 1C9TA 4ZKNU 1QNJA 3TSZA 2HRVA 3F9HA 1GI8B 1A4WH 1IQNA 2C8XB 3SUEA 4GSOA 4IMZA 3Q00A 1NC6A 2QBWA 1W2KH 1C2DA 1QGFA 1AVGH 1KTSB 1TNJA 1P02A 1LCYA 2F9OA 2GZ8A 4OAJA 1OOKB 1Y3UA 2BX3A 4TWYA 1E36B 3SQHE 4M7GA 3VB7A 2FCFA 3A7TA 4LMMA 1FXYA 2WYGA 1X6DA 1YGCH 4YOJA 2I0LA 1MBMA 3NPSA 4CHAC 4ISNA 3KZDA 2BXUH 1CHOF 1V1TA 1YPMH 2OMJA 1UHBA 1V2KT 1AFQC 3ID2A 3LNYA 1P2MA 4B74A 4TY7A 1UJDA 1A0LA 2ESTE 1Q2WA 2CF9H 1PFXC 1WV7H 1HAGE 2QKUA 1G32B 3W95A 2GMTB 3D49H 1DWBH 1Z1JA 2VB0A 1C5VA 3A86A 2M0ZA 2J94A 1KXDA 1C2FA 4MNXA 5AVDA 5C1UA 2OBQA 1P04A 7GCHF 5HFFA 2ANWA 1GG6C 1NRSH 2AWXA 3KHVA 4NZQA 3P8NA 3A8CA 2FNEA 2V1WA 3AW0A 1O2GH 3R0HA 3SNDA 3BTFE 1EQ9A 1SMFE 3PTBA 2H9HA 1C2EA 4F8KA 4Q7XA 4D7FA 2HPPH 1B5GH 3MH4A 2FTLE 1AU8A 1C1RA 2ZFRH 4IS5A 4TPIZ 1V62A 2OINA 3M5NA 4K8YA 1D4PB 1S6FA 4KFWA 2M10A 3P8OA 1ZJKA 1MKWH 1O38A 1FI8A 2BZ6H 3OSYA 2F83A 1EAWA 3CS0A 4OS7A 2F3CE 1AGJA 2HLCA 9ESTA 4Q6SA 4Q2OA 1F0RA 4Q6HA 1V2UT 3FFGA 3SUFA 3BTDE 3RUOA 3RXUA 3EGHC 1TOCB 3K1RA 2C8YB 5TJXA 4DURA 4Q3HA 1ARBA 2IOTA 3U8TH 5E2PA 1PQAA 2F91A 2SGQE 3NXPA 3QO6A 2GCHF 4YOGA 3ZZ9A 4ABGA 4AG1A 2A31A 1RGRA 1M5ZA 1UCYE 1GJ7B 4DCDA 5JXBA 3Q76A 4Y10E 1GJ6A 4A1TA 5FAHA 1Z87A 2QCYA 2O2TA 4GVDA 1O2RA 5L30H 1Z8IB 1F0UA 1ELEE 1GMDG 1LVBA 2JINA 3VB5A 4IN2A 2YOLA 3MNXA 5E0GA 4CRGA 2VGCB 4B2AA 3P17H 4HI3A 1O2PA 1VITH 1JWTA 1VITF 1BBRE 3KCGH 4UD9H 4D9QA 2L4SA 1ZMJA 1TNGA 3RC6A 3HK6B 5LPEA 1UTOA 4Y8YA 2F9BH 1ZSJA 1P11E 3TH4H 1AE8H 4DOQA 1MAXA 1OX1A 2R3UA 2OSGA 4MVNA 3SORA 2FI4E 1SGIB 2D90A 3QDOA 2ZNKH 1CT4E 3ZV9A 1SPJA 3UOUA 3GCOA 1V5QA 2PTNA 4A5TS 3O8RA 1Z8JB 3A83A 3RL8A 2VVUA 3PS4A 1BHXF 2FOCA 2ALVA 3B23B 3GDSA 1C5OH 3FY5A 1IQEA 2EEKA 4NMVA 2GZ9A 2FI3E 4H6TA 4K69A 2J38A 1ZTJA 2R0KA 1FIWA 1GVLA 3T29A 1IQJA 4I8KA 1HXFH 4AFQA 1F92A 2EV8A 2BDAA 1TX8A 2VSVA 1K9OE 3LC5A 2EC9H 1P8VC 3SUZA 1O34A 3LDXH 1WFVA 4JZIA 4NSVA 1NRRH 1Z6JH 4JZ1A 3E1XB 5BPEA 4UU5A 3U9AH 2ULLA 1KLTA 1MTNC 2HGAA 5HFBA 4ABDA 1AN1E 1BITA 1J15A 3K82A 2W3IA 4WVPE 1NS3A 1O3BA 1ZGVA 2BY7X 2Z6BD 5DP3A 3TJNA 3NFLA 1K22H 2EDPA 3QDZB 2L4TA 2BVXH 4BAOB 1A3BH 2GD4B 1DM4B 3LU9B 1HJAB 1EAUA 3CENA 2AMPA 3S7HB 2GCTC 2FP7B 1RGWA 5D13A 2YTWA 4ZROA 5GCHF 1ZSKA 3TK5A 4BTIB 3E16B 2REYA 1L2EA 2PSXA 4OS5A 1GI6A 2B8OH 2ZGXH 4DJZB 5FCKA 2HE4A 4I8JA 1WCZA 4BTTB 5JBTA 4Y0YE 2LNCA 2Z3EA 1ELCA 3RMLH 3FZZA 3SU3A 3OX7U 4GVUA 1GJ4H 1V3XA 1HDTH 1SBWA 2GX4A 3BN9A 6ESTA 1DLKB 2G51A 1O32A 1UHPA 1GJ5H 5EPYA 2BZAA 1JRTA 1ZMLA 2W3KA 3T25A 3LOXA 2ZDAH 4PROA 2W7SA 2Y5HA 1QJ6B 1MH0A 1SGQE 1SFIA 1MUEB 3P70B 1CVWH 5A0BA 3UR6A 1TQ7B 1GHXH 1UO6A 1SGCA 1P1EA 2R4HA 2EJYA 4MNYA 5EQQA 1I92A 4A6LA 2HNTF 2YT7A 2BY5X 2VJ1A 4K3JA 3SGBE 3PWBA 2M3MA 2P95A 2HGTH 2I6SA 1ZHRA 2DJTA 1LPGB 1TA6A 2A0QB 2ZZUH 3HATH 1E0FD 4Y7AA 2QXIA 2CSJA 4FUHA 4ZKRU 1YPJH 1VB7A 2EAQA 4X8UH 2M0UA 1AE5A 1EPTA 2L97A 1ETRH 3SV2H 2KA9A 1GJDB 1GHAF 2XYAA 3LONA 5GPIB 2B5TB 1YP9A 2DKRA 3P8FA 4NSYA 1D3TB 2FOGA 4IC5A 3RXCA 2BVRH 3T26A 3T62A 4K5ZA 1VR1H 1AB9B 4ABIA 2A7HA 1PPEE 1QQ4A 3ZYDA 4E34A 3BG4B 3QX5H 1W12U 2FS9A 3PDVA 4P2AB 4JCNA 1PQ7A 2ZHDA 5TCAA 3KQEA 1RTKA 1TB6H 3TGIE 4MDSA 1MCVA 1S85A 3BTEE 1H4WA 2ZGCA 1EJMA 4CRCA 1TP3A 1BTUA 1WFGA 1B8QA 1AIXH 1LHFH 2BHGA 2Y7XA 5F8ZA 3SHUA 1O31A 5JDUB 1VJ9U 1R6JA 2XC4A 5EODA 4MPAA 3SNEA 3MU8A 2HVXA 1HXEH 2KJKA 2ZIQH 1ZR0A 2DLSA 2GZVA 3A80A 3RXBA 4Z6AH 1O2XA 4GHTA 3RXRA 1KXAA 4HTCH 3MMGA 3RXQA 4AYVB 3IWMA 2G4TA 2KRGA 4X8TH 4KKDA 5HM9A 2FOMB 1UJ1A 2WYJA 4NMQA 1LO6A 1D9IA 4LZ4B 4Y76A 2FI5E 2P8OB 3EA7A 5HEYA 3TK6A 1GJCB 2Y5GA 3SJOA 1L4ZA 3LC3A 2DB5A 4NMRA 2KAIB 1T8OA 1K1LA 1JMOH 3RLWH 1BT7A 1HAIH 4UDWH 5HEDA 2Z94A 4J2YB 1OWDA 1INCA 3AAVA 3U1JB 3JZ2B 2VINA 2GVFA 2X7ZA 1U6QA 1ZOKA 3A84A 2EGNA 1P9UA 1XUKA 4AB8A 3O46A 4NNLA 1QB9A 1SL3A 1GI3A 3A7XA 1N6XA 1Q3XA 4DT7B 2DMZA 1C5ZB 1TOMH 3LT3A 1ESAA 1BTWA 1IU0A 2V35A 2GP9B 1P2OA 1HAPH 1CBWB 1AZZA 1GJBB 3ATMA 4FUFA 2QKTA 6CHAB 3DJAA 3WY8A 1QL9A 2JETB 2M5TA 1F2SE 3E8LA 2ZGJA 1FPHH 1DE7H 1DITH 1Q3OA 2VWRA 1TAWA 5H4IB 1WH1A 5F3XA 4KTSA 3A7WA 1T7CA 3UNRA 3VGCB 1N99A 1GI7B 4WH8A 7GCHG 2H3MA 1FJSA 1TPAE 4JOPA 3A87A 4Y11E 3GY2A 4EDJA 1K21H 5EGMA 1C1QA 3ODDA 3NCLA 3ENSB 1BMMH 4O03A 5HFEA 2GKVE 1O30A 1SLXB 1P3CA 3T5FH 4JOEA 1LHCH 3MNSA 4OS1A 1BIOA 1K32A 3HKJB 1IQKA 2HNTE 2Q1JA 3GYLB 4ASHA 1GDUA 5HETA 4INKA 1JOUB 3TIUA 1V2VT 4MNVA 3K65B 2ZPQA 3P6ZB 1HAOH 1O3PB 2VIPA 5EU8A 1O2QA 1RD3B 1ZLRA 1P2KA 3SV8A 1N7TA 2ANMH 1SLUB 1ZPBA 2JH5D 1KIGH 3B76A 3DJ3A 2TGTA 3OTJE 3Q3XA 5EG4A 5I25A 2RDLA 4MG3A 1DUAA 1C5MD 6LPRA 1QR3E 3KQCA 3RXEA 1OBYA 2A32A 4NIWA 1C2LA 1CT0E 2IN2A 1KXEA 1NRPH 2XBWA 1TRNA 1GBCA 2KOJA 4BAQB 1FAKH 2PLXA 4JYUH 3CH8A 3TJUA 3RXMA 2G5MB 1GBJA 1NO9H 2YNBA 1EOLA 3B8JA 3ITIA 1TGSZ 2Y81A 5C5OA 2AWUA 3OY6U 3ZVCA 3A81A 4UFFH 3RXIA 2OCSA 1SGRE 5FBIA 3TNTA 3SBKA 1GJAB 2A4GA 4KFVA 5EXMA 4BAHB 1ZZZA 5E21A 5C20A 1T2MA 3CBZA 1QTFA 8GCHG 1EOJA 3F9FA 3ATIA 2CMYA 2M0TA 1O36A 4OGYA 1NRNH 2MX6A 4XSKU 1ZGIA 1VITG 1E35B 4CH2B 1KXBA 3SNCA 5DTHA 2GT8A 5HF1A 2SGPE 1AFEH 1J8AA 2FODA 1IHSH 3NWUA 4F49A 2GZ7A 1OXGA 2BY9X 4Q7YA 1SGPE 1DICA 4NWLA 3L4FD 1L4DA 2QGRA 4X6OA 2V0BA 3T28A 4TPYA 3UTUH 1O2MA 3GISB 2FZZA 3MOCA 3M5OA 1UTJA 3LJJA 3K2UA 5EQRA 1YLDA 2IPHA 2Z9GA 3ZZ7A 1ANDA 1HIAB 4AGJA 1KXFA 2HPQH 4FU8A 4NGAH 1UCYK 3TLOA 2FEQH 1ESTA 3QJNA 2AEIH 4XBDA 2YUBA 1RFNA 1GDQA 2JKHA 1K1JA 2Q3GA 1RJXB 2V6NA 1QQUA 1C9PA 1UEPA 4X0WU 1GGDB 1V2OT 2CGAA 1W3CA 3LGWA 2I04A 1GBMA 1U3BA 2QY0B 1OWHA 5DGJA 2EA3A 1BBRK 2A2XH 1V2TT 3C1KA 3FANA 1G3DA 4LK4A 2AIQA 3BTQE 4FU7A 2H2CA 1JXPA 4NG9H 2ZPRA 3UY9A 1IQIA 2K1ZA 3GY4A 4UEHH 3RC4A 3RM2H 5PTPA 1QL7A 2WUBA 1PQ8A 1G36A 2GT7A 5J4SA 2EGOA 3DJ1A 3STIA 1HAXB 2KJPA 2EGKA 1C1SA 1C5UA 5FB8C 3ELAH 5I7ZA 1IQLA 3I4WA 3RXDA 4YESB 1PPFE 2ZGHA 1UCYH 2RA3A 1GBDA 1WI2A 4UFDH 5LPFA 4OEOA 1LHGH 3TSWA 1VCWA 1GI5A 5A8YA 3ZZCA 1YCPM 5HGGA 1V2WT 2FESH 1T4VH 1F5LA 5E6PB 3GDVA 1Z7KA 2BXTH 2RRMA 3RMMH 4GHNA 1OP2A 1IOEA 1ZPCA 4U30A 4YLQH 3ID4A 1BTXA 1F5KU 1CA0C 2J34A 1IQMA 1FV9A 2FO9A 2YNAA 4XHVA 1T8MA 4GAWA 4CH8B 2EEGA 1C1VH 1TA2A 4BNRA 5A2PA 1SQTA 2QF0A 1QJ7B 4X6PA 2PHBA 2W4FA 4RKOB 2ZTYA 4BOHA 2Z3DA 1THRH 3RMOH 1O3OA 2FMJA 1GMHG 2AFQB 2BD3A 3UNQA 4UU6A 5JBCS 2KYLA 1EAIA 1O33A 2C4FH 4CRDA 1KLIH 2BX4A 2F9VA 1GBBA 1GJ8B 2PKTA 2CF8H 2BY8X 5FX5A 1UJVA 3EAJA 4X1SU 1ELAA 4O3TA 2ZQ2A 1HFDA 3UOPA 4K72A 3V7TA 1GHAG 2IWQA 3ZZDA 1FY3A 1ZSLA 4IC6A 4CRBA 5DKMA 1XX9A 1YPHE 3RP2A 2Q6GA 2CS5A 3MO6A 4NWKA 3SW2B 2JWEA 1IQFA 1A2CH 1S84A 5A0AE 2VWOA 2OGPA 3Q3YA 3RXJA 3M3VA 1V6BA 2PKSC 2TGDA 4Y6DA 4R0IA 2PKAA 1UM1A 1N8OC 1LKAA 1MKWK 5FPTA 1IHJA 2CHAC 1FC6A 2WV4A 1UTQA 3OY5U 1Q31A 3GY7A 4JK5A 4B2BA 1TNLA 5EZ0A 2IWOA 4VGCB 3SNAA 4JOFA 4FVDA 1AUTC 4FUGA 2C90B 3UFAA 1F0SA 1V2QT 2FOHA 2FOEA 1TGCA 1TNKA 1ZHMA 2G8TA 4YTAA 2B7DH 3SJKA 4CR5A 3UREA 3UPEA 1MCTA 1BOQA 2VZ5A 3QGJA 5A8XA 1C1UH 1Y7NA 3ZZAA 3SFJA 4D7GA 5FX6A 1L1GA 8ESTE 5HFDA 8LPRA 4JMYA 1C5LH 2ODPA 3P92A 1V2JT 2XXLA 4OS2A 2ZF0H 2AMQA 1N7EA 2PGBB 3TGJE 3N7OA 1Q7XA 2G52A 2TBSA 5ETXA 5CE1A 1FNIA 2BYAX 3F9GA 1XMNB 2KAIA 5EOKA 3SV7A 4MPXA 4H4FA 2FOBA 1OWIA 2UZCA 1C2MA 2AMDA 2FS8A 4JOJA 2W7UA 3PO1C 1EB2A 1X8SA 2FWWA 4OEPA 4KTUA 3RXFA 3V3MA 3JXTA 1TQ0B 5DP9A 1BRCE 1UVPA 2PUXB 2OP9A 3GCHC 1NFYA 1VAEA 3CP7A 4Q2QA 4FVBA 2OC1A 4CHAB 4X1RU 2ZU3A 3MYWA 3VQGA 1AFQB 1AZ8A 5G1DA 1QA7A 3DUXH 1D6WA 4XBBA 3SGQE 1P2NA 1PPGE 4O97A 2QF3A 1BMAA 1P3EA 1G2LA 1SHYA 1EUFA 2BMGB 3SU0A 5JBAS 2DE8A 2FX4A 1HLTH 2G00A 3EGKH 1XUGA 1ZJDA 5EPNA 3ZZBA 2J92A 4DVAU 4FXGH 1NFUA 1Y8TA 4P0CA 2JREA 2ZCHP 1TONA 2ENOA 2H9TH 4YLUA 2R9PA 2XTTB 1BRAA 3BIUH 1GG6B 1SQOA 3TU7H 3QZRA 4IN1A 3RXOA 1P2JA 2ZCKP 3QJMA 4I7YH 1U37A 3F68H 3FVFB 4B73A 1EP6A 3W94A 3SOSA 3UIRA 3VB3A 1LVYA 2PSYA 5C5NA 1J16A 1O3MA 1DT2A 1MFGA
chains in the Genus database with same CATH superfamily
2IJOB 2ZDMA 1Y3XA 5E11A 1TRYA 2LC7A 1HB0B 5C1YA 1C2IA 2NWNA 4LXBH 2HE2A 1UK4A 1AHTH 4D8NA 1NN6A 5K0HA 2VPHA 1O3IA 4JK6A 5F8XA 3GYMA 1NBME 1A7SA 2FYQA 4H42U 1IQGA 3QK1A 2PTCE 2P59A 2WSSD 1UEQA 1IHTH 5C17A 2K0QA 2BVSH 4DGJA 2ZA5A 2ZG0H 4ZHAA 1THPB 1V6DA 4CR9A 1NY22 1TP5A 2VIQA 1UEZA 2OCVB 1ACBE 1AVWA 1A61H 4NFEA 2OPGA 4IW4E 1G9IE 4NA8A 2BYGA 5C0TA 1P06A 5GJ4B 1FN6A 1ANEA 4AYYB 1VGCC 1FZZA 1DSUA 3AASA 3U69H 3VFEA 2AERH 1NFWA 4Y79A 3DFJA 3BEFB 5FBEA 1QBNA 3AVZA 1WHAA 1TNHA 2KBSA 1O2ZA 3P95A 4AGKA 5G4BA 2H3LA 1CU1A 3KQ5A 3LH1A 1HAHH 5CHAC 1LDTT 4QT8C 2UWPA 2WZQA 4JYTA 3A8DA 2ANKH 4ABFA 4WMFA 3A82A 4I32A 2A45B 1O5BB 1UTKA 5AFZH 3SI4H 3M3TA 3K9XB 4Q7ZA 4ZXYH 3PLKA 3EGGC 4NZLA 2FIRH 2VH0A 2VIWA 4GVCA 2STBE 3GY6A 3TMHA 4FUBA 2HALA 1OPHB 3N7DA 3RU4E 2D8IA 1ZMNA 4JORA 2DM8A 2D8WA 3SJIA 2XWAA 3HKIB 3PMBB 3SNBA 1OSSA 3H09A 3S9AA 4LOYH 1ABIH 1TPOA 1HIAA 1YF4A 4I8LA 4ZHMU 5T6FA 4AN7A 1H9HE 3MFJA 3EE0B 2HNTC 5E0HA 3SI3H 2SGAA 3HVQC 4K78A 1NT1A 3PWCA 5CMXH 1GMHF 4RSPA 2JSNA 3V13A 4K75A 1Z71A 2GV6A 1MU6B 1L6OA 2ZECA 5FCRA 3MU0A 5IDKA 3ZZ6A 2A7CA 2UUFB 4MQAA 1DVAH 3E0PB 4I8HA 4MNWA 2AIPA 1WBGB 1MTNB 1UM7A 4K76A 2XCFA 1C1PA 1CGHA 5HM2A 1AWHB 2PW8H 3VB6A 2ZU1A 1Y59T 2I6VA 2BDYA 3SV6A 3R69A 1DSTA 2OS6A 3VB4A 1XUIA 1D3DB 1MC7A 2J95A 3PM3A 3M7TA 2PKAB 1B0FA 1QLCA 2GCTB 4OGXA 2AWWA 1QB1A 1CGIE 3CS7A 2ZHQH 1C1OA 2K20A 5DK1A 3GICB 2AGGX 3GSLA 2F9NA 1EJNA 4WXIA 4K6YA 1XUFA 3I77A 2Z7FE 1WI4A 4Q2PA 5FPYA 2FXRA 4X2WA 2ZP0H 3L3TA 2UUKB 1MBQA 1ELTA 3EYDA 3MH5A 4YYXA 5T6GA 3WKMA 4Y7BA 4IMQA 2B0FA 2CJIA 3U8OH 3TJVA 4UFEH 2LC6A 1A5IA 2VVCA 3MU1A 1H9LB 3IITA 4INLA 4R8TB 5HYOA 3DA9B 3PLPA 1P09A 2ZGBH 1W9EA 4DY7B 1OS8A 1YPLH 1DY8A 1HJ9A 3I18A 1C1WH 8KME2 1X5QA 3K6ZA 1HJ8A 4FUIA 4WMEA 5B42A 2BD4A 3EA9A 1DY9A 2VVVA 2I0IA 2JXOA 2RG3A 1FONA 1ZUBA 4OS4A 1T4UH 4O9VA 2O8LA 1W0KD 1AI8H 2C93B 1GBAA 2XBYA 4MTBA 1C5RA 4XFQA 3TGKE 1GPZA 1V2ST 2F0AA 4L8NA 1A5GH 3PRBA 1WU1A 1FLEE 3ID1A 1S0RA 4BANB 3UQVA 1LVOA 2Q6DA 3K6YA 1TABE 1XXDA 1EAXA 1ORFA 1XM1A 2KG2A 1BCUH 2OC0A 3S9CA 5EW1H 3S0NA 2QG1A 1ELFA 2W26A 2DC2A 2OC8A 4AG2A 3SU4A 2C8ZB 2YT8A 1WF8A 1GBIA 4MLFB 4ZXXH 1W13U 1J17T 3RXGA 3ZZ4A 3QGNB 4HZHA 1C5QA 2VIOA 1AVXA 1YC0A 3QLPH 4X2VA 5K7RA 1W0YH 2JIZD 2G5NA 3BSQA 1IU2A 1D3QB 4TT3D 1WHDA 5SGAE 1QB6A 1S5SA 3MI4A 3PRDA 3UUZA 2VSPA 2LPRA 2VWNA 1OYQA 2KPKA 3NZIA 1AY6H 1GVZA 5EW2H 3NUMA 3GOVB 3QZQA 1O2NA 1T32A 1F5RA 1SG8B 4UONA 1AMHA 4U2WA 1YBOA 3E6PH 1O2IA 1OP0A 3PMJA 4K60A 4HFPB 1N7FA 1E38B 4E06H 4JZEH 2JILA 2JH0D 2JIKA 3QWCH 3UAIC 1O2SA 1TYNA 1GBEA 1QAVB 2TIOA 5E1YA 2AYWA 2J2UA 5DP5A 3ZVBA 5JB8S 1V2MT 4AZ2B 2Z3CA 1HUTH 2A1DB 1B7XB 1ABJH 1QY6A 4FU9A 3MU4A 2V3MA 3R3GB 3U8RH 2ZHWH 2OUAA 1MU8B 2BTCE 3F2FA 1SKYE 4X1QU 4XDEA 1NU9A 2SGDE 1ARCA 1O3FA 1SLWB 1Q3PA 3ZRTA 3C27B 1TX6A 1MQ5A 2IPQX 1O3HA 3SHWA 1V5LA 4B75A 3E3TA 2FE5A 3H7TA 2NU3E 3MQKC 2GDEH 3E0NB 1HAVB 4ZAEA 3BTWE 5EIYA 4ZCNA 1X45A 3SU1A 1LKBA 4RI0A 4H6SB 3KZEA 1Y3WA 1O2JA 1OYTH 2JJ1D 4REYA 5J4QA 4SGAE 1GMCF 3A7YA 1A46H 1EPTC 1UITA 3VEQB 1H8IH 5C0UA 2XWBI 2GEFA 2OZFA 1YPHC 2PP6A 1YKTA 3SUGA 2JDID 4GCHF 1KY9A 4AMHA 4X6MA 1QCPA 1AD8H 2BLQA 2FX6A 1QAUA 1F7ZA 2Q6FA 3MWIU 4GPGA 1O5FH 2Z17A 2UWOA 3KHFA 3CYYA 1P01A 1RIWC 3P8GA 3FP6E 3ZZ8A 1VZQH 3Q3KA 2OQSA 4AFSA 2ZHFH 2ZCLP 4JOHA 5LGOA 1X5NA 2MHOA 2QC2A 2WPKS 5AFYH 4NCYA 3MHWU 3HPTB 4OM9A 1OWJA 1TFXA 1C2HA 1NZQH 2EDVA 1S81A 3RM0H 2CK3D 4JL7A 2W6JD 2OQUA 3A7VA 1NFXA 1BTZA 4K8BA 1GCDA 1YBWA 4DIHH 1IQHA 2KPLA 2OXSA 4X1NU 4XOJA 2Y6TA 1TALA 2A2QH 1A0HB 1DXPA 1YCPH 3N7EA 2WPMS 4LZ1H 4J1YA 1SOTA 1K1OA 5T1VA 2LUIA 1TMBH 2ZKSA 2BLOA 4WMDA 5B6LA 4BXWA 1D5GA 1RTLA 4FOUC 3TH2H 2BDGA 3RDZA 1HGTH 1NTPA 2A5IA 2FLRH 1GL1A 2C8WB 5T3HA 2GV7A 2AS9A 2P3UB 4O3UA 4A92A 5JPMH 1GCTC 1GI9B 3A89A 3SN8A 2B9LA 4YT6H 1DS2E 3RLYH 4K2YA 2D1JA 2L74A 2SGFE 2XNIA 3CC0A 1X5RA 2KL1A 2PDZA 3NCVA 2VNTA 3TVJB 1GM1A 2ZO3H 3PMAB 3SU6A 1YYY1 1CGJE 4Q4LA 3A8AA 4JYVH 1GHZA 5L2ZH 1OZIA 1BA8B 3M61U 1CSOE 1KLJH 1W11U 3F0PA 4ISLA 1LQEA 4F55A 2THFB 2SNVA 2WPJS 4I86A 1W9OA 4TSFD 4N6XA 2H9EH 4CBOA 1PDRA 3F1SB 1MFLA 1B0EA 4FGMA 1C5PA 1UEWA 3RXTA 1V2NT 2YUYA 2BM2A 4WYTA 3TPIZ 3RXPA 1KXCA 2EXGA 2BD7A 2SGEE 1YWUA 3IG6B 3UR9A 1BRBE 1FC9A 1C2KA 4TY6A 2ZDLA 3E90B 5A8ZA 1KYNA 2NU2E 4NFFA 1K1MA 4Z1MD 1FN8A 1BTYA 2Q9VA 1LHDH 5E8EH 1CA8B 1GWAA 1ANBA 1WG6A 3ESTA 2GMTC 5GWZA 1G9OA 2QF5A 2WL7A 2DLUA 1TNIA 3PTNA 4KP0A 4F4OC 3HK3B 1O3CA 4ABHA 1FCFA 3UWIA 2BD9A 4Q2NA 4UE7H 3BEUA 3GCTG 1O2KA 5C67A 1HRTH 4Z33A 5DP6A 1W14U 1PPHE 2I4SA 4XD7D 3LGUA 3GGEA 1QJ1B 3D23A 3JZ1B 5FHTA 1XXFA 3QTVH 3M37A 1TQ3A 4E3BA 2CXVA 1GQ4A 1EZQA 3WW7A 1IAUA 1JRSA 1S6HA 1SR5C 1W10U 3CBYA 1P0SH 1ZTKA 3BEIB 4NA9H 1ELVA 4GUXA 3DIWA 2QKVA 2IWPA 3M5MA 4ISHH 3BPUA 5B6OA 3TJOA 1OKXA 2P3WA 3GY8A 1J9CH 2EI8A 4ABJA 4NXPA 4H11A 4YM9A 4TWWA 2QV1A 1C4Y2 1H8DH 1OWEA 3SU2A 1MZAA 3D62A 1E37B 3SO3A 5HJ1A 1C4V2 1FC7A 1C5XB 3R68A 2ZU4A 2PA1A 1G3BA 1G3EA 1L0ZA 1O2UA 3M5LA 1TLDA 1WYKA 2XBVA 3EQ0H 5IYTA 5GLJA 1TBZH 2LOBA 1LTOA 2WPHS 3FP8E 1GI1A 3AAUA 4WH6A 1ID5H 4NA7A 1TIOA 1O3DA 1C2GA 3BF6H 1OBZA 1BZXE 1TBQH 2FLBH 1MAYA 1UVTH 1CA0B 1G30B 2YMSB 4E7RG 8GCHF 2VGCC 1SGEE 1K2I1 3RL7A 2PFEA 3GY5A 2XCNA 4R2ZA 2Y80A 3F6UH 1P9SA 1O2WA 2G81E 1EP5A 5EXLA 3VXFH 1HNEE 3WWFA 5GXPA 3RC5A 5GDSH 1EXFA 4KTCA 1LPKB 1F0TA 2ZPLA 4ACBA 3VPKA 4ZHLU 4GHQA 2WUCA 4IBLH 3TK9A 3QN7A 4MPUA 2V3HH 1AO5A 2OTVA 1XVOA 3Q77A 5ESBA 2WPLS 3ZVGA 4X6NA 3ID3A 1TGNA 1QL8A 1VJAU 4GLYA 5HMAA 3E17A 1TPSA 1GBTA 1PYTD 1DFPA 1O2OA 5JBBS 3KGPA 2F5YA 5BRRE 1EKBB 2BQ6B 2G2LA 3V12A 1M9UA 2KOHA 3A8BA 1L1NA 5E0JA 2P3FH 3F3BA 2ZQ1A 1GI2A 3PV4A 5E22A 2A5AA 2BOKA 5HEBA 1AKSB 1QRWA 1GL0E 4WJG2 7KMEH 2PV9B 4RKJB 1O0DH 2FOAA 2J97A 3OAAD 4B1TA 5L6NH 1QBVH 5EYZA 2ZDKA 1O5CB 2KFWA 2UWLA 1UTPA 4I33A 3QTOH 1WOFA 1GHYH 1UMAH 2BD8A 2XNDD 4BAKB 1UK2A 2PKSB 1QURH 2F43B 2J9NA 3ATLA 1SOZA 5EXNA 1GHBF 1N8OB 3U98H 2VH6A 3PDZA 1HYLA 3ATKA 4D76A 2CHAB 5FXLA 3TNSA 4ABBA 4ESTE 1ZOMA 3LKWA 1PPZA 3LIWA 1HJAC 1FUJA 2J98A 3R0FA 1G3CA 4ISOA 3ZZ5A 1CHGA 3NFKA 2P93A 2W5EA 3O8DA 1WSSH 2QXGA 3L33A 4WXVA 3FOAA 3TH3H 4YO9A 1RRKA 2ZEBA 7LPRA 1KDQA 5L2YH 1LMWB 1YPGH 1OWKA 1P10A 1YPEH 4FLNA 2PUQH 1VCQA 4E7NA 3RXLA 2BB4A 3BTTE 4X8SH 5LPRA 5AF9H 1D6RA 2EEJA 1T8LA 4NIYA 5ILBA 1PJPA 4G69A 1QAVA 1P1DA 1DWEH 3PV2A 5DJ7A 2Y7ZA 1GVKB 1Z1IA 2Z9JA 2ZU5A 5DN6D 1SGFG 2KQFA 3HPMA 1Y3VA 1YLCA 2ZU2A 1ELDE 4WWYA 5A0CA 1MD7A 2PR3A 2KV8A 1XZ9A 1GHWH 2G5VA 1BJUA 1K1PA 3T2NA 1SHHB 1TMTH 3ZVAA 1ZTLA 3BTGE 3HGPA 4D9RA 1GMCG 1P03A 3PO1B 2BLVA 1SGTA 2H5DA 4X1PU 2KM0A 1HAVA 4X8VH 2O8WA 3RXVA 4NXRA 4GCHG 1S83A 4A1VA 3GCHB 1I16A 1ZPZA 2IJD1 2FOFA 1Y5BT 1BE9A 2DUCA 1TRMA 1RTFB 3S69A 1K1IA 2QXHA 5EQSA 3DHKH 2BY6X 3LGVA 2TGAA 3GCNA 1GBLA 3O8BA 4ABEA 2BLWA 1NU7B 1CT2E 2KJDA 1WTHD 3A88A 1N1LA 4HGCA 5EJLA 2OQ5A 2R3YA 3MU5A 1UVOA 4U32A 3KL6A 9LPRA 3D65E 1QFKH 1AB9C 3SJ8A 1K28D 2KCYA 1DXWA 3BG4C 1XVMA 4U01A 1O5DH 3VQFA 3UWJH 1O37A 1O3AA 1DDJA 2BQ7B 2SFAA 4ASUD 1O39A 2ZFPH 1EATA 3PROA 3BV9B 1U39A 1RGQA 1DUEA 4Z0KA 2SNWA 2QYIA 2TGPZ 1GBKA 2XW9A 1WTGH 2BDHA 1HPGA 1C5NH 1O3JA 3F9EA 4YOIA 4Q80A 1BFEA 3SJ9A 1BHXB 1WQSA 1HBTH 3ATWA 4I8GA 1CQQA 2VIVA 2OBOA 1UK3A 1SGFA 1NTEA 1BUIA 2ZWLH 3NK8A 2C3SA 4XBCA 4JOKA 1DOJA 3EE7A 1LHEH 2DE9A 3TITA 1ZRBA 1O5GH 2Y5FA 1HAYB 3GCTF 2KZ4A 2PKUA 2Y82A 4ABAA 2E7KA 1W7GH 2P8OC 1SSXA 3M7QA 1A5HA 4FUJA 1VJ6A 2QA9E 3WWBA 2BDBA 3S7KB 1O3NA 1PPBH 2ALPA 1GBFA 2FDAA 2P16A 2NU4E 1MKXK 2O9QA 1W8BH 4BXSA 3ZVEA 2KX4A 1A1RA 1MQ6A 3ZVDA 1C5WB 1VGCB 1KEFA 1P2QA 2ZDVH 3MNCA 1WAYB 3QE1A 4NNMA 1XKBC 1O2VA 2V3OH 1Z6EA 2WPIS 1GQ5A 1LPZB 1EJAA 1XUHA 2QF4A 5DP8A 1EZXC 6GCHG 1WDIA 1QIXB 3STJA 1UVUH 1O2LA 1X7AC 3RLEA 2NU0E 2BOHB 1THSH 3SHCH 5A2MH 5FPSA 1UHBB 5F03A 1CBWC 2A4OA 5CHAB 2BD2A 4F48B 2A5KA 1RY4A 6CHAC 2L6OA 1C5SA 1AUJA 4HOPA 3KN2A 2H1UA 2JETC 2EEHA 1FY8E 2KR7A 5HFCA 4Y8ZA 3ZZ3A 3U1IB 3ODFA 1V2PT 1NM6A 3FO8D 2ZPSA 1ZYOA 1RXPA 1W0ZU 1PPCE 1Y3YA 4YT7H 3RU4T 4OS6A 2VU8E 3VGCC 1GDNA 2KOMA 1Y5UT 2M0VA 4XE4A 2ZFFH 3O8CA 1C1NA 3V0XA 3BTHE 2PNTA 1MKXH 1UTLM 1HV7A 5JYIA 1OBXA 2ZI2H 2OLGA 3SYJA 2TPIZ 4AFZA 4YXWD 1ESBA 1PQ5A 4WY3A 2G55A 4Y0ZE 3URDA 3SQEE 4JJ0A 1SI5H 3A7ZA 4WYUA 4ZKSU 5EJZA 1DX5M 2K1QA 2STAE 2RFKC 1WJLA 1PYTC 4JOGA 4Y8XA 3URCA 3DORA 1TPPA 1FY5A 1EX3A 1XUJA 4NIVA 4X2XA 4CRFA 3T27A 1ZRKA 1MMJN 4E35A 1UJUA 1O2TA 3KEEA 1FDPA 1JIMA 1CO7E 3KQBA 4YZUA 1NBMD 5AHGH 2XRCA 4THNH 1LQDB 2UUJB 3BTKE 3NRLA 1ETTH 1SLVB 3AW1A 3DSOA 4CBNA 1CE5A 3QIKA 4P00A 3E91A 4BAMB 4ZH8A 1DANH 1EB1H 1HAZB 1O5EH 4CREA 1TX7A 3SUDA 2ANYA 3CBXA 1VCPA 5F6MA 1QRXA 1CHOG 1GHVH 2AGEX 2J98B 4K1SA 3MH6A 3EDXB 3LH3A 4UFGH 3SU5A 1QBOA 4SGBE 2HWLB 3LNXA 5CHBA 1O3KA 2OD3B 1Z8GA 1U38A 4FUDA 3MO9A 5HF4A 2VWMA 4YDPA 3DCLA 3H5CB 4O06A 3AXAA 4NMOA 1BMNH 2QN5T 3PB1E 4K1EA 1BRUP 3UQOA 3H7OA 4INHA 5I46H 1KDQB 1KSNA 1DWCH 5DO4H 1Y5AT 1E79D 3L6PA 4Y71A 5H3JA 2BD5A 2VIDA 3LJOA 2ZC9H 2FYRA 1FQ3A 1NROH 1O3LA 4AORA 1BMLA 4AB9A 3DT0H 2XBXA 1P05A 3SV9A 5C1XA 3QUMP 1RS0A 2P94A 5GIBA 1FY1A 2AH4X 4MPWA 3MO3A 2A4RA 1GMDF 3G01A 1RZXA 2F9PA 2RCZA 3NKKA 4AOQA 3UNSA 1BB0B 2EHRA 1C4U2 1E34B 2JH6D 3I29A 2HOBA 4BTUB 1VA8A 2Z9KA 1OP8A 2RA0A 1WF7A 4NIXA 4MPVA 2XC0A 3DFLA 1SGNE 1T8NA 1WQVH 3RU4D 1SFQB 3PYHA 1J14A 2Z9IA 3LGYA 1N6YA 2EI6A 2QAAA 1Z8RA 3BG8A 1UTMA 2JOAA 2QT5A 3BTME 1W7XH 1GI0A 2FTMA 4M9FA 2ZFQH 1QA0A 3KF2A 1GI4A 4PQWA 4I31A 2EI7A 1KWAA 3I1EA 2QIQA 5G1EA 1YCPK 1BDAA 3NGHA 4B6FA 1GGDC 2P3TB 2PGQB 1NESE 3KQDA 1S82A 2A4QA 3M35A 2O8MA 2H5CA 4AFUA 3SZNA 1AKSA 3M3SA 1GHBG 4TYDA 7ESTE 2ASUB 2ILNA 5GNDA 1D3PB 1ZHPA 3QGLA 1G2MA 2EDZA 2V90A 4A7IB 3MNBA 2ZPMA 3TSVA 2GCHG 4K1TA 4B71A 1FIZA 1N6DA 2H6MA 4NMTA 3LPRA 3AK5A 2NU1E 2W7RA 2WINI 1A0JA 2J4IA 2RCEA 1MD8A 3FZDA 1O35A 5DP7A 5EJ1A 3DSPA 1P12E 4ZKOU 1SB1H 1O3EA 4DG4A 2R0LA 4JZFH 2AGIX 2PWXA 1AWFH 1UF1A 1KTTB 1O5AB 3BIVH 4B76A 3RXAA 1V2RT 3EA8A 1TBRH 1LVMA 1P2IA 2ODYB 1AQ7A 3HPKA 2KAWA 2UUYA 2ZTZA 5DP4A 3S9BA 1MZDA 1SGYE 3FP7E 2FM2A 2PZDA 4DW2U 4ISIH 2LA8A 1N6EA 3MH7A 3I78A 5DPAA 2OC7A 1T31A 1YPKH 2IWNA 1EFRD 1SVPA 3GABA 2ZDNA 2R2MB 1FMGA 2GDDA 3PLBA 4B2CA 2BDIA 1UVSH 2G4UA 2D92A 4CRAA 1WIFA 3M7UA 1MTUA 1N6FA 1C1TA 5HXFA 3B9FH 4NMPA 4E05H 5JB9S 1TWXB 1BTHH 4KGAA 2A7JA 1TE0A 1GJ9B 3KIDU 1EZSC 1NRQH 4Z8JA 4Q2KA 3O5NA 4FUCA 5DG6A 4NMSA 2CV3A 1MTSA 5A09A 2H2ZA 5TCCA 2D26C 4ZMAH 1O2YA 2O8UA 3A85A 1DLEA 3RXSA 1O2HA 1G37A 1UTNA 4KELA 3SOEA 2TRMA 2F9UA 3OU0A 1DWDH 1SC8U 1BQYA 1DPOA 2ZFTA 2ZTXA 2GGVB 3GDUA 1TGTA 2ODQA 3LGTA 2Z9LA 5CDFE 1MTWA 1EPTB 2O8TA 2ZHEH 1SGDE 3OEED 2BDCA 1Z86A 2QXJA 3MTYA 1EZUC 1XKAC 2R2WU 4NXQA 1BTPA 2CSSA 1S0QA 1GBHA 1MTVA 1EASA 1JIRA 3SHAH 3RMNH 5GCHG 2D2DA 5E2OA 1RIWB 1NPMA 2WV5A 6GCHF 1C5YB 4RN6A 5C3NA 1C5TA 3ZV8A 1TGBA 4HOPB 3GJ9A 1NF3C 1V2LT 3ZYEA 5F67A 1O3GA 3HGNA 4X2YA 2FPZA 3OTPA 2H2BA 5F8TA 4DIIH 2I6QA 2GTBA 4IGDA 1WUNH 1H1BA 1P57B 1L1JA 3GY3A 4A1XA 3RXKA 5ABWA 3SGAE 2XC5A 5HDYA 3OYPA 2FN5A 1W0JD 1QHRB 2DAZA 3OFND 1FY4A 2EEIA 3FAOA 2WPDD 4VGCC 1C2JA 1A3EH 5ESTE 5T6DA 1C1MA 3RXHA 1JBUH 2ZFSA 4WF8A 3WKLA 1ELGA 1ELBA 2VRFA 3DD2H 4AX9H 1SQAA 1BBRH 1UFXA 1ETSH 1FAXA 1H9IE 1YM0A 4JZDH 1K1NA 3VXEH 3M36A 2CN0H 5C2ZA 2VWLA 1BJVA 4ZUHA 4FUEA 2QE7D 3PMHB 3ZVFA 3ZIAD 2BQWB 3U28C 3KNXA 2AINA 5LH8A 2I1NA 1HCGA 1TMUH 3PV5A 1FPCH 5HKKD 5IK2D 3K50A 4B6EA 1W9QA 1GCTB 2LELA 1QRZA 3LGIA 1ANCA 1C9TA 4ZKNU 1QNJA 3TSZA 2HRVA 3F9HA 1GI8B 1A4WH 1IQNA 2C8XB 3SUEA 4GSOA 4IMZA 3Q00A 1NC6A 2QBWA 1W2KH 2VBCA 1C2DA 4ACAA 1QGFA 1KMHB 1AVGH 1KTSB 1TNJA 1P02A 1LCYA 2F9OA 2GZ8A 4OAJA 1OOKB 1Y3UA 2BX3A 4TWYA 1E36B 3SQHE 4M7GA 3VB7A 1FX0B 2FCFA 3A7TA 4LMMA 1FXYA 2WYGA 1X6DA 1YGCH 4YOJA 2I0LA 1MBMA 3NPSA 4CHAC 4ISNA 3KZDA 2BXUH 1CHOF 1V1TA 5C94A 1YPMH 2OMJA 1UHBA 1V2KT 1AFQC 3ID2A 3LNYA 1P2MA 4B74A 4TY7A 1UJDA 1A0LA 2ESTE 1Q2WA 2CF9H 1PFXC 1WV7H 1HAGE 2QKUA 1G32B 3W95A 2GMTB 3D49H 1DWBH 1Z1JA 2VB0A 1C5VA 3A86A 2M0ZA 2J94A 2HLDD 1KXDA 1C2FA 4MNXA 5AVDA 5C1UA 2OBQA 1P04A 7GCHF 5HFFA 2ANWA 1GG6C 1NRSH 2AWXA 1YY3A 3KHVA 4NZQA 3P8NA 3A8CA 2FNEA 2V1WA 3AW0A 1O2GH 3R0HA 3SNDA 3BTFE 1EQ9A 1SMFE 3PTBA 2H9HA 1C2EA 4F8KA 4Q7XA 4D7FA 2HPPH 4FETA 1B5GH 3MH4A 2FTLE 1AU8A 1C1RA 2ZFRH 2KCAA 4IS5A 4TPIZ 1V62A 2OINA 3F0OA 3M5NA 4K8YA 1D4PB 1S6FA 4KFWA 2M10A 3P8OA 1ZJKA 1MKWH 1O38A 1FI8A 2BZ6H 3OSYA 2F83A 1EAWA 3CS0A 4OS7A 2F3CE 1AGJA 2HLCA 9ESTA 4Q6SA 4Q2OA 1F0RA 4Q6HA 1V2UT 3FFGA 3SUFA 3BTDE 3RUOA 3RXUA 3EGHC 1TOCB 3K1RA 2C8YB 5TJXA 4DURA 4Q3HA 1ARBA 2IOTA 3U8TH 5E2PA 1PQAA 2F91A 5KECA 2SGQE 3NXPA 3QO6A 2GCHF 4YOGA 3ZZ9A 4ABGA 4AG1A 2A31A 2V7QD 1RGRA 1M5ZA 1UCYE 1GJ7B 4DCDA 5JXBA 3Q76A 4Y10E 1GJ6A 4A1TA 5FAHA 1Z87A 2OK5A 2QCYA 2O2TA 4GVDA 1O2RA 5L30H 1Z8IB 1F0UA 1ELEE 1GMDG 1LVBA 2JINA 3VB5A 4IN2A 2YOLA 3MNXA 5E0GA 4CRGA 2VGCB 4B2AA 3P17H 4HI3A 1O2PA 1VITH 1JWTA 1VITF 1BBRE 3KCGH 4UD9H 4D9QA 2L4SA 1ZMJA 1TNGA 3RC6A 3HK6B 5LPEA 1UTOA 4Y8YA 2F9BH 2F4LA 1ZSJA 1P11E 3TH4H 1AE8H 4DOQA 1MAXA 1OX1A 2R3UA 2OSGA 4MVNA 3SORA 2FI4E 1SGIB 2D90A 3QDOA 2ZNKH 1CT4E 3ZV9A 1SPJA 3UOUA 3GCOA 1V5QA 2PTNA 4A5TS 3O8RA 1Z8JB 3A83A 3RL8A 2VVUA 3PS4A 3OEHD 1BHXF 2FOCA 2ALVA 3B23B 3GDSA 1C5OH 2M2AA 3FY5A 1IQEA 2EEKA 4NMVA 2GZ9A 2FI3E 4H6TA 4K69A 2J38A 1ZTJA 2R0KA 1FIWA 1GVLA 3T29A 1IQJA 4I8KA 1HXFH 4AFQA 1F92A 2EV8A 2BDAA 1TX8A 2VSVA 1K9OE 3LC5A 2EC9H 1P8VC 3SUZA 1O34A 3LDXH 1WFVA 4JZIA 4NSVA 1NRRH 1Z6JH 4JZ1A 3E1XB 5BPEA 4UU5A 3U9AH 2ULLA 1KLTA 1MTNC 3N99A 2HGAA 5HFBA 4ABDA 1AN1E 1BITA 1J15A 3K82A 2W3IA 4WVPE 1NS3A 1O3BA 1ZGVA 2BY7X 2Z6BD 5DP3A 3TJNA 3NFLA 1K22H 2EDPA 3QDZB 2L4TA 2BVXH 4BAOB 1A3BH 2GD4B 1DM4B 3LU9B 1HJAB 2EQNA 1EAUA 3CENA 2AMPA 3S7HB 2GCTC 2FP7B 1RGWA 5D13A 2YTWA 4ZROA 5GCHF 1ZSKA 3TK5A 4BTIB 3E16B 2REYA 1L2EA 2PSXA 4OS5A 1GI6A 2B8OH 2ZGXH 4DJZB 5FCKA 2HE4A 4I8JA 1WCZA 4BTTB 5JBTA 4Y0YE 2LNCA 2Z3EA 1ELCA 3RMLH 3FZZA 3SU3A 5KGOA 3OX7U 4GVUA 1GJ4H 1V3XA 1HDTH 1SBWA 2GX4A 3BN9A 6ESTA 1DLKB 2G51A 1O32A 1UHPA 1GJ5H 5EPYA 2BZAA 1JRTA 2JJ2D 1ZMLA 2W3KA 3T25A 3LOXA 2ZDAH 4PROA 2W7SA 2Y5HA 1QJ6B 3OE7D 1MH0A 1SGQE 1SFIA 1MUEB 3P70B 1CVWH 5A0BA 3UR6A 1TQ7B 1GHXH 1UO6A 1SGCA 1P1EA 2R4HA 2EJYA 4MNYA 5EQQA 1I92A 4A6LA 2HNTF 2YT7A 2BY5X 2VJ1A 4K3JA 3SGBE 3PWBA 2M3MA 2P95A 2HGTH 2I6SA 1ZHRA 2DJTA 1LPGB 1TA6A 2A0QB 2ZZUH 3HATH 1E0FD 4Y7AA 2QXIA 2CSJA 4FUHA 4ZKRU 1YPJH 1VB7A 4RT1A 2EAQA 4X8UH 2M0UA 1AE5A 1EPTA 1YLNA 2L97A 4JJ3A 1ETRH 3SV2H 2KA9A 1GJDB 1GHAF 2XYAA 3LONA 5GPIB 5HIYA 2B5TB 1YP9A 2DKRA 3P8FA 4NSYA 1D3TB 2FOGA 4IC5A 3RXCA 2BVRH 3T26A 3T62A 4K5ZA 1VR1H 1AB9B 4ABIA 2A7HA 1PPEE 1QQ4A 3ZYDA 4E34A 3BG4B 3QX5H 1W12U 2FS9A 3PDVA 4P2AB 4JCNA 1PQ7A 2ZHDA 5TCAA 3KQEA 1RTKA 1TB6H 3TGIE 4MDSA 1MCVA 1S85A 3BTEE 1H4WA 2ZGCA 1EJMA 4CRCA 1TP3A 1BTUA 1WFGA 1B8QA 1AIXH 1LHFH 2BHGA 2Y7XA 5F8ZA 2AHME 3SHUA 1O31A 5JDUB 1VJ9U 1R6JA 2XC4A 5EODA 4MPAA 5DSFA 3SNEA 3MU8A 2HVXA 1HXEH 2KJKA 2ZIQH 2XOKD 1WXRA 1ZR0A 2DLSA 2GZVA 3A80A 3RXBA 4Z6AH 1O2XA 4GHTA 3RXRA 1KXAA 4HTCH 3MMGA 3RXQA 4AYVB 3IWMA 2G4TA 2KRGA 4X8TH 4KKDA 2YMSD 5HM9A 2FOMB 1UJ1A 2WYJA 4NMQA 1LO6A 1D9IA 4LZ4B 4Y76A 2FI5E 2P8OB 3EA7A 5HEYA 3TK6A 1GJCB 2Y5GA 3SJOA 1L4ZA 3LC3A 2DB5A 4NMRA 2KAIB 5HIZA 1T8OA 1K1LA 1JMOH 3RLWH 1BT7A 1HAIH 4UDWH 5HEDA 2Z94A 4J2YB 1OWDA 1INCA 3AAVA 3U1JB 3JZ2B 2VINA 2GVFA 3CNRA 2X7ZA 1U6QA 1ZOKA 3A84A 2EGNA 1P9UA 1XUKA 4AB8A 3O46A 4NNLA 1QB9A 1SL3A 1GI3A 3A7XA 3GS9A 1N6XA 1Q3XA 4DT7B 2DMZA 1C5ZB 1TOMH 3LT3A 1ESAA 1BTWA 1IU0A 2V35A 2GP9B 1P2OA 1HAPH 1CBWB 3KDGA 1AZZA 1GJBB 3ATMA 4FUFA 2QKTA 6CHAB 3DJAA 3WY8A 1QL9A 2JETB 2M5TA 1F2SE 4XRNA 3E8LA 2ZGJA 1FPHH 1DE7H 1DITH 1Q3OA 2VWRA 1TAWA 5H4IB 1WH1A 5F3XA 4KTSA 3A7WA 1T7CA 3UNRA 3VGCB 1N99A 1GI7B 4WH8A 7GCHG 2H3MA 1FJSA 1TPAE 4JOPA 3A87A 4Y11E 3GY2A 4EDJA 1K21H 5EGMA 1C1QA 3ODDA 3NCLA 3ENSB 1BMMH 4O03A 5HFEA 2GKVE 1O30A 1SLXB 1P3CA 3T5FH 4JOEA 1LHCH 3MNSA 3SZEA 4OS1A 1BIOA 1K32A 3HKJB 3F2HA 1IQKA 2HNTE 2Q1JA 3GYLB 4ASHA 1GDUA 5HETA 4INKA 1JOUB 3TIUA 1V2VT 4MNVA 3K65B 2ZPQA 3P6ZB 1HAOH 1O3PB 2VIPA 4P02A 1O2QA 1RD3B 5EU8A 1ZLRA 1P2KA 3SV8A 1N7TA 2ANMH 1SLUB 1ZPBA 2JH5D 1KIGH 3B76A 3DJ3A 2TGTA 3OTJE 3Q3XA 5EG4A 5I25A 2RDLA 4MG3A 1DUAA 4RT0A 1C5MD 6LPRA 1QR3E 3KQCA 3RXEA 1OBYA 2A32A 4NIWA 1C2LA 1CT0E 2IN2A 1KXEA 1NRPH 2XBWA 1TRNA 1GBCA 2KOJA 4BAQB 1FAKH 2PLXA 4JYUH 3CH8A 3TJUA 3RXMA 2G5MB 1GBJA 1NO9H 2YNBA 1EOLA 3B8JA 3ITIA 1TGSZ 2Y81A 5C5OA 2AWUA 3OY6U 5F53A 3A81A 3ZVCA 1X9ZA 4UFFH 3RXIA 2OCSA 1SGRE 5FBIA 3TNTA 2WHXA 1H8HD 3SBKA 1GJAB 2A4GA 4KFVA 5EXMA 1UW7A 4BAHB 1ZZZA 5E21A 5C20A 1T2MA 3CBZA 1QTFA 8GCHG 1EOJA 3F9FA 3ATIA 2CMYA 2M0TA 1O36A 4OGYA 1NRNH 2MX6A 4XSKU 1ZGIA 1VITG 1E35B 4CH2B 4Q63A 1KXBA 3SNCA 5DTHA 2GT8A 5HF1A 2SGPE 2K8IA 1AFEH 1J8AA 2FODA 1IHSH 3NWUA 4F49A 2GZ7A 1OXGA 2BY9X 4Q7YA 1SGPE 1DICA 4NWLA 3L4FD 1L4DA 2QGRA 4X6OA 2V0BA 3T28A 4TPYA 3UTUH 1O2MA 3GISB 2FZZA 3MOCA 1SQRA 1UTJA 3M5OA 3LJJA 3K2UA 5EQRA 1YLDA 2IPHA 2Z9GA 3ZZ7A 1ANDA 1COWD 2RDEA 1HIAB 4AGJA 1KXFA 2HPQH 4FU8A 4NGAH 3FN8A 1UCYK 3TLOA 2FEQH 1ESTA 3QJNA 2AEIH 4XBDA 2YUBA 1RFNA 3W1EA 1GDQA 2JKHA 1K1JA 2Q3GA 1RJXB 2V6NA 1QQUA 1C9PA 4DT4A 1UEPA 1QZ8A 4X0WU 1GGDB 1V2OT 2CGAA 3FKSD 1W3CA 3LGWA 2I04A 1GBMA 1U3BA 2QY0B 1OWHA 5DGJA 2EA3A 5KEDA 1BBRK 2A2XH 1V2TT 3C1KA 3FANA 1G3DA 4LK4A 2AIQA 3KYFA 3BTQE 4FU7A 2H2CA 1JXPA 4NG9H 2ZPRA 3UY9A 1IQIA 2K1ZA 3GY4A 4UEHH 3RC4A 1H8ED 3RM2H 5PTPA 1QL7A 2WUBA 1PQ8A 1G36A 2GT7A 5J4SA 2EGOA 3DJ1A 3STIA 1HAXB 2KJPA 2EGKA 1C1SA 1C5UA 5FB8C 3ELAH 5I7ZA 1IQLA 3I4WA 3RXDA 4YESB 1PPFE 2ZGHA 1UCYH 2RA3A 1GBDA 3DSGA 1WI2A 1S6LA 4UFDH 5LPFA 4OEOA 1LHGH 3TSWA 1VCWA 1GI5A 5A8YA 3ZZCA 1YCPM 5HGGA 1V2WT 2FESH 1T4VH 1F5LA 5E6PB 1E1QD 3GDVA 1Z7KA 2BXTH 2RRMA 3RMMH 4GHNA 1OP2A 1IOEA 1ZPCA 4U30A 4YLQH 3ID4A 1BTXA 1F5KU 1CA0C 2J34A 1IQMA 1FV9A 2YMSC 1VKYA 2FO9A 2YNAA 4XHVA 1T8MA 4GAWA 4CH8B 2EEGA 1C1VH 1TA2A 4BNRA 1MABB 5A2PA 1SQTA 2QF0A 2J5UA 1QJ7B 4X6PA 2PHBA 2W4FA 4RKOB 2ZTYA 4BOHA 5IL9A 2Z3DA 1THRH 3RMOH 1O3OA 2FMJA 1GMHG 2AFQB 1OHHD 2BD3A 4UU6A 3UNQA 5JBCS 2KYLA 1EAIA 1O33A 2C4FH 4CRDA 1KLIH 2BX4A 2F9VA 1GBBA 1GJ8B 2PKTA 1K0HA 2CF8H 2BY8X 3F2GA 5FX5A 1UJVA 3EAJA 4X1SU 1ELAA 2WV9A 4O3TA 2ZQ2A 1HFDA 3UOPA 4K72A 3V7TA 1GHAG 1BMFD 2IWQA 3ZZDA 1FY3A 1ZSLA 4IC6A 4CRBA 5DKMA 1XX9A 1YPHE 3RP2A 2Q6GA 2CS5A 3MO6A 4NWKA 3SW2B 2JWEA 1IQFA 1A2CH 1S84A 5A0AE 2VWOA 2OGPA 3Q3YA 3RXJA 3M3VA 1V6BA 2PKSC 2TGDA 4Y6DA 4R0IA 2PKAA 1UM1A 1N8OC 1LKAA 1MKWK 5FPTA 1IHJA 2CHAC 1FC6A 2WV4A 1UTQA 3OY5U 1Q31A 3GY7A 4JK5A 2HVYB 2GJGA 4B2BA 1TNLA 3VG8A 5EZ0A 2IWOA 4VGCB 3SNAA 4JOFA 4FVDA 1AUTC 4FUGA 2C90B 3UFAA 1F0SA 1V2QT 2FOHA 2FOEA 1TGCA 1TNKA 1ZHMA 2G8TA 4YTAA 2B7DH 3KYGA 3SJKA 4CR5A 3UREA 3UPEA 1MCTA 1BOQA 2VZ5A 3QGJA 5A8XA 1C1UH 4AC9A 1Y7NA 3KDKA 3ZZAA 3SFJA 4D7GA 5FX6A 1L1GA 8ESTE 5HFDA 8LPRA 4JMYA 1C5LH 2ODPA 3P92A 1V2JT 2XXLA 4OS2A 2LP6A 2W6ID 2ZF0H 2AMQA 1N7EA 2PGBB 3TGJE 3N7OA 1Q7XA 2G52A 2TBSA 5ETXA 5FL7D 5CE1A 1FNIA 2BYAX 3F9GA 1XMNB 3UB0A 2KAIA 5EOKA 3SV7A 4MPXA 2EY4C 2FOBA 4H4FA 1OWIA 2UZCA 1C2MA 2AMDA 2FS8A 4JOJA 2W7UA 3PO1C 1EB2A 1X8SA 2FWWA 4OEPA 4KTUA 3RXFA 3V3MA 3JXTA 1TQ0B 5DP9A 1BRCE 1UVPA 2PUXB 2OP9A 3GCHC 1NFYA 1VAEA 3CP7A 4Q2QA 4HG6A 4FVBA 2OC1A 4CHAB 4X1RU 2ZU3A 3MYWA 3VQGA 1AFQB 1AZ8A 5G1DA 1QA7A 3DUXH 1D6WA 4XBBA 2KCPA 2KCOA 3SGQE 1P2NA 1PPGE 4O97A 2QF3A 1BMAA 1P3EA 1G2LA 1SHYA 1EUFA 2BMGB 3SU0A 5JBAS 2DE8A 2FX4A 1HLTH 2G00A 3EGKH 1XUGA 1ZJDA 5EPNA 3ZZBA 2J92A 4DVAU 4FXGH 1NFUA 1Y8TA 4P0CA 2JREA 2ZCHP 1TONA 2ENOA 2H9TH 1E1RD 4YLUA 2R9PA 2XTTB 1BRAA 3BIUH 1GG6B 1SQOA 3TU7H 3QZRA 4IN1A 3RXOA 1P2JA 2ZCKP 3QJMA 4I7YH 1U37A 3F68H 3FVFB 4B73A 1EP6A 3W94A 3SOSA 3UIRA 3VB3A 1LVYA 2PSYA 5C5NA 1J16A 1O3MA 1DT2A 1MFGA
chains in the Genus database with same CATH topology
2IJOB 2ZDMA 1Y3XA 5E11A 1TRYA 2LC7A 1HB0B 5C1YA 1C2IA 2NWNA 4LXBH 2HE2A 1UK4A 1AHTH 4D8NA 1NN6A 5K0HA 2VPHA 1O3IA 4JK6A 5F8XA 3GYMA 1A7SA 2FYQA 4H42U 1IQGA 3QK1A 2PTCE 2P59A 1UEQA 1IHTH 2BVSH 4DGJA 2ZA5A 2ZG0H 4ZHAA 1THPB 1V6DA 4CR9A 1NY22 1TP5A 2VIQA 1UEZA 2OCVB 1ACBE 1AVWA 1A61H 4NFEA 2OPGA 4IW4E 1G9IE 4NA8A 2BYGA 1P06A 5GJ4B 1FN6A 1ANEA 4AYYB 1VGCC 1FZZA 1DSUA 3AASA 3U69H 3VFEA 2AERH 1NFWA 4Y79A 3DFJA 3BEFB 5FBEA 1QBNA 3AVZA 1WHAA 1TNHA 2KBSA 1O2ZA 3P95A 4AGKA 5G4BA 2H3LA 1CU1A 3LH1A 1HAHH 5CHAC 1LDTT 4QT8C 2UWPA 4JYTA 3A8DA 2ANKH 4ABFA 4WMFA 3A82A 4I32A 2A45B 1O5BB 1UTKA 5AFZH 3SI4H 3M3TA 3K9XB 4Q7ZA 4ZXYH 3PLKA 3EGGC 4NZLA 2FIRH 2VH0A 2VIWA 4GVCA 2STBE 3GY6A 3TMHA 4FUBA 2HALA 1OPHB 3RU4E 2D8IA 1ZMNA 4JORA 2DM8A 2D8WA 3SJIA 2XWAA 3HKIB 3PMBB 3SNBA 1OSSA 3S9AA 4LOYH 1ABIH 1TPOA 1HIAA 1YF4A 4I8LA 4ZHMU 5T6FA 4AN7A 1H9HE 3MFJA 3EE0B 2HNTC 5E0HA 3SI3H 2SGAA 3HVQC 4K78A 1NT1A 3PWCA 5CMXH 1GMHF 4RSPA 2JSNA 3V13A 4K75A 1Z71A 2GV6A 1MU6B 1L6OA 2ZECA 5FCRA 3MU0A 5IDKA 3ZZ6A 2A7CA 2UUFB 4MQAA 1DVAH 3E0PB 4I8HA 4MNWA 2AIPA 1WBGB 1MTNB 1UM7A 4K76A 2XCFA 1C1PA 1CGHA 5HM2A 1AWHB 2PW8H 3VB6A 2ZU1A 1Y59T 2I6VA 2BDYA 3SV6A 3R69A 1DSTA 2OS6A 3VB4A 1XUIA 1D3DB 1MC7A 2J95A 3PM3A 3M7TA 2PKAB 1B0FA 1QLCA 2GCTB 4OGXA 2AWWA 1QB1A 1CGIE 3CS7A 2ZHQH 1C1OA 2K20A 5DK1A 3GICB 2AGGX 3GSLA 2F9NA 1EJNA 4WXIA 4K6YA 1XUFA 3I77A 2Z7FE 1WI4A 4Q2PA 5FPYA 2FXRA 4X2WA 2ZP0H 3L3TA 2UUKB 1MBQA 1ELTA 3EYDA 3MH5A 4YYXA 5T6GA 3WKMA 4Y7BA 4IMQA 2B0FA 2CJIA 3U8OH 3TJVA 4UFEH 2LC6A 1A5IA 2VVCA 3MU1A 1H9LB 3IITA 4INLA 4R8TB 5HYOA 3DA9B 3PLPA 1P09A 2ZGBH 1W9EA 4DY7B 1OS8A 1YPLH 1DY8A 1HJ9A 3I18A 1C1WH 8KME2 1X5QA 3K6ZA 1HJ8A 4FUIA 4WMEA 5B42A 2BD4A 3EA9A 1DY9A 2VVVA 2I0IA 2JXOA 2RG3A 1FONA 1ZUBA 4OS4A 1T4UH 4O9VA 2O8LA 1AI8H 2C93B 1GBAA 2XBYA 4MTBA 1C5RA 4XFQA 3TGKE 1GPZA 1V2ST 2F0AA 4L8NA 1A5GH 1WU1A 1FLEE 3ID1A 1S0RA 4BANB 3UQVA 1LVOA 2Q6DA 3K6YA 1TABE 1XXDA 1EAXA 1ORFA 1XM1A 2KG2A 1BCUH 2OC0A 3S9CA 5EW1H 3S0NA 2QG1A 1ELFA 2W26A 2DC2A 2OC8A 4AG2A 3SU4A 2C8ZB 2YT8A 1WF8A 1GBIA 4MLFB 4ZXXH 1W13U 1J17T 3RXGA 3ZZ4A 3QGNB