1SOTA

Crystal structure of the degs stress sensor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
312
structure length
283
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 54
structure length 283
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sotA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA02
2XC0A 2QKUA 1A0LA 3UPEA 1BE9A 1X5NA 5EU8A 2ZEBA 1J16A 3QX5H 1OWHA 3TJUA 1SLVB 4OS5A 3SOSA 1EKBB 1V2WT 1YPLH 4TWWA 4GSOA 4WYUA 1K21H 4I33A 4HTCH 3NZIA 2TGDA 1VZQH 2FOFA 3S9BA 1KDQA 1P10A 2W3KA 3SU2A 3PLBA 3AXAA 5EPYA 2A7CA 1L1GA 1GQ5A 1GHAF 4NIXA 2ZHFH 1UJDA 4OS1A 2Y7XA 3MWIU 2OCVB 1H9IE 2WYGA 4NMPA 2FTMA 1DS2E 3PMHB 5EXMA 4ZHLU 1SBWA 1CVWH 3RXQA 5G1DA 1XMNB 1U6QA 1SI5H 1T8MA 3ODDA 2DAZA 4CRGA 1C2LA 1MTUA 1V2PT 3ZV9A 4NMRA 2PKTA 1HAOH 3DHKH 5A0CA 1UJ1A 1P8VC 1T8NA 3MHWU 1N7TA 4MLFB 1SG8B 1U37A 3RXMA 3SI3H 2KJKA 1ELBA 1O3JA 2G52A 1QQ4A 1TX6A 1GJAB 1SGNE 1N6EA 1D3PB 1XUIA 5I46H 3MOCA 3LC5A 1OWDA 1C5TA 4I8HA 2ODQA 2GCTB 4WMEA 1GGDC 1AY6H 4AB9A 2PSXA 1Y3YA 1C5WB 4NA9H 1WAYB 5ETXA 3RXJA 1Z87A 2A7JA 2EAQA 1MQ5A 4MPXA 3BEUA 2NU1E 3SNCA 2B9LA 4LZ1H 4D76A 1AU8A 1RJXB 2BY5X 1MZAA 3LGYA 3GDUA 2OD3B 2LUIA 1O33A 2ZCHP 3OU0A 3P95A 1B8QA 2XWBI 1C5SA 2V3HH 3I29A 1XZ9A 3DT0H 3SI4H 3F9EA 3RXFA 1S6HA 3GJ9A 1D3DB 1F0RA 1YKTA 4K8BA 2KJPA 3T2NA 3RMLH 3AVZA 3T27A 1BZXE 3CC0A 2H2CA 2GCHG 1FY1A 1DUEA 2HPQH 2R3YA 1BUIA 2UWLA 2XYAA 3ODFA 4RKOB 4ABJA 3D23A 4OS7A 3QJNA 1H8IH 2BLQA 1W14U 1ZR0A 1ZHRA 3KCGH 2M3MA 2YT7A 1GWAA 2QYIA 4I32A 5F3XA 2ZCKP 3GY7A 1C2FA 3ZZ7A 2OGPA 1TOCB 4INHA 4ABGA 3NPSA 1O2OA 4GAWA 1FJSA 1GI6A 1O2GH 4ZKNU 1QNJA 4AYVB 4D8NA 5J4QA 1EZUC 3MMGA 4JOHA 1TA2A 2VGCB 3PTBA 1O2KA 3KIDU 1HAVA 3S0NA 1ZMJA 1K1OA 4K1EA 4BAKB 1PPGE 3Q3KA 1G9IE 3TK5A 1P2NA 1O3LA 3BSQA 3M3SA 1RTLA 3M5NA 2OCSA 4UFDH 4MPUA 1ZHPA 1NT1A 3HKIB 1HCGA 2ZU3A 2SGEE 1PJPA 3QDOA 3UOPA 1GJBB 2BDAA 1I16A 3NUMA 2PSYA 2A4OA 1BHXB 3RL8A 2ZPQA 3VB3A 5HFBA 1AZZA 1GVKB 2QXIA 4AFUA 1IQIA 3EGHC 1GHAG 3QK1A 1WG6A 1GMHG 2D90A 1HAXB 2BD5A 2NWNA 2ZQ1A 1LVMA 9ESTA 2K1ZA 1DANH 3UNRA 1GG6C 2VJ1A 2M0VA 1C1VH 2PKAB 8ESTE 4XOJA 1XVMA 2ZHWH 1ESAA 2ZKSA 5EYZA 1W12U 2ULLA 3TLOA 4Y8YA 1RZXA 3G01A 2EGKA 4YYXA 4X8TH 4AG1A 3T29A 2Z9LA 2EDPA 1N6YA 1QJ1B 2QF3A 3ATKA 3UWIA 3NFLA 2PKSC 4E05H 4YDPA 3HPKA 4WF8A 4XE4A 1VGCC 2ODYB 1X7AC 3VB5A 2DLUA 3VB7A 3LGTA 4QT8C 2V1WA 3MNCA 4Y10E 1CGHA 5C1XA 1ANBA 2EI6A 2R2MB 4IN2A 3BTWE 3L3TA 3GCTG 3K9XB 4ABFA 4GVCA 4NG9H 2YNAA 2IN2A 1TNHA 2D26C 3CBYA 4B76A 1QHRB 1UTNA 3GISB 2A2XH 1UJVA 2ZHEH 2MX6A 2O8TA 4NIWA 4D9RA 1MTWA 2PGQB 3Q77A 4U2WA 3OY5U 1Q3OA 2DKRA 1GMCF 3SNAA 4ABIA 1AZ8A 2DUCA 1P9UA 1C2KA 4THNH 1NC6A 2BXTH 2HGTH 1NRPH 2XWAA 3RU4D 4XHVA 2ENOA 4JYTA 5HGGA 1XUFA 3DJAA 3ZVBA 2VU8E 2VIPA 2G8TA 1WTGH 2GDDA 1GCDA 1AVWA 1SLWB 2BM2A 1NO9H 1KXBA 1HAVB 2AIPA 4WMDA 1PPBH 1X5QA 1IOEA 1V2TT 2HWLB 3IWMA 3L4FD 3VPKA 1C2IA 3UOUA 2VSVA 1TWXB 2ZG0H 2Q6DA 2ZU4A 4MNYA 1RS0A 4FUFA 2OTVA 1B0FA 1BRBE 2BOKA 4Y71A 2Y7ZA 4FVBA 1O2PA 1GI1A 3UQOA 3C27B 3SN8A 5A8YA 2GGVB 2PDZA 3TMHA 2GV7A 2ZDNA 1BJVA 3ATMA 3T28A 1CE5A 2FWWA 3SZNA 1QL8A 5DJ7A 2J9NA 2JWEA 1F7ZA 2Q9VA 3SUDA 1WV7H 1ANEA 1OP8A 6GCHF 5H3JA 4ABHA 3QIKA 4Y0YE 3O8RA 2J38A 4CHAB 4D7GA 3RXBA 1O2ZA 1GJCB 3K50A 2Z7FE 1L0ZA 1T4UH 2ZU5A 2AGEX 2BDCA 2UUJB 1DICA 1C5QA 1CA0B 2ZGBH 2BY7X 2PW8H 1YGCH 1ZHMA 1ZJDA 1SMFE 2BZ6H 2D2DA 4I8KA 2Z3DA 2A5KA 3QZQA 5F67A 2K20A 1VCWA 3RXAA 1P06A 3MU4A 5FB8C 2KQFA 1XXDA 3SGQE 1QA0A 4X2WA 2F0AA 2OC8A 4NMTA 2BQ6B 1SGFA 1K1LA 4VGCC 1ETRH 2Q3GA 1V2RT 4BANB 4DGJA 2AWUA 1LHEH 1LQDB 4GCHF 4UDWH 5HF1A 1GJ4H 1E0FD 1WSSH 4JCNA 4ABAA 5L2ZH 1FDPA 1D4PB 2FMJA 4LZ4B 3F1SB 3SFJA 1LVYA 1J8AA 1TGBA 1C5RA 5FBIA 4X2VA 4ISHH 2BLVA 1Y59T 3RXSA 4Q7XA 4BAMB 2GX4A 5F8ZA 3E17A 1GBHA 1P2MA 1ELGA 3HK6B 3SNDA 3GY4A 1K1MA 4AB8A 5ESBA 4F49A 1WJLA 1HAIH 4Q6HA 4IMZA 1QGFA 3RMOH 1FIWA 1T31A 2LOBA 5AF9H 3GCTF 2CMYA 2A4QA 3O8DA 3SU0A 4KFVA 3UNSA 3MO6A 1C4Y2 3CH8A 1V2LT 5EW2H 2V35A 3SUFA 1UTLM 3O46A 2KAIB 1C2MA 4IBLH 2F9PA 1DXPA 1VJAU 2QCYA 4JK6A 1AFEH 1WU1A 4E06H 1OX1A 3R0FA 1LTOA 2GZ8A 1YPEH 2HALA 3MNXA 1PFXC 3LIWA 3T25A 1IAUA 2RG3A 3SUGA 2HVXA 1G3CA 3M7UA 3JZ2B 2QY0B 1O5CB 1ELAA 3EQ0H 4WXIA 4B74A 3TGIE 1J14A 2G55A 3TGKE 1ELFA 5JDUB 4G69A 1XVOA 2F9NA 5HFEA 2KBSA 1KLJH 1BBRE 3I18A 3NWUA 4X8SH 2GKVE 3SHWA 3SO3A 1TRMA 1X5RA 1MFLA 1FUJA 3Q3XA 5JBCS 4FUCA 1O37A 4GVUA 1EJAA 1Z8JB 2Y80A 1P3CA 1CSOE 1TPSA 2AEIH 2ZA5A 1MTNC 3AAUA 1SGRE 4A1VA 1ACBE 1GCTC 2H9HA 1GBJA 1L1JA 1HJ9A 2AIQA 2ALPA 2GD4B 3C1KA 1ID5H 1Q31A 3TPIZ 4JORA 1A4WH 1MKXH 2BX4A 1B0EA 3RXUA 2R9PA 2IWNA 2P95A 3L6PA 1FC7A 4ABBA 4BNRA 1TOMH 4BAQB 2DLSA 1O3GA 3LONA 1RGWA 3JZ1B 1FN6A 1UK3A 4BAHB 1DVAH 7KMEH 3V12A 1YPJH 3KGPA 4DY7B 3CYYA 4YESB 2A4RA 2ZGXH 3TK9A 4NSVA 1UFXA 5FCKA 1Z1JA 4GVDA 1UTQA 2F9UA 1VITF 2VWNA 4FGMA 1O30A 1EASA 1NS3A 3IG6B 3B9FH 2BB4A 1HAGE 2UUFB 4GCHG 1UCYE 5HMAA 1THPB 2QXJA 3ATIA 1QJ7B 1O2UA 1RD3B 3VB4A 2ZPRA 1KLIH 5H4IB 4HGCA 5FPSA 1WI4A 2AH4X 4Q7ZA 2HPPH 1O2QA 4MTBA 1FIZA 1O5GH 3SV9A 1NU7B 1GL1A 2RA3A 2CN0H 1MTVA 1FY5A 2NU2E 3A81A 4UEHH 1P11E 1S5SA 4OGXA 3BTDE 1TNJA 1E34B 2JXOA 1GI9B 1YPKH 1GBBA 3L33A 5EQQA 1ARBA 2YT8A 6CHAB 2GZ7A 2AWXA 3DJ1A 1A0JA 2REYA 4GHTA 2SGQE 3U69H 3PV5A 2YUYA 3QGLA 2ZDLA 4ABEA 5CE1A 5AVDA 2A5AA 1O3OA 3GY6A 2A31A 4KP0A 1GDQA 2HNTC 5HFCA 1I92A 2FCFA 4D9QA 1JXPA 1LO6A 5E22A 1QY6A 3B76A 1KXDA 4O3UA 2OS6A 1QL9A 3MO9A 3ZYDA 1CA8B 1C1TA 1KY9A 1C1OA 3F6UH 4CRAA 1P04A 3I1EA 4DIIH 3BTTE 3E1XB 1MU6B 1EOJA 4FVDA 4X1SU 1ZRKA 1F5LA 3RXGA 1BMLA 1R6JA 1XKBC 4YT7H 1D3QB 3WKMA 1WHDA 4ISOA 3BPUA 1WCZA 2FYRA 3BEIB 4ZXXH 2PZDA 2TRMA 1C9PA 2DE9A 3SU1A 4I8JA 5HETA 1RGRA 1IQNA 3DD2H 3RXVA 2BDBA 1O2RA 1OPHB 2I6VA 1EAUA 2KOJA 4UU6A 1PPEE 4L8NA 1W7GH 2KAIA 1FCFA 1UTPA 4WJG2 1MKWK 4YOIA 3HKJB 1MFGA 2Z17A 3SHAH 1N8OC 3ELAH 1EJNA 2Y5FA 1TFXA 3ZZ3A 1DWCH 1C9TA 1OBYA 1HIAA 4Q2KA 1PPHE 4VGCB 1Z8GA 2TGTA 2BD7A 1H8DH 4NFEA 1ZGVA 1DITH 1CHOF 1G30B 2ZNKH 1UK2A 2P94A 4K2YA 3ZZAA 2Y5HA 2P3WA 2PTCE 4E34A 1UVPA 4IC6A 1O2XA 2KJDA 1DE7H 3STIA 2VIQA 2D92A 5J4SA 2WYJA 1OOKB 2DJTA 2QAAA 4Z0KA 1H9LB 4GHQA 1TNIA 2BD2A 2G5MB 4DVAU 5HXFA 3ZZ9A 4ZHAA 3ATLA 2A32A 3ESTA 1QRXA 3FP6E 1RIWB 1PPZA 3UR9A 3SU6A 2FXRA 1N6XA 3EAJA 2M0UA 1JIRA 1VITH 3M5LA 3SBKA 2ANYA 3BG4B 2WPKS 4ISIH 2ESTE 3A84A 3WY8A 4AOQA 1VJ9U 1BITA 2EC9H 2O2TA 4ZKRU 3FP8E 1HV7A 2I0LA 2ZFFH 3QTVH 1O3PB 1HGTH 2SGFE 1D9IA 3HPTB 1OWJA 1PYTD 1D3TB 1WFGA 3UQVA 1Y5AT 3F9GA 3SV2H 4YZUA 2C4FH 2ZTYA 2M0TA 4NXPA 5DG6A 4DG4A 4R0IA 4KTSA 8LPRA 3A8AA 1OKXA 2OBQA 1O3AA 2JILA 2JH5D 3UR6A 4CRCA 4AX9H 1O3EA 1EB2A 1MKWH 5HJ1A 3E8LA 3RL7A 2F91A 3STJA 1O3IA 2FI5E 3CBZA 2EEHA 1QCPA 3RMNH 1HNEE 2I6SA 3RXLA 4AGKA 1C1WH 2F9VA 1GL0E 3U1IB 1SGTA 2BTCE 3TSVA 1O2IA 3ZZCA 3OTJE 5HEBA 3BTME 1L4ZA 4NXRA 1W0YH 1AKSA 1BBRH 3GYMA 1TNKA 2WL7A 3RMMH 2B0FA 2H5CA 5HDYA 1TYNA 5TCCA 4JK5A 1TRNA 4BTTB 1GBCA 1GJ9B 1UEZA 4NGAH 4LXBH 3BTFE 3M3TA 2FS8A 1FAKH 3EYDA 5GNDA 1MC7A 4K75A 5EPNA 4AN7A 2K1QA 1ZTJA 1FZZA 5BRRE 1NRNH 1V5LA 4XFQA 2G2LA 2VWOA 3BTEE 1C5YB 3BIUH 1D6WA 3GY5A 1FLEE 2DB5A 1BDAA 2ILNA 2LPRA 4I8LA 2BLWA 5F8XA 1DSTA 1GMDF 3PS4A 4X6MA 3DJ3A 2ZF0H 1BMMH 2O8MA 1SGFG 5K7RA 1S85A 1AIXH 3TH2H 4AMHA 1ZPCA 3M5OA 1DXWA 3LOXA 1IQMA 4FUIA 1V3XA 2L97A 1CO7E 4CRFA 1CT0E 5F03A 3RM0H 5C5OA 4HFPB 2LC6A 2PWXA 2ZI2H 4NMOA 2H9TH 3KZEA 1E36B 2FESH 1MCVA 3PLPA 3S69A 2XNIA 1NFUA 4OS2A 2ANMH 1K1IA 3DIWA 3UTUH 1XXFA 1MAXA 1ESTA 3ID2A 1HXFH 2I1NA 2ZIQH 2ZHDA 4K72A 2VZ5A 3A89A 3SU4A 2VVUA 3A7TA 1ZPBA 3GY8A 1TLDA 3A7XA 1KIGH 4KELA 2OC1A 1GHBF 4CH8B 2JINA 1JRTA 2KOMA 2KAWA 1C5OH 4AFSA 2A0QB 1EJMA 1QBVH 1AHTH 2FOGA 1BBRK 3V3MA 1GBEA 2JH0D 1GMHF 2O8LA 1HLTH 3ZVCA 5FX6A 3LGVA 2QIQA 5A0AE 1LVOA 1P12E 5ESTE 4MNXA 1NN6A 5GCHF 5C2ZA 3CBXA 4P0CA 1TP3A 3QTOH 1SHYA 2V6NA 2ZTZA 4A1TA 2ALVA 3D65E 3HVQC 4NWLA 1C5PA 2AERH 2BD3A 4FU8A 4E7RG 3FZZA 1BB0B 4JZFH 2NU4E 1H1BA 3LT3A 1P3EA 1RTFB 4BAOB 2BMGB 4FU9A 3P8FA 1DOJA 1OXGA 1EPTC 1LVBA 3AAVA 2ZGHA 3ENSB 4XBDA 4AFQA 3ZZ5A 2VH6A 2W26A 1XUGA 3O8CA 2GZ9A 4ZXYH 2CSJA 4UU5A 3PMBB 1TPOA 2ZO3H 5G1EA 1PQ8A 4I8GA 3R69A 3GDVA 3F68H 1ZPZA 1J17T 1SVPA 3I4WA 1HJAB 1TE0A 2H9EH 3A85A 4K5ZA 4TPYA 1GI7B 4GHNA 1TP5A 1O2TA 1S6FA 3U8RH 3LGIA 2ZDKA 3A7VA 3TU7H 3RC5A 1XKAC 5EGMA 4YTAA 1A61H 2GDEH 3T26A 5HFDA 2OZFA 2QC2A 1VCPA 5FBEA 1Z8IB 3FP7E 3KEEA 1Y5BT 2RRMA 3SOEA 1V6DA 4DOQA 2VH0A 2CSSA 2BDHA 3BTKE 1OWIA 3LGUA 1PYTC 1O3MA 2ZGCA 3LH3A 2XC5A 4MQAA 1OWKA 1UVUH 5JBBS 3RC6A 1GI5A 1Y3VA 3S7HB 2FI3E 3GY3A 3MYWA 3SU5A 4JZDH 4O9VA 4AYYB 1K1NA 4WXVA 3MNBA 3ZZBA 3VGCB 1KEFA 1ZGIA 2W3IA 4E35A 3P6ZB 3MU1A 3RXTA 5JBTA 1UEQA 2WV4A 1GMDG 1TGNA 1O2MA 3OY6U 1GVLA 5FCRA 1UHBA 5C3NA 2STBE 3KZDA 3R0HA 1WFVA 1C2DA 1T2MA 3BV9B 1P03A 2XTTB 1MCTA 4P2AB 3AW1A 1LCYA 1QRZA 1BCUH 6GCHG 1W13U 3RLYH 3K65B 2XW9A 2SFAA 2TIOA 3SV7A 4Q2QA 3D49H 1O34A 1O35A 4H4FA 2E7KA 1GDNA 3TITA 4MNWA 1KTTB 1FPHH 2RCEA 1YBOA 1FMGA 5HEDA 1AVXA 2BD8A 1MQ6A 1P2QA 3UFAA 1QBNA 2JKHA 4WY3A 3MNSA 1ZZZA 1GI4A 1LHDH 5GCHG 2BY9X 2PKSB 3PO1C 3LC3A 1W9OA 4X8UH 2NU3E 4YOJA 3QE1A 3UIRA 5AFYH 1UO6A 3SJ9A 1BTZA 3HATH 1FV9A 1KXCA 2SGAA 5L6NH 3TSWA 1DLKB 2O8WA 2A4GA 1ABIH 1IQLA 2XXLA 2G81E 2GMTB 4JOFA 1PDRA 3A8CA 5EXNA 1HPGA 2AMPA 1Y7NA 1A5GH 4NIYA 3OYPA 4Q80A 1FI8A 2H2ZA 2G51A 4ABDA 3RP2A 3MFJA 2G5VA 1QJ6B 4ZKOU 3K82A 2BDYA 2CHAB 3PB1E 1BJUA 1O2WA 1BOQA 1O2VA 1AWHB 1SLUB 2XBYA 4BOHA 1SR5C 2PNTA 1N8OB 1IQEA 1A7SA 3RLWH 4NMVA 2F5YA 3BTGE 3RU4E 1SGPE 2TBSA 1OWEA 2R2WU 3TSZA 1ELEE 1YLCA 3ZZ6A 2ZGJA 5E0HA 1O36A 1ZSLA 3MH4A 2J2UA 1C1NA 3SQHE 3H5CB 3LDXH 1EX3A 3GYLB 4PQWA 3H7TA 4NCYA 4ZH8A 1AFQC 1AVGH 4DJZB 1F0UA 1FY4A 4FXGH 3NK8A 5EQSA 1S83A 1AO5A 2FPZA 3A83A 2CV3A 3RLEA 1P57B 5GPIB 4NXQA 4Q3HA 2P16A 2ZFRH 1HB0B 1O5DH 3A82A 1UVOA 4H6TA 3PDVA 2XRCA 3ZVEA 5B6OA 1P2OA 1MAYA 3SQEE 1XX9A 1P09A 2SGDE 5GLJA 5D13A 1BTHH 3PV2A 4CRDA 1KWAA 1PQ5A 3ZYEA 5GXPA 2I0IA 1EP5A 1UVTH 1TQ3A 1CGJE 1L1NA 3LJJA 1C4V2 4BTIB 1UHPA 4ZUHA 1B5GH 2ZU2A 1HAHH 2P3UB 2L4SA 1YCPK 1WYKA 1V2OT 1C1QA 1F2SE 1OSSA 4Q2OA 2BYAX 3A88A 5FHTA 3NFKA 5LPRA 3LH1A 1WUNH 2OXSA 4JOGA 4CHAC 2WUBA 2A1DB 1W9QA 4OS6A 2Z3EA 1Y8TA 1WF8A 4M7GA 1O2YA 3ATWA 1IU0A 1T8LA 2PKAA 1E37B 1NY22 2ASUB 1HAPH 1AFQB 2FO9A 2UUKB 4K69A 1NRSH 1FY3A 1O38A 2ZDMA 2FNEA 2P8OC 1Q3PA 1NRRH 1GQ4A 4CBOA 1ARCA 1UITA 1HAZB 2YTWA 2D8WA 1GI2A 2CF9H 2EEKA 3LPRA 4X1PU 3H7OA 2Z94A 1QAVA 3HGPA 2H6MA 1N99A 1C1RA 5EQRA 1IQGA 3U8OH 2CXVA 1A3BH 1B7XB 2O8UA 1T32A 1ZSKA 5GIBA 2KG2A 3M37A 1BIOA 1LKAA 2VIOA 2C93B 4HI3A 1VA8A 4B73A 1AUJA 2OBOA 1EQ9A 4TPIZ 1LMWB 3Q00A 1J15A 4TY7A 3GDSA 1NESE 3K2UA 1TQ7B 2QF0A 3KQCA 4KGAA 4K78A 1BRUP 3BF6H 1GCTB 1HIAB 1GBLA 4GUXA 1YPGH 1KTSB 4E3BA 3ID1A 2VIVA 1Z6JH 3UY9A 4JZ1A 1V2KT 3GSLA 1O2LA 4MVNA 1GPZA 2B5TB 1RFNA 2FOMB 2QXGA 3BG4C 3K6ZA 4FUDA 3QJMA 1UEWA 1Z86A 5FAHA 1TA6A 1CQQA 1GJ6A 2EHRA 1KLTA 2EEGA 1BTPA 1VR1H 2FLBH 4BTUB 5A09A 2THFB 1ZTKA 1X8SA 2OINA 4J1YA 1SQTA 3SNBA 2CJIA 5HF4A 4H6SB 1F0TA 2FX4A 2OPGA 3PWCA 2IPHA 4IS5A 1RTKA 1O32A 1V2VT 4WH8A 4WVPE 4ISLA 1O5FH 1N7FA 1T7CA 3ZVDA 1O31A 2Z9KA 3QLPH 2BXUH 2W7UA 1RXPA 5T6DA 1MTNB 3QDZB 1W2KH 3SHUA 2WPIS 4KTCA 1AUTC 1HAYB 1ZMLA 4X6PA 1ESBA 5DP8A 5CMXH 2TGPZ 3ZVFA 1LKBA 5A8ZA 2EA3A 1L2EA 2J95A 2DE8A 1ANCA 2JOAA 4JL7A 2WPHS 4R2ZA 2BY8X 4B2CA 2JREA 1GG6B 1N7EA 4X6NA 1FNIA 2PUQH 2X7ZA 1QB6A 2FTLE 9LPRA 2J92A 4MDSA 1MTSA 2BLOA 2VWLA 2ZWLH 4ZROA 5AFZH 1WF7A 4UD9H 5E2OA 1A5HA 3SNEA 1ZTLA 2BDGA 1GJDB 1YPHE 2BHGA 2FP7B 2PV9B 1T4VH 3MU5A 2OC0A 2RCZA 1RIWC 1OYTH 5JB9S 3UNQA 2ZU1A 3U98H 1NROH 4TY6A 1V2NT 1N6FA 1V2UT 3U1JB 3URDA 1GDUA 1ETSH 3MH5A 1TONA 1IQKA 1INCA 1GBFA 4RSPA 2H1UA 3PMJA 5E8EH 5DP6A 5LGOA 1O2NA 2EDVA 3O5NA 1D5GA 5DGJA 1G2MA 1TABE 2IOTA 5DKMA 4I31A 1CGIE 3TJNA 1W8BH 1SSXA 4J2YB 3TVJB 4HOPA 2C90B 1OYQA 1EPTB 3VQFA 1PPCE 1HJAC 1M5ZA 5T6GA 3MTYA 1ELCA 2PKUA 1ZOMA 7GCHG 1GGDB 4Y8XA 2QKTA 4O97A 5E1YA 3DA9B 3OX7U 2W7SA 1NRQH 2F3CE 6ESTA 2Q1JA 3LGWA 1NZQH 2PLXA 1O3HA 2QBWA 4Q6SA 2BVXH 3RXRA 3V0XA 3W94A 1DDJA 3B8JA 4NA8A 2A5IA 3PMAB 5DP5A 1E38B 1T8OA 3SORA 2QT5A 2WPMS 1D6RA 2L4TA 3TK6A 3VFEA 1ELVA 1XM1A 4Y79A 4YM9A 2YOLA 2BY6X 3M36A 4INLA 5A8XA 4CH2B 2JETB 3QGNB 5IYTA 1WI2A 3KF2A 4Y8ZA 2FEQH 1UF1A 1TQ0B 3DFLA 2KRGA 1SB1H 1YPHC 2O9QA 4A92A 3PWBA 2VPHA 1SPJA 1C1UH 1NPMA 3V7TA 4Y7BA 1GBIA 2B7DH 1UEPA 1W7XH 5GDSH 3BTHE 2A2QH 3AASA 1QL7A 1W11U 3V13A 4ASHA 1AKSB 2BX3A 5E6PB 3CS7A 3ZVAA 1FQ3A 1WQVH 1V62A 1G37A 2I6QA 2AGGX 3PV4A 4A1XA 3E3TA 2IWQA 3PYHA 1V1TA 1LHFH 3BN9A 1G9OA 5TCAA 3TJVA 1GJ8B 3GY2A 1RRKA 1AD8H 2GTBA 2QA9E 1GJ5H 1O2JA 2KA9A 2OMJA 1GMCG 2P93A 3NKKA 4B2AA 2OQ5A 1FC6A 1CBWB 3RU4T 2GZVA 4DCDA 1EP6A 4WMFA 2PUXB 4O3TA 5C1UA 4X2YA 1P05A 2P59A 1TMTH 1UM7A 1P2KA 3TH4H 1GBMA 1SC8U 2MHOA 5DPAA 3SJKA 4A7IB 1C2EA 3KHFA 1F5KU 2EJYA 5T6FA 3VXFH 1NU9A 1LHGH 2KL1A 2Y5GA 4Z33A 2EGOA 3A8DA 3MO3A 3P70B 1MUEB 3S9CA 2HLCA 3N7OA 2BD4A 2W4FA 3E90B 2XBWA 1TX7A 1DLEA 2VIWA 5HEYA 2GV6A 2BQWB 2R0KA 1C1PA 1UHBB 1MBMA 2VNTA 4AGJA 2BYGA 4IW4E 3QN7A 4O06A 2XCFA 3ZZ4A 1F0SA 1QQUA 2BZAA 2FDAA 1Z71A 1SGDE 2SNVA 2EGNA 1KDQB 1C5NH 2HOBA 3GICB 3M35A 4Y0ZE 4I7YH 4RI0A 4SGAE 2UUYA 1V2ST 2AS9A 1OP0A 4NFFA 4Q2NA 3T5FH 1HUTH 4UFFH 2TPIZ 1YC0A 1VITG 1WHAA 3SHCH 4GLYA 1LPGB 2Y6TA 4WYTA 5FPYA 1GHBG 2Z3CA 4YLQH 2OQUA 3KNXA 4PROA 2Z9GA 1X6DA 1FY8E 1G36A 1G3DA 2AYWA 1WBGB 5T3HA 4NWKA 2EDZA 3FY5A 2ZCLP 1ANDA 2EEJA 2IWPA 1AE5A 2VB0A 2VVCA 1BTXA 4JZEH 4RKJB 1K1JA 2SNWA 3MH7A 1GBDA 8GCHG 1YM0A 1Z6EA 2XBVA 3VGCC 1H9HE 2FOCA 1WIFA 4K1TA 1C5UA 4YOGA 5K0HA 1MBQA 2P3TB 2FYQA 1NFXA 7GCHF 3RC4A 1ZUBA 5LPFA 1TBZH 1SHHB 4MG3A 3K1RA 1EOLA 4XBCA 2VINA 2ZHQH 4IC5A 4Q7YA 3FVFB 2GT7A 4JYUH 3KHVA 3FANA 4K76A 1S0QA 2ZPSA 2FE5A 1AQ7A 4ISNA 4Y11E 3EA8A 3GCNA 5EW1H 4LK4A 6CHAC 1DUAA 5SGAE 1K2I1 4DURA 3E91A 1EB1H 1GVZA 3TIUA 5C67A 2G5NA 1UM1A 2STAE 1G32B 1RY4A 4ZMAH 1BT7A 2KV8A 1QFKH 3SGBE 1YLDA 1FONA 2IJOB 1TX8A 1SQOA 3F9HA 2QGRA 2V90A 4U32A 2QN5T 2ZP0H 5GWZA 1PQ7A 5G4BA 3BTQE 3MU0A 4NSYA 1GHWH 3ID3A 4AFZA 1MH0A 4E7NA 4O03A 5C5NA 1O2SA 2ZPLA 4Y76A 2HGAA 2WV5A 1MMJN 1THSH 2ZFSA 1GHZA 4CREA 2ZDVH 2R0LA 5F6MA 3WKLA 5L30H 1AN1E 2J94A 1PQAA 3BG8A 1S81A 3GOVB 1M9UA 3A87A 3SU3A 1DWBH 2OSGA 1TBRH 4XBBA 4CBNA 2ZFTA 5HM9A 2SGPE 1HJ8A 3A7YA 1CA0C 1GHVH 3P92A 2PFEA 1GHYH 2FZZA 3SJIA 1C5LH 3ZRTA 3GCHC 4XSKU 1BHXF 3LU9B 1U38A 2FS9A 1DM4B 1JRSA 2B8OH 3NCLA 4FUEA 1LPKB 5FXLA 1CHOG 1S82A 3RUOA 2JIKA 1V2QT 1UVSH 2FODA 2CGAA 4ZKSU 1Q7XA 2XCNA 1BTYA 1TB6H 1TBQH 1K1PA 3R3GB 1LHCH 5GJ4B 4INKA 2KPLA 4B1TA 2Q6FA 1ABJH 1GJ7B 3GGEA 1P9SA 2JETC 1QTFA 2VRFA 1QR3E 4NZLA 4NNMA 1G3BA 1DX5M 3EGGC 3M7QA 2ZZUH 1FXYA 3A7WA 3QO6A 1WQSA 1DT2A 2G00A 2OLGA 1L6OA 4U30A 2ZECA 2A7HA 4X8VH 8KME2 5DTHA 1GM1A 2HNTF 3SV8A 1MZDA 1BA8B 4X2XA 1ZOKA 4UONA 2H5DA 3O8BA 3ZZDA 1JBUH 4K1SA 1ZRBA 2M10A 4ZHMU 1HYLA 2M5TA 4X1RU 2GVFA 1PPFE 8GCHF 1AE8H 3BEFB 4YLUA 1GHXH 1DWDH 3A80A 1O5AB 1C4U2 2UWPA 4IMQA 2R3UA 4X0WU 3M61U 1CBWC 3S9AA 3SV6A 4CR9A 1QIXB 2AMQA 1YPMH 4K8YA 4NZQA 2QXHA 1UK4A 4ESTE 1TPAE 5DP7A 1O3FA 2LNCA 4GPGA 3RXCA 1U39A 2AINA 4DW2U 1CHGA 1K28D 3PTNA 4A6LA 1Y3UA 1EATA 3FZDA 2JH6D 3AW0A 3M3VA 4Y7AA 4JOPA 1W9EA 1SOTA 2I04A 4UFEH 2GMTC 4Y6DA 2OUAA 2KOHA 1VGCB 1TNLA 2EV8A 3VQGA 1X45A 3SW2B 2RA0A 1LQEA 4YT6H 1NM6A 2WUCA 1H4WA 1QB9A 5A2MH 1SGIB 2PR3A 1FN8A 1XUHA 2EI7A 2RDLA 2WPLS 5HYOA 1C1SA 1UCYH 5L2YH 1LPZB 1RGQA 3EE0B 1A46H 2VWMA 1V6BA 2C3SA 1C1MA 4R8TB 3SJ8A 4AZ2B 2EXGA 2BQ7B 1OBZA 5E11A 2J4IA 1OZIA 2QKVA 4H11A 2TGAA 1O2HA 2VGCC 2FOBA 4N6XA 1QA7A 2Q6GA 5DK1A 1C5MD 1P2IA 4KKDA 4X1NU 1F92A 2FN5A 3R68A 1FAXA 3QWCH 3K6YA 4XDEA 2ZFPH 1BQYA 1O5BB 1TGCA 1Y5UT 4FU7A 1O3CA 5FX5A 1DSUA 3W95A 2PGBB 2ZDAH 1TMBH 2VVVA 1UTMA 2HE4A 1JIMA 3EDXB 1KSNA 4LMMA 2Y82A 3PO1B 2ZFQH 4TWYA 5ABWA 2C8XB 3U9AH 5PTPA 1SFIA 2AFQB 3EA9A 3HGNA 1QLCA 1VAEA 4TYDA 1TNGA 1BMNH 4DIHH 2BVRH 3ID4A 3E0NB 3BIVH 3D62A 1W10U 2ANWA 3U8TH 1O3NA 3URCA 1CT2E 4SGBE 3LNYA 4F8KA 2Y81A 4B2BA 3A8BA 1Z7KA 3QGJA 1Y3XA 1P1DA 1BMAA 2ZQ2A 2LC7A 1A5IA 3JXTA 5EOKA 3RXDA 4D7FA 4Z6AH 4A5TS 1O39A 1GBKA 3E0PB 1BFEA 1A2CH 2FX6A 1UJUA 1P01A 4HZHA 1ZSJA 3KL6A 1KXFA 1N1LA 3EA7A 3TNTA 2EEIA 5I25A 1WH1A 4Z8JA 1JWTA 5E21A 1L4DA 1UCYK 1DWEH 1HXEH 3CENA 3LJOA 2PTNA 1W0ZU 5TJXA 1MD8A 3MU8A 1EXFA 1UTJA 3RXEA 1W3CA 3RDZA 1FC9A 1EZSC 1XUKA 3FAOA 4REYA 3OSYA 3S7KB 3HPMA 4EDJA 2VSPA 2R4HA 4U01A 1VB7A 2GP9B 2OP9A 4K6YA 3GCHB 5I7ZA 4AG2A 1P1EA 1NTEA 5CHAB 1HDTH 3OTPA 1TRYA 1SFQB 1O0DH 1Q2WA 1KXEA 5C20A 4YO9A 3DUXH 3MI4A 1BTWA 2P3FH 3I77A 2LA8A 1BTUA 4KFWA 2Z6BD 2Z9IA 2BD9A 2XC4A 2YNBA 1SGCA 5BPEA 4CRBA 2PA1A 5HM2A 1SGQE 1ZJKA 1QAVB 3KN2A 1IHTH 1P2JA 4LOYH 2BDIA 2C8YB 1HBTH 5A2PA 1TPPA 3MH6A 3VXEH 3UREA 1K9OE 4UFGH 1G3EA 2G4TA 3SGAE 3P17H 3NGHA 2ZPMA 2G4UA 3KQBA 5IDKA 3GCOA 4MPVA 1C2HA 3M7TA 3TH3H 2FM2A 1GBAA 2OQSA 1DPOA 2HRVA 3KQEA 3E6PH 1A1RA 3LKWA 1O3KA 3RXHA 1VJ6A 2IWOA 5F8TA 3RXKA 2C8WB 5FPTA 4OEPA 2HNTE 1NFYA 2F83A 4KTUA 4MNVA 2HE2A 2CF8H 3I78A 5B6LA 4NIVA 2Z9JA 1O5EH 1C2JA 2UZCA 1TGTA 1IQHA 5JBAS 2BOHB 1HRTH 3P8OA 1IHSH 5HFFA 5JXBA 2DMZA 2GT8A 3A7ZA 1ORFA 3P8GA 1TMUH 1V2JT 1TALA 3FFGA 2AMDA 3M5MA 1JMOH 4F4OC 1DFPA 1C5ZB 4OGYA 3NXPA 1NF3C 1S84A 3PDZA 5EG4A 3UUZA 2P8OB 2FIRH 3Q76A 1ZMNA 1Q3XA 1QB1A 3ZVGA 1G2LA 2A45B 3SJOA 2D1JA 3Q3YA 3P8NA 3ITIA 3RXIA 3CP7A 1O3DA 2W5EA 5JPMH 3PM3A 2KYLA 4JOEA 2QV1A 2DC2A 3F9FA 4JOKA 1YCPH 2UWOA 4H42U 2ZTXA 2EI8A 1DY8A 1AB9B 5EXLA 4OAJA 4IN1A 1YP9A 1Z8RA 1IQJA 1NFWA 1ZLRA 3TNSA 1EAWA 2FLRH 2W7RA 1DY9A 4K3JA 5DP3A 2VWRA 1P0SH 1AI8H 4NMSA 1IU2A 1SQAA 2V3OH 1KYNA 2H2BA 1AB9C 2QG1A 1SGEE 1WTHD 5AHGH 3VB6A 4FUGA 2FOHA 5LPEA 1QBOA 4B75A 4BXWA 1VCQA 1S0RA 4HOPB 3PLKA 4RN6A 3ZZ8A 4NA7A 1K32A 2GCTC 1YCPM 1V2MT 1CT4E 1C5XB 2BVSH 1NTPA 2FI4E 3SUEA 2PHBA 5C1YA 1SL3A 4ZAEA 1YYY1 4FUHA 4WWYA 4BXSA 3T62A 4OEOA 2YUBA 1J9CH 3TGJE 4JZIA 2OC7A 2WINI 4MPAA 1MD7A 4AORA 1CU1A 2J34A 1GI3A 4UE7H 1N6DA 3QZRA 3SUZA 1BRAA 4DT7B 4CR5A 1GI8B 2F9BH 1AWFH 2V0BA 4X1QU 4K60A 1YBWA 3EGKH 1Z1IA 1SOZA 4IGDA 1OP2A 4JYVH 5E0JA 5A0BA 2ANKH 1QURH 1ELDE 4X6OA 1UTOA 1UTKA 2XBXA 3DORA 1TGSZ 1SLXB 4MPWA 3RXPA 1WOFA 3KQDA 2I4SA 1F5RA 1EZXC 6LPRA 1EPTA 1SGYE 3CS0A 3B23B 3LNXA 1BRCE 5E0GA 5LH8A 1U3BA 7ESTE 1ELTA 1AGJA 2CS5A 1A3EH 2AGIX 4B71A 1XUJA 1K22H 1O3BA 5E2PA 5DP9A 1FPCH 4OS4A 1EZQA 1P02A 4FUBA 2FOAA 2NU0E 2H3MA 2H3LA 7LPRA 1A0HB 3VEQB 1KXAA 1IQFA 4Q2PA 3RM2H 4JMYA 5JYIA 4JOJA 1E35B 2VIDA 1QRWA 2ODPA 2WPJS 1ETTH 3QUMP 4WH6A 5EODA 2GCHF 3E16B 1EAIA 1TAWA 2KPKA 1MU8B 2AWWA 1UMAH 3PROA 2M0ZA 2DM8A 1C5VA 1EUFA 2ZC9H 3DFJA 4NNLA 1QAUA 3RXOA 3TJOA 1HFDA 3HK3B 1V5QA 2C8ZB 5JB8S 1TIOA 3A86A 2CHAC 3IITA 5EZ0A 4NMQA 1THRH 5DO4H 1GI0A 1JOUB 1LDTT 4FUJA 3UWJH 2FOEA 1ZYOA 1IHJA 1GBTA 1YF4A 5DP4A 1AMHA 1C2GA 1EAXA 2F9OA 1OS8A 1Y3WA 3ZV8A 1OBXA 5CHAC 2D8IA 1MKXK
chains in the Genus database with same CATH superfamily
2XC0A 2QKUA 2GEFA 1A0LA 3UPEA 1BE9A 1X5NA 5EU8A 2ZEBA 1J16A 3QX5H 1OWHA 3TJUA 1SLVB 4OS5A 3SOSA 1EKBB 1V2WT 1YPLH 4TT3D 4TWWA 4GSOA 4WYUA 1K21H 4I33A 4HTCH 3NZIA 2TGDA 1VZQH 2FOFA 3S9BA 1KDQA 1P10A 2W3KA 3SU2A 3PLBA 3AXAA 5EPYA 2A7CA 1L1GA 1GQ5A 1GHAF 4NIXA 2ZHFH 1UJDA 4OS1A 2Y7XA 3MWIU 2OCVB 1H9IE 2WYGA 4NMPA 2FTMA 1DS2E 3PMHB 5EXMA 4ZHLU 1SBWA 1CVWH 3RXQA 5G1DA 1XMNB 1U6QA 1SI5H 1T8MA 3ODDA 2DAZA 4CRGA 1C2LA 1MTUA 1V2PT 3ZV9A 4NMRA 2PKTA 1HAOH 3DHKH 5A0CA 1UJ1A 1P8VC 1T8NA 2V3MA 3MHWU 1N7TA 4MLFB 1SG8B 1U37A 3RXMA 3SI3H 2KJKA 1ELBA 1O3JA 2G52A 1QQ4A 1TX6A 1GJAB 1SGNE 1N6EA 1D3PB 1XUIA 5I46H 3MOCA 3LC5A 1OWDA 1C5TA 4I8HA 2ODQA 2GCTB 4WMEA 1GGDC 1AY6H 4AB9A 2PSXA 1Y3YA 1C5WB 4NA9H 1WAYB 5ETXA 3RXJA 1Z87A 2A7JA 2EAQA 1MQ5A 4MPXA 3BEUA 2NU1E 2YMSC 3SNCA 2B9LA 4LZ1H 4D76A 1AU8A 1RJXB 2YMSD 1E1QD 2BY5X 1MZAA 3LGYA 3GDUA 2OD3B 2LUIA 1O33A 2ZCHP 3OU0A 3P95A 1B8QA 2XWBI 1C5SA 2V3HH 3I29A 1XZ9A 3DT0H 3SI4H 3F9EA 3RXFA 1S6HA 3GJ9A 1D3DB 1F0RA 1YKTA 4K8BA 2KJPA 3T2NA 3RMLH 2GJGA 5FL7D 3AVZA 3T27A 1BZXE 3CC0A 2H2CA 2GCHG 5C0UA 1FY1A 1DUEA 2HPQH 2R3YA 1BUIA 2UWLA 2XYAA 3DSOA 3ODFA 4RKOB 4ABJA 3D23A 4OS7A 3QJNA 1H8IH 2BLQA 1W14U 1ZR0A 1ZHRA 3KCGH 2M3MA 2YT7A 1GWAA 2QYIA 4I32A 5F3XA 2ZCKP 3GY7A 1C2FA 3ZZ7A 2OGPA 1TOCB 4INHA 4ABGA 3NPSA 1O2OA 4GAWA 1FJSA 1GI6A 1O2GH 4ZKNU 1QNJA 4AYVB 4D8NA 5J4QA 1EZUC 3MMGA 4JOHA 1TA2A 2VGCB 3PTBA 1O2KA 3F0PA 3KIDU 1HAVA 3S0NA 1ZMJA 3OEED 1K1OA 4K1EA 4BAKB 2EQNA 1PPGE 3Q3KA 1G9IE 3TK5A 1P2NA 1O3LA 3BSQA 3M3SA 1RTLA 3M5NA 2OCSA 4UFDH 4MPUA 1ZHPA 1NT1A 3HKIB 1HCGA 2ZU3A 2SGEE 1PJPA 3QDOA 3UOPA 1GJBB 2BDAA 1I16A 3NUMA 2PSYA 2A4OA 1BHXB 3RL8A 2ZPQA 5KGOA 3VB3A 5HFBA 1AZZA 1GVKB 2QXIA 4AFUA 1IQIA 3EGHC 1GHAG 3QK1A 1WG6A 1GMHG 2D90A 1HAXB 2BD5A 2NWNA 2ZQ1A 1LVMA 9ESTA 2K1ZA 1DANH 3UNRA 1GG6C 2VJ1A 2M0VA 1C1VH 2PKAB 8ESTE 4XOJA 1XVMA 2ZHWH 1ESAA 2ZKSA 5EYZA 1W12U 2ULLA 3TLOA 4Y8YA 1RZXA 3G01A 4XD7D 2EGKA 4YYXA 4X8TH 4AG1A 3T29A 2Z9LA 2EDPA 2WHXA 1N6YA 1QJ1B 2QF3A 3ATKA 3UWIA 4FLNA 3NFLA 2PKSC 4E05H 4YDPA 3HPKA 4WF8A 4XE4A 1VGCC 2ODYB 1X7AC 3VB5A 2DLUA 3VB7A 3LGTA 4QT8C 2V1WA 3MNCA 4Y10E 1CGHA 5C1XA 1ANBA 2EI6A 2R2MB 4IN2A 3BTWE 3L3TA 3GCTG 3K9XB 3WW7A 4ABFA 4GVCA 4NG9H 2YNAA 2IN2A 1TNHA 2D26C 3CBYA 4B76A 1QHRB 1UTNA 3GISB 2A2XH 1UJVA 2ZHEH 2MX6A 2O8TA 4NIWA 4D9RA 1MTWA 2PGQB 3Q77A 4U2WA 3OY5U 1Q3OA 2DKRA 1GMCF 3SNAA 4ABIA 1AZ8A 2DUCA 1P9UA 1C2KA 4THNH 1NC6A 2BXTH 2HGTH 1NRPH 2XWAA 3RU4D 4XHVA 2ENOA 4JYTA 5HGGA 1XUFA 3DJAA 3ZVBA 2KR7A 2VU8E 2VIPA 2G8TA 1WTGH 2GDDA 1GCDA 1AVWA 1SLWB 4Q63A 2BM2A 1NO9H 1KXBA 1HAVB 2AIPA 4WMDA 1PPBH 1X5QA 1IOEA 1V2TT 2HWLB 3IWMA 3L4FD 3VPKA 1C2IA 3UOUA 2VSVA 1TWXB 2ZG0H 2Q6DA 2ZU4A 3NRLA 4MNYA 1RS0A 4FUFA 2OTVA 1B0FA 1BRBE 2BOKA 4Y71A 2Y7ZA 4FVBA 3KDGA 1O2PA 1GI1A 3UQOA 5C0TA 3C27B 3SN8A 5A8YA 2GGVB 2PDZA 3TMHA 2GV7A 2ZDNA 1BJVA 3ATMA 3T28A 1CE5A 2FWWA 3SZNA 1QL8A 5DJ7A 2J9NA 2JWEA 1F7ZA 2Q9VA 3SUDA 1WV7H 4OM9A 1ANEA 1OP8A 6GCHF 5H3JA 3F2HA 3QIKA 4Y0YE 4ABHA 2J38A 4CHAB 4D7GA 3RXBA 1O2ZA 3O8RA 1GJCB 5HIZA 3K50A 2Z7FE 1L0ZA 1T4UH 2ZU5A 2AGEX 2BDCA 2UUJB 1DICA 1C5QA 1CA0B 2ZGBH 2BY7X 2PW8H 1YGCH 1ZHMA 1ZJDA 1SMFE 2BZ6H 2D2DA 4I8KA 2Z3DA 2A5KA 3QZQA 5F67A 2K20A 1VCWA 3RXAA 1P06A 3MU4A 5EJZA 5FB8C 2KQFA 1XXDA 3SGQE 1QA0A 4X2WA 2F0AA 2OC8A 4NMTA 2BQ6B 1SGFA 1K1LA 4VGCC 4JJ3A 1ETRH 2Q3GA 1V2RT 4BANB 4DGJA 2AWUA 1LHEH 1LQDB 4GCHF 2J97A 1YWUA 4UDWH 5HF1A 1GJ4H 1E0FD 1WSSH 2QE7D 4JCNA 4ABAA 5L2ZH 1FDPA 1D4PB 2FMJA 4LZ4B 3F1SB 3SFJA 1LVYA 1J8AA 1TGBA 1C5RA 5FBIA 3KYGA 4X2VA 4ISHH 2BLVA 1Y59T 3RXSA 4Q7XA 4BAMB 2GX4A 5F8ZA 3E17A 1GBHA 1P2MA 1ELGA 3HK6B 3SNDA 3GY4A 1K1MA 4AB8A 5ESBA 4F49A 1WJLA 1HAIH 4Q6HA 4IMZA 1QGFA 3RMOH 1FIWA 1T31A 2LOBA 5AF9H 4P02A 3GCTF 2CMYA 2A4QA 3O8DA 3SU0A 4KFVA 3UNSA 3FN8A 3MO6A 1C4Y2 3CH8A 1V2LT 5EW2H 2V35A 3SUFA 1UTLM 3O46A 2KAIB 1C2MA 4IBLH 2F9PA 1DXPA 1VJAU 2QCYA 4JK6A 1AFEH 1WU1A 4E06H 4Q4LA 1OX1A 3R0FA 1LTOA 2GZ8A 1YPEH 2HALA 3MNXA 1PFXC 3LIWA 3T25A 1IAUA 2RG3A 3SUGA 2HVXA 1G3CA 3M7UA 3JZ2B 2QY0B 1O5CB 1ELAA 3EQ0H 4WXIA 4B74A 3TGIE 1J14A 2G55A 3TGKE 1ELFA 5JDUB 4G69A 1XVOA 2F9NA 5HFEA 2KBSA 1KLJH 1BBRE 3I18A 3NWUA 4X8SH 2GKVE 3SHWA 3SO3A 1TRMA 1X5RA 1MFLA 1FUJA 3Q3XA 5JBCS 4FUCA 5CHBA 1O37A 4GVUA 1EJAA 1Z8JB 2Y80A 1P3CA 1CSOE 1TPSA 2AEIH 2ZA5A 1MTNC 3AAUA 1SGRE 4A1VA 1ACBE 1GCTC 2H9HA 1GBJA 1L1JA 1HJ9A 2AIQA 2ALPA 2GD4B 3C1KA 1ID5H 1Q31A 3TPIZ 4JORA 1A4WH 1MKXH 2BX4A 1B0EA 3RXUA 2R9PA 2IWNA 2P95A 3L6PA 1FC7A 4ABBA 4BNRA 1TOMH 4BAQB 2OK5A 2DLSA 1O3GA 3LONA 1RGWA 3JZ1B 1FN6A 1UK3A 4ACAA 4BAHB 1DVAH 7KMEH 3V12A 1YPJH 3KGPA 2RDEA 4DY7B 3CYYA 4YESB 2A4RA 2ZGXH 3TK9A 4NSVA 1UFXA 5FCKA 1Z1JA 4GVDA 1UTQA 2F9UA 1VITF 2VWNA 4FGMA 1O30A 5C94A 1EASA 1NS3A 3IG6B 3B9FH 3UB0A 2BB4A 1HAGE 2UUFB 4GCHG 1UCYE 5HMAA 1THPB 2QXJA 3ATIA 1QJ7B 1O2UA 1RD3B 3VB4A 2ZPRA 1KLIH 5H4IB 4HGCA 5FPSA 1WI4A 2AH4X 4Q7ZA 2HPPH 1O2QA 5C17A 4MTBA 1FIZA 1O5GH 5DN6D 3SV9A 1NU7B 1GL1A 2RA3A 2CN0H 1MTVA 1FY5A 2NU2E 3A81A 4UEHH 1P11E 1S5SA 4OGXA 3BTDE 1TNJA 1E34B 2JXOA 1GI9B 1YPKH 1H8ED 1GBBA 3L33A 5EQQA 1ARBA 2YT8A 6CHAB 2GZ7A 2AWXA 3DJ1A 1A0JA 2REYA 4GHTA 2SGQE 3U69H 3PV5A 2YUYA 3QGLA 2ZDLA 4ABEA 5CE1A 5AVDA 2A5AA 1O3OA 3GY6A 2A31A 4KP0A 3DSGA 1GDQA 2HNTC 5HFCA 1I92A 2FCFA 4D9QA 1JXPA 1LO6A 5E22A 1QY6A 3B76A 3F3BA 1KXDA 4O3UA 2OS6A 1QL9A 3MO9A 3ZYDA 1CA8B 1C1TA 1KY9A 1C1OA 3F6UH 4CRAA 1P04A 3I1EA 4DIIH 3BTTE 3E1XB 1MU6B 1EOJA 4FVDA 4X1SU 1ZRKA 1F5LA 3RXGA 1BMLA 2K0QA 1R6JA 1XKBC 4YT7H 1COWD 1D3QB 3WKMA 1WHDA 4ISOA 3BPUA 1WCZA 2FYRA 3BEIB 4ZXXH 2PZDA 3VG8A 2TRMA 1C9PA 2DE9A 3SU1A 4I8JA 5HETA 1RGRA 1IQNA 3DD2H 3RXVA 2BDBA 1O2RA 1OPHB 2XNDD 2I6VA 1E79D 1EAUA 2KOJA 4UU6A 1E1RD 1PPEE 4L8NA 1W7GH 2KAIA 1FCFA 1UTPA 4WJG2 1MKWK 4YOIA 3HKJB 1MFGA 2Z17A 3SHAH 1N8OC 3ELAH 1SQRA 1EJNA 2Y5FA 1TFXA 3ZZ3A 1DWCH 1C9TA 1OBYA 1HIAA 4Q2KA 1PPHE 4VGCB 1Z8GA 2TGTA 2BD7A 1H8DH 4NFEA 2YMSB 1ZGVA 1DITH 1CHOF 1G30B 2ZNKH 1UK2A 2P94A 4K2YA 3ZZAA 2Y5HA 2P3WA 2PTCE 4E34A 1UVPA 4IC6A 1O2XA 2KJDA 1DE7H 3STIA 1X9ZA 2VIQA 2D92A 5J4SA 2WYJA 1OOKB 2DJTA 2QAAA 4Z0KA 1H9LB 4GHQA 1TNIA 2BD2A 2G5MB 4DVAU 5HXFA 3ZZ9A 4ZHAA 3ATLA 2A32A 3ESTA 1QRXA 3FP6E 1RIWB 1PPZA 3UR9A 3SU6A 2FXRA 1N6XA 3EAJA 2M0UA 1JIRA 1VITH 3M5LA 3SBKA 2ANYA 3BG4B 2WPKS 4ISIH 2ESTE 3A84A 3WY8A 4AOQA 1VJ9U 1BITA 2EC9H 1QZ8A 2O2TA 4ZKRU 3FP8E 1HV7A 2I0LA 2ZFFH 3QTVH 1O3PB 1HGTH 2SGFE 3OFND 1YLNA 1D9IA 3HPTB 1OWJA 1PYTD 1H8HD 1D3TB 1WFGA 3UQVA 1Y5AT 3F9GA 3SV2H 5KEDA 4YZUA 2C4FH 2ZTYA 2M0TA 4NXPA 5DG6A 4DG4A 4R0IA 4KTSA 8LPRA 3A8AA 1OKXA 2OBQA 1O3AA 2JILA 2JH5D 3UR6A 4CRCA 4AX9H 2HVYB 1O3EA 1EB2A 1MKWH 2J98A 5HJ1A 3E8LA 3RL7A 2F91A 3STJA 1O3IA 2FI5E 3CBZA 2EEHA 1QCPA 3RMNH 1HNEE 2I6SA 3RXLA 4AGKA 1C1WH 2F9VA 1GL0E 3U1IB 1SGTA 2BTCE 3TSVA 1EFRD 1O2IA 3ZZCA 3OTJE 3PRBA 5HEBA 3OAAD 3BTME 1L4ZA 4NXRA 1W0YH 1AKSA 1BBRH 3GYMA 1TNKA 2WL7A 5IL9A 3RMMH 2B0FA 2H5CA 5HDYA 1TYNA 5TCCA 4JK5A 1TRNA 4BTTB 1GBCA 1GJ9B 1UEZA 4NGAH 4LXBH 1K0HA 3BTFE 3M3TA 2FS8A 1FAKH 3EYDA 5GNDA 1MC7A 4K75A 5EPNA 4AN7A 2K1QA 1ZTJA 2LELA 1FZZA 5BRRE 1NRNH 1V5LA 4XFQA 2WPDD 2G2LA 2VWOA 3BTEE 1C5YB 3BIUH 1D6WA 3GY5A 1FLEE 2DB5A 1BDAA 2ILNA 2LPRA 4I8LA 2BLWA 5F8XA 1DSTA 1GMDF 3PS4A 4X6MA 3DJ3A 2ZF0H 1BMMH 2O8MA 1SGFG 5K7RA 1S85A 3KYFA 2IPQX 1AIXH 3TH2H 4AMHA 1ZPCA 3M5OA 1DXWA 3F2FA 3LOXA 1IQMA 4FUIA 1V3XA 2L97A 1CO7E 4CRFA 1CT0E 5F03A 3RM0H 5C5OA 4HFPB 2LC6A 2PWXA 2ZI2H 4NMOA 2H9TH 3FKSD 3KZEA 1E36B 2FESH 1MCVA 3PLPA 3S69A 2XNIA 1NFUA 4OS2A 2ANMH 1K1IA 3DIWA 2K8IA 1XXFA 3UTUH 1MAXA 1ESTA 3ID2A 5HKKD 1HXFH 2I1NA 2ZIQH 2ZHDA 4K72A 2VZ5A 3A89A 3SU4A 2VVUA 3A7TA 1ZPBA 3GY8A 1TLDA 3A7XA 1KIGH 4KELA 2OC1A 1GHBF 4CH8B 2JINA 1JRTA 2KOMA 2KAWA 1C5OH 4AFSA 2A0QB 1EJMA 1QBVH 1AHTH 2FOGA 1BBRK 3N99A 3V3MA 1GBEA 2JH0D 1GMHF 2KCOA 2O8LA 1HLTH 3ZVCA 5FX6A 3LGVA 2QIQA 5A0AE 1LVOA 1P12E 3DCLA 5ESTE 4MNXA 1NN6A 5GCHF 5C2ZA 3CBXA 4P0CA 1TP3A 3QTOH 1SHYA 2V6NA 2ZTZA 4A1TA 2ALVA 3D65E 3HVQC 4NWLA 1C5PA 2AERH 2BD3A 4FU8A 4E7RG 1VKYA 3FZZA 1BB0B 4JZFH 2NU4E 1H1BA 3LT3A 1P3EA 1RTFB 4BAOB 2BMGB 4FU9A 3P8FA 1DOJA 1OXGA 1EPTC 1LVBA 3AAVA 2ZGHA 3ENSB 4XBDA 4AFQA 3ZZ5A 2VH6A 2W26A 1XUGA 3O8CA 2GZ9A 4ZXYH 2CSJA 4UU5A 3PMBB 1TPOA 2ZO3H 5G1EA 1PQ8A 2F43B 4I8GA 3R69A 3GDVA 3F68H 1ZPZA 1J17T 1SVPA 3I4WA 1HJAB 1TE0A 2H9EH 3A85A 4K5ZA 4TPYA 1GI7B 4GHNA 1TP5A 1O2TA 1S6FA 2PP6A 3U8RH 3LGIA 2ZDKA 3A7VA 3TU7H 3RC5A 1XKAC 5EGMA 4YTAA 1A61H 2GDEH 2J98B 3T26A 2WSSD 5HFDA 2OZFA 2QC2A 1VCPA 5FBEA 1Z8IB 3FP7E 3KEEA 2LP6A 1Y5BT 2RRMA 3SOEA 1V6DA 4DOQA 2VH0A 2CSSA 2BDHA 3BTKE 1OWIA 3LGUA 1PYTC 1O3MA 2ZGCA 3LH3A 2XC5A 3OE7D 4MQAA 1OWKA 1UVUH 5JBBS 3RC6A 1GI5A 1Y3VA 3S7HB 2FI3E 3GY3A 3MYWA 3SU5A 4JZDH 4O9VA 4AYYB 1K1NA 4WXVA 3MNBA 3ZZBA 3VGCB 1KEFA 1ZGIA 2W3IA 4E35A 3P6ZB 1YY3A 3MU1A 3RXTA 5JBTA 1UEQA 2WV4A 1GMDG 4B6EA 1TGNA 1O2MA 3OY6U 1GVLA 5FCRA 1UHBA 5C3NA 2STBE 3KZDA 3R0HA 1WFVA 1C2DA 3FOAA 1T2MA 3BV9B 1P03A 2XTTB 1MCTA 4P2AB 3AW1A 1LCYA 1QRZA 1BCUH 6GCHG 1W13U 3RLYH 3K65B 2XW9A 1W0JD 2SFAA 2TIOA 3SV7A 4Q2QA 3D49H 4F55A 1O34A 1O35A 4AC9A 3U28C 4H4FA 2E7KA 1GDNA 3TITA 4MNWA 1KTTB 1FPHH 2RCEA 1YBOA 1FMGA 5HEDA 1AVXA 2BD8A 1MQ6A 1P2QA 3UFAA 4I86A 1QBNA 2JKHA 4WY3A 3MNSA 1ZZZA 4B6FA 1GI4A 1LHDH 5GCHG 2BY9X 2PKSB 3PO1C 3LC3A 1W9OA 4X8UH 2HLDD 2NU3E 2RFKC 4YOJA 3QE1A 3UIRA 4YXWD 5AFYH 1UO6A 3SJ9A 1BTZA 3HATH 1FV9A 1KXCA 2SGAA 5L6NH 3TSWA 1DLKB 2O8WA 2A4GA 1ABIH 1IQLA 2XXLA 2G81E 2GMTB 4JOFA 1PDRA 3A8CA 4FETA 5EXNA 1HPGA 2AMPA 1Y7NA 2KCPA 1A5GH 2WZQA 4NIYA 3OYPA 4Q80A 1FI8A 2H2ZA 2G51A 4ABDA 3RP2A 3MFJA 2G5VA 1QJ6B 4ZKOU 3K82A 2BDYA 2CHAB 3PB1E 1BJUA 1O2WA 1BOQA 1O2VA 1AWHB 1SLUB 2XBYA 4BOHA 1SR5C 2PNTA 1N8OB 5EJ1A 1IQEA 1A7SA 3RLWH 4NMVA 2F5YA 3BTGE 3RU4E 1SGPE 2TBSA 1OWEA 2R2WU 3TSZA 1ELEE 1YLCA 3ZZ6A 2ZGJA 5E0HA 1O36A 1ZSLA 3MH4A 2M2AA 2J2UA 1C1NA 3SQHE 3H5CB 3LDXH 1EX3A 3GYLB 4PQWA 3H7TA 4NCYA 4ZH8A 1AFQC 1AVGH 4DJZB 1F0UA 1FY4A 4FXGH 3NK8A 5EQSA 3W1EA 1S83A 1AO5A 2FPZA 3A83A 5ILBA 2CV3A 3RLEA 1P57B 5GPIB 4NXQA 4Q3HA 2P16A 2ZFRH 1HB0B 1O5DH 3A82A 1UVOA 4H6TA 3PDVA 2XRCA 3ZVEA 5B6OA 1P2OA 1MAYA 3SQEE 1XX9A 1P09A 2SGDE 5GLJA 5D13A 1BTHH 3EE7A 3PV2A 4CRDA 1KWAA 1PQ5A 3ZYEA 5GXPA 2I0IA 1SKYE 1EP5A 1UVTH 1TQ3A 1CGJE 1L1NA 3LJJA 1C4V2 2L6OA 4BTIB 1UHPA 4ZUHA 1B5GH 2ZU2A 1HAHH 2P3UB 2L4SA 1YCPK 1WYKA 1V2OT 1C1QA 1F2SE 1OSSA 2VBCA 4Q2OA 2BYAX 3A88A 5FHTA 3NFKA 5LPRA 3LH1A 1WUNH 2OXSA 4JOGA 4CHAC 2WUBA 2A1DB 5HIYA 1W9QA 4OS6A 2Z3EA 1Y8TA 1WF8A 4M7GA 2WV9A 1O2YA 3ATWA 1IU0A 1T8LA 2PKAA 1E37B 1NY22 2ASUB 1HAPH 1AFQB 2FO9A 2UUKB 4K69A 2JSNA 1NRSH 1FY3A 3GS9A 1O38A 2ZDMA 2FNEA 2P8OC 1Q3PA 1NRRH 1GQ4A 2IJD1 4CBOA 1ARCA 1UITA 1HAZB 2YTWA 2D8WA 1GI2A 2CF9H 2EEKA 3LPRA 4X1PU 3H7OA 2Z94A 1QAVA 3HGPA 2H6MA 1N99A 1C1RA 3KQ5A 5EQRA 1IQGA 3U8OH 2CXVA 1A3BH 1B7XB 2O8UA 1T32A 1ZSKA 5GIBA 2KG2A 3M37A 1BIOA 1LKAA 2VIOA 2C93B 4HI3A 1VA8A 4B73A 1AUJA 2OBOA 1EQ9A 4TPIZ 1LMWB 3Q00A 1J15A 4TY7A 3GDSA 1NESE 3K2UA 1TQ7B 2QF0A 3KQCA 4KGAA 4K78A 1BRUP 3BF6H 1GCTB 1HIAB 1GBLA 4GUXA 1YPGH 1KTSB 4E3BA 3ID1A 2VIVA 1Z6JH 3UY9A 4JZ1A 1V2KT 3GSLA 1O2LA 4MVNA 1GPZA 2B5TB 1MABB 1RFNA 2FOMB 2QXGA 3BG4C 3K6ZA 4FUDA 3QJMA 1UEWA 1Z86A 5FAHA 1TA6A 1CQQA 1GJ6A 2EHRA 1KLTA 1VR1H 2EEGA 1BTPA 2FLBH 4BTUB 5A09A 2THFB 2QF5A 1ZTKA 1X8SA 2KM0A 2OINA 4J1YA 1SQTA 3SNBA 2CJIA 5HF4A 4H6SB 1F0TA 2FX4A 5EIYA 2OPGA 3PWCA 2IPHA 4IS5A 1RTKA 1O32A 1V2VT 4WH8A 4WVPE 4ISLA 1O5FH 1N7FA 1T7CA 3ZVDA 1O31A 2Z9KA 3QLPH 2BXUH 2W7UA 1RXPA 5T6DA 1MTNB 3QDZB 1W2KH 3SHUA 2WPIS 4KTCA 1AUTC 1HAYB 1ZMLA 4X6PA 1ESBA 5DP8A 5CMXH 2TGPZ 3ZVFA 1LKBA 5A8ZA 2EA3A 1L2EA 2J95A 2DE8A 1ANCA 2JOAA 4JL7A 2WPHS 4R2ZA 2BY8X 4B2CA 2JREA 1GG6B 1N7EA 4X6NA 1FNIA 2PUQH 2X7ZA 1QB6A 2FTLE 9LPRA 2J92A 3PRDA 4MDSA 1MTSA 2BLOA 5EJLA 2VWLA 2ZWLH 4ZROA 5AFZH 1WF7A 4UD9H 5E2OA 1A5HA 3SNEA 1UW7A 1ZTLA 2BDGA 1GJDB 1YPHE 2BHGA 2FP7B 2PV9B 1T4VH 3MU5A 2OC0A 2RCZA 1RIWC 1OYTH 5JB9S 1WXRA 3UNQA 2ZU1A 3U98H 5CDFE 5B42A 1NROH 4TY6A 1V2NT 1N6FA 1V2UT 3U1JB 3URDA 1GDUA 1ETSH 3MH5A 1TONA 1IQKA 1INCA 1GBFA 4RSPA 2H1UA 3PMJA 5E8EH 5DP6A 5LGOA 1O2NA 2EDVA 3O5NA 1D5GA 5DGJA 1G2MA 1TABE 2IOTA 5DKMA 4I31A 1CGIE 3TJNA 1W8BH 1SSXA 4J2YB 3TVJB 4HOPA 2C90B 1OYQA 1EPTB 3VQFA 1PPCE 1HJAC 1M5ZA 5T6GA 3MTYA 1ELCA 2PKUA 1ZOMA 7GCHG 1GGDB 4Y8XA 2QKTA 4FOUC 4O97A 5E1YA 3DA9B 3OX7U 2W7SA 1NRQH 2F3CE 6ESTA 2Q1JA 3LGWA 1NZQH 2PLXA 1O3HA 2QBWA 4Q6SA 2BVXH 3RXRA 3V0XA 3W94A 1DDJA 3B8JA 4NA8A 2A5IA 3PMAB 5DP5A 1E38B 1T8OA 3SORA 3UAIC 2QT5A 2WPMS 1D6RA 2L4TA 3TK6A 3VFEA 1ELVA 4XRNA 1XM1A 4Y79A 4YM9A 2YOLA 2BY6X 3M36A 4INLA 5A8XA 4CH2B 2JETB 3QGNB 5IYTA 1WI2A 3KF2A 4Y8ZA 2FEQH 1UF1A 1TQ0B 3DFLA 2KRGA 1SB1H 1YPHC 2O9QA 4A92A 3PWBA 2VPHA 1SPJA 1C1UH 1NPMA 3V7TA 4Y7BA 1GBIA 2B7DH 1UEPA 1W7XH 5GDSH 3BTHE 2A2QH 3AASA 1QL7A 1W11U 3V13A 4ASHA 1AKSB 2BX3A 5E6PB 3CS7A 3ZVAA 1FQ3A 1WQVH 1V62A 1G37A 4HG6A 2I6QA 2XOKD 2AGGX 3PV4A 4A1XA 2QF4A 3E3TA 2IWQA 3PYHA 1V1TA 1LHFH 3BN9A 1G9OA 5TCAA 3TJVA 1GJ8B 3GY2A 1RRKA 1AD8H 2GTBA 2QA9E 1GJ5H 1O2JA 2KA9A 2OMJA 1GMCG 2P93A 3NKKA 4B2AA 2OQ5A 1FC6A 1CBWB 3RU4T 2GZVA 4DCDA 1EP6A 4WMFA 2PUXB 4O3TA 5C1UA 4X2YA 1P05A 2P59A 1TMTH 1UM7A 1P2KA 3TH4H 1GBMA 1SC8U 2MHOA 3SYJA 4RT1A 5DPAA 3SJKA 3F2GA 4A7IB 1C2EA 3KHFA 1KMHB 1F5KU 2EJYA 5T6FA 3VXFH 1NU9A 1LHGH 2KL1A 2Y5GA 4Z33A 2EGOA 3A8DA 3MO3A 3P70B 1MUEB 3S9CA 2HLCA 3N7OA 2BD4A 2W4FA 3E90B 2XBWA 1TX7A 1DLEA 2VIWA 5HEYA 2GV6A 2BQWB 2R0KA 1C1PA 1UHBB 1MBMA 2VNTA 4AGJA 2BYGA 4IW4E 3QN7A 4O06A 2XCFA 3ZZ4A 1F0SA 1QQUA 2BZAA 2FDAA 1Z71A 1SGDE 2SNVA 2EGNA 1KDQB 1C5NH 2HOBA 3GICB 3M35A 4Y0ZE 4I7YH 4RI0A 4SGAE 2W6ID 2UUYA 1V2ST 2AS9A 1OP0A 4NFFA 4Q2NA 3T5FH 1HUTH 4UFFH 2TPIZ 1YC0A 1VITG 1WHAA 3SHCH 4GLYA 1LPGB 2Y6TA 4WYTA 5FPYA 1GHBG 2Z3CA 5KECA 4YLQH 2OQUA 3KNXA 4PROA 2KCAA 2Z9GA 1X6DA 1FY8E 1G36A 5DSFA 1G3DA 2AYWA 1WBGB 5T3HA 4NWKA 2EDZA 3FY5A 2ZCLP 1ANDA 2EEJA 2IWPA 1AE5A 2VB0A 2VVCA 4F48B 1BTXA 4JZEH 4RKJB 1K1JA 2SNWA 3MH7A 1GBDA 8GCHG 1YM0A 1Z6EA 2XBVA 3VGCC 1H9HE 2FOCA 1WIFA 4K1TA 1C5UA 4YOGA 5K0HA 1MBQA 2P3TB 2FYQA 1NFXA 7GCHF 3RC4A 1ZUBA 5LPFA 1TBZH 1NBME 1SHHB 4MG3A 3K1RA 1EOLA 4XBCA 2VINA 2ZHQH 4IC5A 4Q7YA 3FVFB 2GT7A 4JYUH 3KHVA 3FANA 4K76A 1S0QA 2ZPSA 2FE5A 1AQ7A 4ISNA 4Y11E 3EA8A 3GCNA 5EW1H 4LK4A 6CHAC 1DUAA 5SGAE 1K2I1 4DURA 3E91A 1EB1H 1GVZA 3TIUA 5C67A 2G5NA 1UM1A 2JIZD 2STAE 1G32B 1RY4A 2JJ1D 4ZMAH 3KDKA 2KV8A 1BT7A 1QFKH 3SGBE 1YLDA 1FONA 2IJOB 1TX8A 1SQOA 3F9HA 2QGRA 2V90A 4U32A 2QN5T 2ZP0H 5GWZA 1PQ7A 5G4BA 3BTQE 3MU0A 4NSYA 1GHWH 3ID3A 4AFZA 1MH0A 4E7NA 4O03A 5C5NA 1O2SA 2ZPLA 4Y76A 2HGAA 2WV5A 1BMFD 1MMJN 2V7QD 1THSH 2ZFSA 1GHZA 4CREA 2ZDVH 2R0LA 5F6MA 3WKLA 5L30H 1AN1E 2J94A 1PQAA 3BG8A 1S81A 3GOVB 1M9UA 3A87A 3SU3A 1DWBH 2OSGA 3DSPA 1TBRH 4XBBA 4CBNA 2ZFTA 5HM9A 2SGPE 1HJ8A 3A7YA 1CA0C 1GHVH 3P92A 2PFEA 1GHYH 2FZZA 3SJIA 1C5LH 3ZRTA 3GCHC 4XSKU 1BHXF 3LU9B 1U38A 2FS9A 1DM4B 4ZCNA 1JRSA 2B8OH 3NCLA 4FUEA 1LPKB 5FXLA 1CHOG 1S82A 3RUOA 2JIKA 1V2QT 1UVSH 2FODA 2CGAA 4ZKSU 1Q7XA 2XCNA 1BTYA 1TB6H 1TBQH 4ASUD 1K1PA 3R3GB 1LHCH 5GJ4B 4INKA 2KPLA 3SZEA 4B1TA 2Q6FA 1ABJH 1GJ7B 5T1VA 3GGEA 1P9SA 2JETC 1QTFA 2VRFA 1QR3E 4NZLA 4NNMA 2W6JD 1G3BA 1DX5M 3EGGC 3M7QA 2ZZUH 1FXYA 3A7WA 3QO6A 1WQSA 1DT2A 2G00A 2OLGA 1L6OA 4U30A 3WWBA 2ZECA 2A7HA 4X8VH 8KME2 5DTHA 1GM1A 2HNTF 3SV8A 1MZDA 1BA8B 4X2XA 1ZOKA 4M9FA 4UONA 2H5DA 3O8BA 3ZZDA 1JBUH 4K1SA 1ZRBA 2M10A 4ZHMU 1HYLA 2M5TA 4X1RU 2GVFA 1PPFE 8GCHF 1AE8H 3BEFB 4YLUA 1GHXH 1DWDH 3A80A 1O5AB 1C4U2 2UWPA 4IMQA 2R3UA 4X0WU 3ZIAD 3M61U 1CBWC 3S9AA 3SV6A 4CR9A 1QIXB 2AMQA 1YPMH 4K8YA 4NZQA 2QXHA 1UK4A 4ESTE 1TPAE 5DP7A 1O3FA 1FX0B 2LNCA 4GPGA 3RXCA 1U39A 2AINA 4DW2U 1CHGA 1K28D 3PTNA 4A6LA 1Y3UA 1EATA 3FZDA 2JH6D 3AW0A 3M3VA 4Y7AA 1W0KD 4JOPA 1W9EA 1SOTA 2I04A 4UFEH 2GMTC 4Y6DA 2OUAA 3WWFA 2KOHA 1VGCB 1TNLA 2EV8A 3VQGA 1X45A 3SW2B 2RA0A 1LQEA 4YT6H 1NM6A 2WUCA 1H4WA 1QB9A 5A2MH 1SGIB 2PR3A 1FN8A 1XUHA 2EI7A 2L74A 2RDLA 2WPLS 5HYOA 1C1SA 1UCYH 5L2YH 1LPZB 1RGQA 3EE0B 1A46H 2VWMA 1V6BA 2C3SA 1C1MA 4R8TB 3SJ8A 4AZ2B 2EXGA 2BQ7B 1OBZA 5E11A 2J4IA 1OZIA 2QKVA 4H11A 2TGAA 1O2HA 2VGCC 2FOBA 4N6XA 1QA7A 2Q6GA 5DK1A 1C5MD 1P2IA 4KKDA 4X1NU 1F92A 2FN5A 3R68A 1FAXA 3N7EA 3QWCH 3K6YA 4XDEA 2ZFPH 1BQYA 1O5BB 1TGCA 1Y5UT 4FU7A 1O3CA 1S6LA 5FX5A 1DSUA 3W95A 2PGBB 2ZDAH 1TMBH 2VVVA 1UTMA 2HE4A 1JIMA 3GABA 3EDXB 1KSNA 4LMMA 2Y82A 3CNRA 3PO1B 2ZFQH 4TWYA 5ABWA 2C8XB 3U9AH 5PTPA 1SFIA 2AFQB 3EA9A 3HGNA 1QLCA 1VAEA 4TYDA 1TNGA 1BMNH 4DIHH 2BVRH 3ID4A 3E0NB 3BIVH 3D62A 1W10U 2ANWA 3U8TH 1O3NA 2KX4A 3URCA 1CT2E 4SGBE 3LNYA 4F8KA 2Y81A 4B2BA 3A8BA 4P00A 1Z7KA 3QGJA 1Y3XA 1P1DA 1OHHD 1BMAA 2ZQ2A 2LC7A 1A5IA 3JXTA 5EOKA 3RXDA 4D7FA 4Z6AH 4A5TS 1O39A 1GBKA 3E0PB 1BFEA 1A2CH 2FX6A 1UJUA 1P01A 5F53A 4HZHA 1ZSJA 3KL6A 1KXFA 1N1LA 3EA7A 3TNTA 2EEIA 5I25A 1WH1A 4Z8JA 1JWTA 5E21A 1L4DA 1UCYK 1DWEH 1HXEH 3CENA 3LJOA 2PTNA 1W0ZU 5TJXA 1MD8A 3MU8A 3AK5A 1EXFA 1UTJA 3RXEA 1W3CA 3RDZA 1FC9A 1EZSC 1XUKA 3FAOA 4REYA 3OSYA 3S7KB 3HPMA 4EDJA 2VSPA 2R4HA 4U01A 1VB7A 2GP9B 2OP9A 4K6YA 3GCHB 5I7ZA 4AG2A 1P1EA 1NTEA 3NCVA 5CHAB 1HDTH 3OTPA 1TRYA 1SFQB 1O0DH 1Q2WA 1KXEA 5C20A 4YO9A 3DUXH 3MI4A 1BTWA 2P3FH 3I77A 2LA8A 1BTUA 4KFWA 4ACBA 2Z6BD 2Z9IA 2BD9A 2XC4A 2YNBA 1SGCA 5BPEA 4CRBA 2PA1A 2KCYA 1SGQE 1ZJKA 5HM2A 1QAVB 3KN2A 1IHTH 2F4LA 1P2JA 4LOYH 2BDIA 2C8YB 1HBTH 5A2PA 1TPPA 3MH6A 3VXEH 3UREA 1K9OE 4UFGH 1G3EA 2G4TA 3SGAE 3P17H 3NGHA 2ZPMA 2G4UA 3KQBA 5IDKA 2EY4C 3GCOA 4MPVA 1C2HA 3M7TA 3TH3H 2FM2A 1GBAA 2OQSA 1DPOA 2KFWA 2HRVA 3KQEA 3E6PH 1A1RA 3LKWA 1O3KA 3RXHA 1VJ6A 2IWOA 5F8TA 3RXKA 2C8WB 5FPTA 4OEPA 2HNTE 1NFYA 2F83A 4KTUA 4MNVA 2HE2A 2CF8H 3I78A 5B6LA 1NBMD 4NIVA 2Z9JA 1O5EH 1C2JA 2UZCA 1TGTA 1IQHA 5JBAS 2BOHB 2JJ2D 1HRTH 3P8OA 1IHSH 5HFFA 5JXBA 2DMZA 2CK3D 2GT8A 3A7ZA 1ORFA 3P8GA 1TMUH 1V2JT 1TALA 3FFGA 2AMDA 3M5MA 1JMOH 4TSFD 4F4OC 1DFPA 1C5ZB 4OGYA 3NXPA 1NF3C 1S84A 3PDZA 5EG4A 3UUZA 2P8OB 2FIRH 3Q76A 1ZMNA 1Q3XA 1QB1A 3ZVGA 1G2LA 2A45B 3SJOA 2D1JA 3Q3YA 3P8NA 3FO8D 3ITIA 3RXIA 3CP7A 1O3DA 2W5EA 5JPMH 3PM3A 2KYLA 4JOEA 2QV1A 2DC2A 3F9FA 4JOKA 1YCPH 2UWOA 4H42U 2ZTXA 2EI8A 1DY8A 1AB9B 5EXLA 4OAJA 4IN1A 1YP9A 1Z8RA 1IQJA 1NFWA 1ZLRA 3TNSA 4DT4A 1EAWA 2FLRH 2W7RA 1DY9A 4K3JA 5DP3A 2VWRA 2J5UA 1P0SH 1AI8H 4NMSA 1IU2A 1SQAA 2V3OH 1KYNA 2H2BA 1AB9C 2QG1A 1SGEE 1WTHD 5AHGH 3VB6A 5IK2D 4FUGA 2FOHA 4Z1MD 5LPEA 1QBOA 4B75A 4BXWA 1VCQA 1S0RA 4HOPB 3PLKA 4RN6A 3ZZ8A 4NA7A 1K32A 2GCTC 1YCPM 1V2MT 1CT4E 1C5XB 2BVSH 1NTPA 2FI4E 3SUEA 2PHBA 5C1YA 1SL3A 4ZAEA 1YYY1 4FUHA 4WWYA 4BXSA 3T62A 4OEOA 2YUBA 1J9CH 3TGJE 4JZIA 2OC7A 2WINI 4MPAA 1MD7A 4AORA 1CU1A 2J34A 1GI3A 4UE7H 1N6DA 4JJ0A 3SUZA 3QZRA 1BRAA 3N7DA 4DT7B 4CR5A 1GI8B 2F9BH 1AWFH 2V0BA 4X1QU 4K60A 1YBWA 3EGKH 1Z1IA 1SOZA 4IGDA 1OP2A 4JYVH 5E0JA 5A0BA 3MQKC 1WDIA 2ANKH 1QURH 1ELDE 4X6OA 1UTOA 1UTKA 2XBXA 3DORA 1TGSZ 1SLXB 3OEHD 2KZ4A 4MPWA 3RXPA 1WOFA 3KQDA 2I4SA 1F5RA 1EZXC 2JDID 6LPRA 1EPTA 1SGYE 3CS0A 3B23B 3LNXA 1BRCE 5E0GA 5LH8A 1U3BA 7ESTE 1ELTA 1AGJA 2CS5A 1A3EH 2AGIX 4B71A 3H09A 1XUJA 1K22H 1O3BA 5E2PA 5DP9A 1FPCH 4OS4A 1EZQA 1P02A 4FUBA 2FOAA 2NU0E 2H3MA 2H3LA 7LPRA 1A0HB 4RT0A 3VEQB 1KXAA 1IQFA 4Q2PA 3RM2H 4JMYA 5JYIA 4JOJA 1E35B 2VIDA 1QRWA 2ODPA 2WPJS 1ETTH 3QUMP 4WH6A 5EODA 2GCHF 3E16B 1EAIA 1TAWA 2KPKA 1MU8B 2AWWA 1UMAH 3PROA 2M0ZA 2DM8A 1C5VA 1EUFA 3F0OA 2ZC9H 3DFJA 4NNLA 1QAUA 3RXOA 3TJOA 1HFDA 3HK3B 1V5QA 2C8ZB 5JB8S 1TIOA 3A86A 2CHAC 3IITA 5EZ0A 4NMQA 1THRH 5DO4H 1GI0A 1JOUB 1LDTT 2AHME 4FUJA 2FOEA 3UWJH 1ZYOA 1IHJA 1GBTA 1YF4A 5DP4A 1AMHA 1C2GA 1EAXA 2F9OA 1OS8A 1Y3WA 3ZV8A 1OBXA 5CHAC 2D8IA 1MKXK
chains in the Genus database with same CATH topology
2XC0A 2QKUA 2GEFA 1A0LA 3UPEA 1BE9A 1X5NA 5EU8A 2ZEBA 1J16A 3QX5H 1OWHA 3TJUA 1SLVB 4OS5A 3SOSA 1EKBB 1V2WT 1YPLH 4TWWA 4GSOA 4WYUA 1K21H 4I33A 4HTCH 3NZIA 2TGDA 1VZQH 2FOFA 3S9BA 1KDQA 1P10A 2W3KA 3SU2A 3PLBA 3AXAA 5EPYA 2A7CA 1L1GA 1GQ5A 1GHAF 4NIXA 2ZHFH 1UJDA 4OS1A 2Y7XA 3MWIU 2OCVB 1H9IE 2WYGA 4NMPA 2FTMA 1DS2E 3PMHB 5EXMA 4ZHLU 1SBWA 1CVWH 3RXQA 5G1DA 1XMNB 1U6QA 1SI5H 1T8MA 3ODDA 2DAZA 4CRGA 1C2LA 1MTUA 1V2PT 3ZV9A 4NMRA 2PKTA 1HAOH 3DHKH 5A0CA 1UJ1A 1P8VC 1T8NA 3MHWU 1N7TA 4MLFB 1SG8B 1U37A 3RXMA 3SI3H 2KJKA 1ELBA 1O3JA 2G52A 1QQ4A 1TX6A 1GJAB 1SGNE 1N6EA 1D3PB 1XUIA 5I46H 3MOCA 3LC5A 1OWDA 1C5TA 4I8HA 2ODQA 2GCTB 4WMEA 1GGDC 1AY6H 4AB9A 2PSXA 1Y3YA 1C5WB 4NA9H 1WAYB 5ETXA 3RXJA 1Z87A 2A7JA 2EAQA 1MQ5A 4MPXA 3BEUA 2NU1E 3SNCA 2B9LA 4LZ1H 4D76A 1AU8A 1RJXB 2BY5X 1MZAA 3LGYA 3GDUA 2OD3B 2LUIA 1O33A 2ZCHP 3OU0A 3P95A 1B8QA 2XWBI 1C5SA 2V3HH 3I29A 1XZ9A 3DT0H 3SI4H 3F9EA 3RXFA 1S6HA 3GJ9A 1D3DB 1F0RA 1YKTA 4K8BA 2KJPA 3T2NA 3RMLH 3AVZA 3T27A 1BZXE 3CC0A 2H2CA 2GCHG 1FY1A 1DUEA 2HPQH 2R3YA 1BUIA 2UWLA 2XYAA 3ODFA 4RKOB 4ABJA 3D23A 4OS7A 3QJNA 1H8IH 2BLQA 1W14U 1ZR0A 1ZHRA 3KCGH 2M3MA 2YT7A 1GWAA 2QYIA 4I32A 5F3XA 2ZCKP 3GY7A 1C2FA 3ZZ7A 2OGPA 1TOCB 4INHA 4ABGA 3NPSA 1O2OA 4GAWA 1FJSA 1GI6A 1O2GH 4ZKNU 1QNJA 4AYVB 4D8NA 5J4QA 1EZUC 3MMGA 4JOHA 1TA2A 2VGCB 3PTBA 1O2KA 3KIDU 1HAVA 3S0NA 1ZMJA 1K1OA 4K1EA 4BAKB 1PPGE 3Q3KA 1G9IE 3TK5A 1P2NA 1O3LA 3BSQA 3M3SA 1RTLA 3M5NA 2OCSA 4UFDH 4MPUA 1ZHPA 1NT1A 3HKIB 1HCGA 2ZU3A 2SGEE 1PJPA 3QDOA 3UOPA 1GJBB 2BDAA 1I16A 3NUMA 2PSYA 2A4OA 1BHXB 3RL8A 2ZPQA 3VB3A 5HFBA 1AZZA 1GVKB 2QXIA 4AFUA 1IQIA 3EGHC 1GHAG 3QK1A 1WG6A 1GMHG 2D90A 1HAXB 2BD5A 2NWNA 2ZQ1A 1LVMA 9ESTA 2K1ZA 1DANH 3UNRA 1GG6C 2VJ1A 2M0VA 1C1VH 2PKAB 8ESTE 4XOJA 1XVMA 2ZHWH 1ESAA 2ZKSA 5EYZA 1W12U 2ULLA 3TLOA 4Y8YA 1RZXA 3G01A 2EGKA 4YYXA 4X8TH 4AG1A 3T29A 2Z9LA 2EDPA 1N6YA 1QJ1B 2QF3A 3ATKA 3UWIA 4FLNA 3NFLA 2PKSC 4E05H 4YDPA 3HPKA 4WF8A 4XE4A 1VGCC 2ODYB 1X7AC 3VB5A 2DLUA 3VB7A 3LGTA 4QT8C 2V1WA 3MNCA 4Y10E 1CGHA 5C1XA 1ANBA 2EI6A 2R2MB 4IN2A 3BTWE 3L3TA 3GCTG 3K9XB 4ABFA