1SOTA

Crystal structure of the degs stress sensor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
312
structure length
283
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 54
structure length 283
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sotA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA02
4ABHA 2AGGX 1WQSA 5FXLA 1OWHA 2AH4X 2E7KA 1T7CA 2WPIS 1TPOA 4E06H 1IQNA 5HGGA 5EQRA 4X2YA 3UWIA 3P92A 4REYA 1VCPA 4ZKNU 2KAWA 2P8OC 3SNCA 4ISHH 4DCDA 2BY7X 3GY8A 1H1BA 1YYY1 3QGLA 2LPRA 2FI3E 2FOGA 4X2XA 2HE2A 2H3MA 2OLGA 4K78A 5A0CA 5I46H 1OWDA 2JIKA 5GDSH 2BD2A 2R9PA 1O3HA 5F6MA 3MOCA 2BLWA 3Q77A 1GJCB 1P9UA 3OTJE 1INCA 1CQQA 3M35A 3JXTA 5EG4A 2EDVA 1GJ8B 2XC4A 5G1EA 4IN1A 1SHYA 4UFFH 4CRDA 2EEHA 2ZC9H 4DJZB 4AG1A 1LDTT 1PPCE 4NMRA 4KELA 1C1VH 2XBYA 3QTOH 4XDEA 1QLCA 1V2ST 5CHAB 3K9XB 9LPRA 3PDZA 1P2NA 2PKSB 1NO9H 1EJMA 1AY6H 3F9HA 3KCGH 2H3LA 4E34A 1OWEA 3RC5A 1MZAA 2VSPA 4NFFA 1C2GA 1GMCF 4CR9A 1M5ZA 1TQ7B 1YC0A 1L1JA 2M10A 4KFVA 3EYDA 1L2EA 3M5NA 2XWAA 2QCYA 1WI4A 1TPAE 4YT6H 3SGAE 4O9VA 3SU1A 3QWCH 1THRH 1NU9A 1VAEA 4DIHH 3D65E 2KV8A 4YOIA 3MNXA 2OC1A 2Z3EA 1C2EA 5E2OA 1MTWA 2ASUB 2RRMA 3KL6A 3E1XB 3MYWA 2YT7A 4Q2PA 3MHWU 2Q9VA 1L4DA 1TYNA 3SU3A 2QAAA 3GSLA 3GY6A 2IWOA 1VZQH 1K1JA 3PLBA 4P2AB 4WYTA 3IG6B 2GCHG 2AMDA 3FZDA 4BAMB 2PGBB 1F7ZA 1FNIA 2HLCA 2PLXA 1HJ8A 1PPHE 1CHOF 1O3EA 3ZZAA 1XUGA 2G4UA 2RA3A 3F9EA 3RXKA 1YCPK 3LOXA 2P3UB 2ZPLA 1J9CH 2VIPA 1C1UH 2KJDA 1UTNA 2YOLA 3FAOA 1GJAB 2LC6A 1MKWK 4K69A 1ZUBA 4B2CA 2BYGA 4X6MA 3UIRA 4OS5A 2LA8A 5E11A 3T29A 2FS8A 3W94A 1DWDH 3BTME 1GHBG 1J14A 4Q2KA 3TH4H 4MDSA 3SU6A 3URDA 7LPRA 2EC9H 1KXEA 4B1TA 2ZHWH 1GHZA 5EXNA 1DLEA 1O2IA 2QYIA 5HEDA 2YTWA 3A89A 3RXEA 1D3TB 1CBWC 1FXYA 1ELEE 1UTKA 4B2AA 4HI3A 2BQ6B 2AIQA 1GHWH 1O3PB 4YZUA 1GDNA 1C2JA 1N7FA 5HFEA 2F91A 5EW2H 1HAIH 3MU1A 2JINA 2VVUA 3D62A 1CGIE 2PWXA 2A2QH 2PHBA 3BV9B 4FUGA 1WH1A 1SLUB 2F9BH 1V5LA 5LGOA 2QG1A 1DITH 1GMHG 2PNTA 2VGCB 2FODA 1KSNA 2KYLA 2DE9A 3PMHB 1AB9B 2ZGHA 2QF0A 1GDQA 1OP8A 1GBEA 4Q6HA 2AGEX 1O34A 1C5OH 2M0VA 1UMAH 2YUBA 2P94A 3LGUA 1O2WA 2ZGBH 2AYWA 3SV7A 2YUYA 1O35A 1AUTC 2OCVB 1GBTA 1TAWA 1TALA 3SO3A 4AMHA 2ZPSA 1WG6A 3NFKA 4OEOA 1FY3A 4Y7BA 5G4BA 3SUEA 1BFEA 1GHAF 1EOJA 1AO5A 1K1LA 3P6ZB 1DS2E 1GI9B 3CC0A 4LMMA 1O5CB 3TNSA 1C2LA 7KMEH 3UOUA 1W9QA 3NCLA 3SU0A 4DOQA 1O3KA 1O3OA 1QA0A 5L2YH 3TSZA 2A7CA 4WJG2 5HF1A 3E8LA 1P01A 3ZVFA 3O8BA 1TP5A 5DP4A 2B5TB 1DICA 2ZFFH 1C5VA 1GCDA 5LH8A 2ILNA 2EA3A 2ESTE 1T32A 3LC5A 3P17H 3EA8A 5DP7A 1GVKB 1GI1A 1FMGA 1AWHB 1TRYA 2V90A 2ZDAH 4FUEA 2QBWA 2OMJA 2XWBI 3RC6A 2NU0E 3RMMH 3RL8A 1KXCA 1ELAA 3SBKA 3ZZ7A 1BTPA 4Q7XA 3EGHC 2P3FH 3PROA 2DKRA 1ZHRA 2PKUA 4U2WA 4CBOA 1JOUB 5DP9A 1HIAB 2G00A 1JIRA 1DPOA 3KQEA 3RXVA 3E91A 1AVGH 1GJ6A 2PSYA 4X6NA 4NA9H 3RP2A 1UTJA 2QN5T 2K1ZA 1O39A 2B0FA 4YOGA 1Z71A 3QE1A 4AORA 1GBAA 4HFPB 1KWAA 3F68H 5A8XA 3SN8A 1QRXA 1WI2A 2FYRA 1CSOE 4THNH 1E38B 1TOMH 4ESTE 1BMNH 4K3JA 5DP3A 1UTMA 2ZU2A 5K7RA 1V2RT 2SGDE 3MMGA 3S7HB 1SL3A 1IQJA 2A0QB 1BZXE 1OXGA 4UFEH 1SGPE 5GNDA 4WWYA 2PW8H 1W13U 2SGFE 5L2ZH 2I4SA 3Q3KA 5D13A 3ATIA 2NWNA 1XUFA 2B8OH 1ZOKA 2ANYA 1O3AA 2Z7FE 2L4TA 1Z87A 2M0UA 1MTNB 1ZPBA 1O2GH 2VB0A 1EZSC 2K1QA 3HATH 3MNBA 4BTTB 1EB2A 3LPRA 2ZCKP 6GCHG 3A87A 1WJLA 1QR3E 2GT8A 1N8OB 2OS6A 3SHUA 1FI8A 2BHGA 4A1TA 3TH3H 4WMEA 2GVFA 2M0ZA 4JOEA 1C1WH 2A4QA 3UY9A 2MHOA 4I33A 1NTEA 1LVBA 4MPXA 4X8VH 3MU4A 4LK4A 1OP2A 2XC0A 1ANDA 1AZZA 1OYQA 5F8ZA 2DB5A 1KLIH 3MFJA 1ELBA 1Q31A 3I29A 2EI8A 2VVVA 1GI8B 3A7TA 5EQSA 2EEGA 4ABJA 1QJ7B 3LH3A 1AUJA 1G32B 3M3VA 5F8TA 3TJNA 2FM2A 4KKDA 1WFGA 3T25A 5IYTA 2ZG0H 1CT4E 1U3BA 5FB8C 2JH0D 2I6QA 1O2SA 4K8YA 3HPKA 4SGBE 3SW2B 1X45A 2Q6GA 2WPHS 2BDAA 3R0FA 1NRNH 4UD9H 1K1NA 1V2WT 2ZU4A 3I78A 3GY5A 3FP7E 2A4GA 5JBTA 3ZZ9A 5E0HA 2AERH 3NGHA 1K9OE 1Z8GA 4XSKU 2JILA 2NU4E 3FANA 2ZHEH 3RLWH 1C1RA 1BBRH 4IW4E 5C1YA 2BDIA 1XUJA 4FUJA 5DP8A 2O8MA 2OZFA 1EAUA 4Y0ZE 3O8DA 5C5OA 2EEKA 5J4QA 4X2WA 4IS5A 1ZMJA 1ORFA 1QBOA 1TGBA 2VNTA 3BF6H 2A4RA 3VXEH 1GJ9B 4CRAA 5LPFA 2YT8A 3GY3A 1TFXA 4LZ1H 4ZKSU 3MO9A 4TY6A 4YOJA 1UJDA 1FAKH 2ZDKA 2Y5FA 4AZ2B 3M5LA 1OOKB 4NMVA 1MKXK 2FP7B 1TIOA 2UUYA 2OSGA 1MAYA 1RFNA 2VH0A 2OQSA 3LU9B 3ID2A 3QUMP 1SGCA 1Y8TA 1SB1H 3RLEA 1XUIA 2FIRH 4TPYA 4WVPE 2ULLA 5JXBA 2JH5D 5FX6A 1UO6A 7ESTE 3C27B 1U39A 3PYHA 4I7YH 2JETC 3T27A 1UF1A 1PPBH 2QT5A 2FOEA 2BDHA 3BTHE 2KQFA 1YCPH 3K2UA 4X1QU 2ZU5A 2VWLA 3TITA 3FP8E 3PMBB 4E7RG 1MKWH 1NFUA 2UZCA 2HGTH 1O37A 1EPTB 3E0PB 1MD8A 4UONA 1LO6A 1TMUH 1UVSH 1OSSA 1MZDA 2FE5A 2O8WA 1P0SH 4FVBA 3I18A 2BY8X 2ZDLA 2Z9JA 1HAGE 1TP3A 2AWXA 4AB8A 1EX3A 2CSSA 4ZMAH 1C5MD 1DUAA 3A82A 1V6DA 1YPEH 4UU6A 1MU6B 2R2MB 1IQEA 1FAXA 1GHYH 2Y5HA 1TQ3A 1CVWH 3GISB 1SOTA 2W7RA 1TE0A 3U9AH 1O0DH 3AASA 4GLYA 1AKSB 1G3EA 1K1PA 5JBCS 1RJXB 4JZ1A 2Q6FA 3OU0A 9ESTA 1XUKA 2DM8A 1SVPA 3NZIA 1HAVB 1JMOH 1ZTKA 3SU5A 4MPWA 3FVFB 2CGAA 3MH7A 2ZDMA 2BVRH 2Y7ZA 4GSOA 3SGBE 3U8OH 1FPHH 2A5KA 4BNRA 4JCNA 1O2QA 1E36B 5EW1H 2GKVE 2M3MA 3T5FH 1V2NT 2AMPA 4AYVB 3H5CB 1BUIA 1ANBA 2P59A 5CHAC 1SQOA 1PQ5A 2PKSC 5DK1A 2AEIH 1W0ZU 2CF8H 5FPSA 2F9NA 1Z7KA 1GHXH 1L6OA 2P3WA 1A3BH 4JZFH 1UTPA 3R3GB 1UJUA 3U1JB 4WY3A 4TY7A 1P04A 1MTSA 3MWIU 3O8RA 3P70B 1BIOA 1SGFA 3GY4A 1WQVH 3O46A 2H9TH 2ZGCA 1P02A 1P8VC 1THSH 1MQ5A 3NKKA 2EHRA 1GPZA 2V3HH 4H4FA 1BHXF 1PPEE 1TX7A 5TCCA 1SFIA 1Z8RA 3M5MA 4Z0KA 5HXFA 4O03A 1P06A 3SUFA 4GHQA 1O2JA 5ETXA 1FIZA 1A46H 1GBMA 2ZFTA 3BEFB 1C5UA 4OGXA 2VIWA 3HPMA 3NXPA 4I8LA 4G69A 2UUFB 1W11U 5I7ZA 3GICB 3M3TA 4YT7H 1PJPA 1O3JA 5C67A 2XBVA 1NTPA 1GMDG 2WUCA 1AGJA 1SGEE 1TNJA 3UFAA 5B6LA 4AOQA 4MNYA 4Z33A 3CP7A 3V12A 1UEQA 1TRNA 3VB7A 5F3XA 4HZHA 4SGAE 3K1RA 5HFBA 2OGPA 1GHVH 2J2UA 4H6TA 1G3BA 1LHEH 2V3OH 3BG4B 3RLYH 2Z6BD 4NXPA 3UNRA 3SJIA 3TPIZ 3UNSA 2PA1A 2CS5A 1W8BH 3AAVA 4BAOB 2A31A 1UEZA 4IGDA 1ESBA 1ETRH 4NCYA 4YO9A 2H2CA 1NRRH 4WXVA 1EAXA 1O2XA 2WYJA 1Z86A 1AQ7A 4Q3HA 4NFEA 2EGOA 2L4SA 3U69H 3CBXA 1IAUA 2G8TA 4IBLH 3SI4H 4XBDA 4Z6AH 1KLTA 4BXWA 2GMTB 1KEFA 1MMJN 1MUEB 2Q3GA 1M9UA 1SHHB 3CYYA 1T8MA 2WINI 1UCYK 2QC2A 3BTQE 1ARCA 4GCHF 5SGAE 5EQQA 3FP6E 5JBBS 4JZEH 2VGCC 3P8GA 1F5KU 3BG8A 2LUIA 3KHVA 3P95A 2XRCA 1UHBB 3SNEA 3LGYA 1Y3WA 1IQLA 2PR3A 2CJIA 1ZGIA 2QA9E 4ZKRU 1T8LA 1QY6A 1C4Y2 1W7XH 4MNWA 4JOJA 1CO7E 3HKIB 3STIA 1DM4B 1Z6JH 3A84A 5GCHG 5FPTA 3VB6A 2JKHA 1NRQH 4RSPA 4B74A 1G9OA 2TGPZ 1W12U 3LKWA 4X1PU 1XX9A 2EDZA 1SSXA 4Z8JA 2ZDVH 5AF9H 4ABFA 1BCUH 1EZXC 3T2NA 4IC6A 4TPIZ 5DGJA 2GP9B 1O2MA 8GCHG 1TPSA 3HK6B 4X8SH 3IWMA 1BJUA 3A7XA 1AMHA 4Y0YE 1AE5A 3M7QA 2M0TA 1QIXB 1H8IH 1J8AA 1GHBF 2F9VA 1Y3YA 3PMAB 5BPEA 4WYUA 2W3IA 3TJUA 2IWQA 1C1MA 1P9SA 2QXHA 1TNKA 5A09A 2BDGA 1DVAH 1ZLRA 3QN7A 3MU0A 1HPGA 1QCPA 1IQGA 1SPJA 2OCSA 3AAUA 3IITA 2SFAA 1ELVA 3CH8A 4WMDA 2BD8A 3SQHE 3ATWA 4DGJA 2EGNA 4E3BA 1IQMA 2J38A 3HK3B 3QK1A 1J17T 1MAXA 2HNTE 2Y82A 2G51A 1P2QA 3MTYA 1C2IA 1GMHF 4O97A 2C8XB 3D49H 1O2VA 1ELDE 5DKMA 5H4IB 2ZHFH 3GCOA 4FU7A 1C4V2 1DY8A 4Q2QA 2GV6A 3ATKA 4NGAH 2RCZA 3RUOA 3KF2A 1E0FD 3GYMA 2ZTZA 2W3KA 4MLFB 3ZZ3A 4D8NA 1LHGH 1QB6A 2D2DA 2VVCA 2Z3CA 3ZZ4A 2GZ9A 3SNBA 4ABBA 2GV7A 1EATA 1S0QA 2Y6TA 1V2OT 3ODFA 3QJMA 1HAZB 4K6YA 5FX5A 2PKTA 2O8UA 3RXHA 1RXPA 1VITG 5E22A 2QKVA 1MKXH 3ZVDA 1EZQA 2HRVA 1GGDB 1GI5A 3LIWA 3HGNA 4K1TA 1Z6EA 2KPLA 3F9FA 4D9RA 2O2TA 3S0NA 2ZNKH 2G55A 3A85A 2Y80A 4A6LA 1C2KA 5LPRA 4CREA 1TGCA 1MTNC 1ZOMA 2HPPH 4FUHA 2I04A 1RTLA 1O3NA 1UVTH 1TNHA 1HCGA 4ABEA 2HPQH 1NT1A 1K28D 1WFVA 3CBYA 1N8OC 2XNIA 4F4OC 4BTIB 1O3MA 4NXRA 3GYLB 2KOMA 1D3DB 2HGAA 2GZ7A 2R2WU 1GI7B 2I1NA 1D5GA 1H9LB 3SUZA 1O2TA 1AHTH 1C9TA 1EJAA 3GCHB 3M3SA 2W7SA 1FLEE 3GGEA 1LPKB 1TRMA 1CGJE 1Y3UA 4K2YA 1YP9A 1AFQB 3I1EA 2JWEA 1GJ7B 4HOPB 1ELFA 1SGFG 1KTSB 3RXQA 1RD3B 2W7UA 1N6DA 2I6SA 1O2RA 3B8JA 3BN9A 3M7TA 3P8FA 4KTSA 3BIVH 1LVYA 4A5TS 4U32A 1A0JA 1S6HA 1DFPA 4MG3A 2GZ8A 1C5QA 2PTNA 3STJA 4I32A 4GHNA 2OTVA 3QDOA 1O2PA 3QGJA 1X8SA 2VIVA 2Y81A 2W4FA 1OKXA 5C1XA 1EZUC 3Q3YA 1ACBE 2FOCA 1BRCE 3SUDA 3QLPH 2FX6A 2FYQA 4OS6A 2BM2A 1LVMA 1HFDA 1MFLA 1T31A 4ZROA 3A8CA 5JBAS 1BMAA 1BMLA 2EI6A 5LPEA 1KDQB 1CGHA 3R0HA 4RKOB 5AFZH 1FV9A 2BY5X 1AVXA 2FPZA 2IN2A 2PKAB 4B73A 2WPKS 2P95A 1HXFH 3OTPA 3DHKH 4CHAC 1JIMA 1QJ6B 1S0RA 3SJ8A 4Y76A 1PPFE 3ZYEA 3RXFA 1ZJDA 2C93B 1NFYA 4AFZA 1ZHMA 2H5DA 4D7GA 3SU4A 1CA0B 1NRPH 2Z9IA 1C5YB 1RZXA 5F03A 3BPUA 1SMFE 1NPMA 4ZKOU 4OS7A 1XXDA 1S5SA 4M7GA 3L4FD 1C5LH 1PYTC 3I4WA 1A4WH 4UFGH 1NM6A 4LXBH 2OQ5A 4FGMA 2OC8A 1HXEH 3A7ZA 3VB3A 3ZZCA 2G5NA 3VGCB 1YPHE 3TSVA 1GI3A 1G3CA 3ZZ8A 1SQAA 5T6FA 5F8XA 1SI5H 3SJKA 4MPAA 1P2IA 2AINA 2CV3A 1FZZA 1GI4A 5T6GA 2V35A 1OS8A 3BTTE 1KY9A 2JH6D 3SOSA 4JYVH 4NMTA 5C5NA 3A88A 4AYYB 4WXIA 2F0AA 2O9QA 1MQ6A 4B71A 3TVJB 3R68A 1A5IA 1ELCA 1EPTC 1LKBA 1ZYOA 2FESH 3UNQA 1HIAA 1GMCG 3RXJA 4B76A 4IMZA 1GCTB 1SQTA 1OZIA 2AWUA 4E05H 1C5XB 3PO1C 1AN1E 2VWMA 1HDTH 2W5EA 3NK8A 2LOBA 2G4TA 1LHCH 4YLUA 2ZKSA 4YTAA 2SGEE 5EODA 1FN6A 1FY5A 2TIOA 3E6PH 1UK2A 1N7TA 1HYLA 5CE1A 5C2ZA 1F2SE 3ENSB 3ZVAA 1UCYH 4H42U 1PQ7A 2O8LA 7GCHF 2V6NA 1PYTD 2Z9KA 4HTCH 4ZH8A 1NY22 2AMQA 3KN2A 4JOKA 3VXFH 1UVUH 1ESAA 3TK5A 4F8KA 2TRMA 3V0XA 1QA7A 4KP0A 1FY4A 3UR6A 3LT3A 3L6PA 2J92A 3DJ1A 2J9NA 1BTXA 1P2OA 1V2MT 1QNJA 3LJJA 4UFDH 4MNVA 1O2ZA 1BITA 2KJKA 4AG2A 3CS7A 2BD5A 1G3DA 3SV8A 3CS0A 1B7XB 2VU8E 3VB5A 1X7AC 5IDKA 2XTTB 2FDAA 2ODQA 4X6OA 2CHAB 2DE8A 3L33A 3DD2H 3BEIB 3VB4A 3C1KA 2A5IA 4INKA 1ABJH 1W14U 3V3MA 1QFKH 3QZQA 1LVOA 3QX5H 5A2PA 1TMTH 2A2XH 3M5OA 3PLPA 1K2I1 2ZFQH 1C1NA 1T8OA 4NZQA 4P0CA 2WV4A 4A1VA 4OS2A 4AB9A 2HOBA 3DT0H 3RXIA 2Z9LA 1AVWA 4FUDA 5DP5A 3K6ZA 3O8CA 1Y3VA 3B76A 1GBCA 1ARBA 3SV2H 1MC7A 2VRFA 1IQIA 3KNXA 4BANB 2FLRH 3NUMA 1K22H 1MH0A 1VA8A 5L30H 2A32A 1P09A 5HF4A 4Y8YA 1W10U 1DSUA 1FC9A 1TA2A 1U6QA 2ZGJA 1D3PB 1G9IE 5TJXA 1YPMH 2ZHDA 1TB6H 2ANMH 3LGWA 4FUCA 2FI5E 1BTUA 1J16A 4DG4A 1C1SA 5A0AE 5HETA 2KA9A 3RL7A 1GHAG 3BG4C 3KGPA 4DT7B 2AFQB 2OBOA 2IOTA 2PFEA 4Y10E 2X7ZA 2FO9A 4NWKA 1FC7A 1A5HA 2FNEA 3VFEA 1O2HA 2J94A 1UCYE 3TH2H 4DW2U 2H5CA 5EPNA 4YYXA 2EI7A 3TJOA 4X1SU 3GCNA 2GMTC 4NMOA 1YF4A 2KOJA 3B9FH 4K60A 2F9OA 1H8DH 1T8NA 3BTWE 1RTKA 1SGIB 2KBSA 1ZTJA 2PGQB 3VEQB 1A5GH 1AD8H 1O5DH 2D26C 3ZYDA 3SU2A 5A2MH 1OWIA 4CHAB 2LNCA 2D8IA 4GPGA 3U8RH 4WF8A 3A7VA 1B8QA 4GHTA 1YCPM 4H6SB 2BD4A 1YM0A 1MFGA 4CR5A 1O5AB 2I6VA 1N6XA 2WL7A 1EPTA 3SUGA 4GVCA 1AZ8A 5B6OA 1W7GH 4BAQB 2PZDA 2Z94A 1V6BA 5EGMA 3BTDE 1YBWA 2OXSA 1OWJA 2AS9A 2HNTF 1GBBA 3FFGA 1Y7NA 4AN7A 2FOBA 1AIXH 1T2MA 3MU8A 1K21H 2OPGA 1PFXC 3JZ2B 3SHCH 1SBWA 1SG8B 2BMGB 3LONA 3M37A 1WAYB 2J34A 5HMAA 1P12E 2V0BA 1GMDF 1O30A 2UWPA 1VJAU 3LH1A 3SJOA 2VZ5A 1AKSA 3RXSA 4JK6A 1DWEH 1HGTH 2P3TB 3RMNH 3MH6A 1O5FH 1FY8E 4NSYA 2TPIZ 3GDVA 3S69A 4O06A 1HAVA 1U38A 2JOAA 4ZAEA 5JPMH 2G81E 3EA9A 5HJ1A 2VWOA 4NZLA 1Y5BT 3DJ3A 1GI2A 1TBQH 2XCFA 1BHXB 2XBXA 3M36A 1UTOA 3S9CA 1NN6A 3PO1B 2XXLA 1DLKB 1GJDB 1LMWB 1PQ8A 2GDDA 3ZZDA 3SGQE 1WOFA 3RXRA 2ZGXH 2XBWA 2ODYB 1FC6A 3SV6A 1JRTA 1EJNA 5FHTA 1GG6C 1SR5C 1NROH 4XBBA 3GJ9A 2F9UA 1C5SA 4N6XA 3ZVGA 4RKJB 4J2YB 2CXVA 2IPHA 4R2ZA 4B75A 2ZU3A 1Q2WA 3OSYA 4FU9A 1KXFA 1V2PT 1HJAC 2A4OA 3SJ9A 1XXFA 2BOHB 1IU0A 2RA0A 3SZNA 3RXCA 1D6RA 1WU1A 1QL7A 1DSTA 5G1DA 1GBIA 2KPKA 1QURH 2FOHA 3NWUA 3TMHA 5AVDA 1UVPA 2KAIB 1GGDC 1SGYE 2VSVA 3ZZ6A 3BTEE 2IWNA 2C8YB 2OINA 3I77A 1O2KA 3Q00A 4I8GA 1GL1A 8GCHF 4FUBA 1ZGVA 1ZJKA 3GCTF 1UM7A 3QZRA 2G5VA 1SGDE 5ESTE 4HGCA 3RC4A 1B0EA 2GZVA 1O38A 1QQUA 3RXDA 4NWLA 3TK6A 3TJVA 1C4U2 2AGIX 6ESTA 1ZRKA 3AW0A 3K6YA 4JOGA 3HKJB 1UEPA 1N6FA 1FIWA 2CF9H 2ZECA 4NNMA 3KQCA 1CU1A 2ZPQA 1OBYA 1GJ4H 3GCHC 5DP6A 3UUZA 5EPYA 3BEUA 1FCFA 1BOQA 1DXWA 3TIUA 1LQEA 3D23A 3PWBA 2A7JA 1AFQC 1Q3OA 1ID5H 1C5ZB 1HAYB 3OYPA 2THFB 2L97A 1TNGA 1HAXB 4ZXYH 1FJSA 1HB0B 1RGRA 3MNSA 3UQOA 4UDWH 1G37A 4D9QA 1LPZB 3MU5A 2R3UA 1EOLA 1C1QA 3SNAA 4NIXA 1UHBA 4R0IA 2BXTH 1VCWA 1SFQB 2ANKH 1EXFA 1IQHA 4I8JA 1O3BA 1GQ4A 1TMBH 1N6EA 1GL0E 2I0LA 4NG9H 1QAVB 1IHSH 1HAOH 2UUKB 3KQBA 3SI3H 3HPTB 1XKAC 4VGCC 1WSSH 4MNXA 4MTBA 3GDUA 1P1EA 1ZMLA 1O32A 3LGTA 1TABE 1NF3C 5ESBA 1Y5UT 1K32A 3MO3A 3UR9A 4MPUA 1XVOA 1N1LA 1W9OA 2ZFRH 4CRBA 1ANCA 3H7TA 2BD7A 2HWLB 3RXTA 2FTLE 1CA0C 1GM1A 2ZPMA 2ALPA 2H6MA 5E8EH 4AX9H 4ZUHA 1ZMNA 3K82A 2H9HA 1V2QT 1F0SA 2GTBA 1P11E 5HM2A 3T62A 1UJ1A 1S83A 2LC7A 5FBEA 4AFQA 4K1EA 3VGCC 2WPLS 5I25A 1V2UT 4JOHA 1O5BB 1NZQH 4Q7YA 1XVMA 1AWFH 1O31A 3RXMA 2GCHF 3DFJA 1E34B 1A3EH 2Z3DA 1HNEE 1I92A 3ZV9A 5ABWA 1MD7A 3URCA 4JL7A 5GPIB 4CH8B 2VIDA 1FQ3A 1DUEA 3AVZA 4AGKA 3BIUH 1FPCH 4JK5A 2REYA 1ELGA 1SC8U 4JZIA 2EAQA 1YBOA 1F5RA 1UK3A 1V2VT 5EXLA 4XHVA 4D76A 2VH6A 2DLUA 1YGCH 3A7YA 2C8ZB 2ZTYA 3TGJE 4K5ZA 1Y5AT 1F92A 3UOPA 5BRRE 2SNWA 2D92A 1GCTC 3RXOA 3DUXH 1VGCB 2ZFPH 2SGPE 5J4SA 3QGNB 3DJAA 1S85A 3RM0H 2B7DH 2FTMA 3RM2H 3UQVA 3VPKA 1C5WB 3ZZBA 1UM1A 5T3HA 4UE7H 2VIQA 2STAE 1W2KH 1GBFA 1UITA 1T4UH 2TGAA 2V1WA 2ALVA 2J4IA 4Y79A 1GG6B 1H9IE 3ZVCA 2G52A 3MH4A 1TNIA 4NNLA 5PTPA 4K75A 3TGIE 1V1TA 2EV8A 2R0LA 5E1YA 3QTVH 4Q2OA 3EGKH 1PPGE 2OC0A 5HYOA 1O2YA 5A0BA 3HVQC 1XM1A 1HJAB 1ZRBA 4DY7B 1PPZA 1D4PB 1YLCA 1HBTH 2QY0B 2XCNA 1C5RA 5EYZA 1GI0A 1HRTH 1H4WA 1BJVA 5TCAA 1UEWA 2ZEBA 4QT8C 1LHDH 1DX5M 3PB1E 4A1XA 2RDLA 2CHAC 3F6UH 1IHTH 1MU8B 1VJ9U 2IJOB 1ZZZA 1NS3A 1O3GA 4ISIH 1X5QA 1BBRK 1SOZA 1C5PA 1UTQA 1WF7A 4X8TH 2R4HA 4X1NU 4HOPA 4KFWA 1O3DA 2ZI2H 1MBQA 2EGKA 4Y8XA 4GCHG 1QHRB 3ZVEA 1G2LA 2J95A 5HEBA 1SLXB 4X2VA 1C1PA 2HVXA 2PUQH 2A45B 2WPMS 2K20A 1Y3XA 3RU4D 4GVDA 2ZPRA 1NRSH 1DWBH 4INLA 2AIPA 2DUCA 1GVZA 1O2UA 3MI4A 5E0JA 1VITH 2C90B 1IHJA 5EXMA 2FN5A 3OY6U 1FUJA 2HNTC 5T6DA 4XOJA 3H7OA 2H2BA 1T4VH 5AHGH 2BOKA 1RY4A 2STBE 1KDQA 4OS1A 2VWRA 1GVLA 1V3XA 3E16B 4ISNA 4Y71A 4ZHAA 2BD9A 1G2MA 2PKAA 2Z9GA 2GCTC 2I0IA 1X5NA 3EDXB 2ZZUH 2JREA 2GD4B 3SV9A 3PV4A 3RDZA 4AFSA 2ZFSA 4U30A 4F49A 4JOFA 1ETSH 1BA8B 2H1UA 1B5GH 2DMZA 5CMXH 3ZVBA 1WTGH 4NA7A 3L3TA 1N6YA 3P8NA 1YPLH 1ESTA 4K76A 1Q3XA 1WCZA 1Q3PA 2BQWB 2BZ6H 4VGCB 2BLVA 1ZHPA 1QAUA 1NFWA 5GJ4B 3DFLA 4Y6DA 1EASA 3ITIA 2MX6A 2ZWLH 3LGVA 2C3SA 5E0GA 3A8AA 1SGNE 1FONA 2BVSH 4CRFA 1YPJH 2GGVB 4ABAA 1KYNA 1O2LA 1YPKH 3NPSA 1AFEH 4O3TA 2Y5GA 3E0NB 1HJ9A 4I31A 1XZ9A 2DLSA 5DTHA 2ZU1A 6GCHF 1UTLM 2SGAA 4NXQA 5HFCA 6CHAB 1NU7B 1BRAA 1V2KT 1CE5A 3A80A 2BLOA 3DA9B 1O2OA 1E35B 2M5TA 3LNYA 1GBJA 2UUJB 3S7KB 1UK4A 2YNAA 3S9AA 3F1SB 1TPPA 1XUHA 2QXIA 3E90B 1DY9A 3TK9A 5GWZA 1G36A 2DJTA 1XKBC 4I8HA 2PDZA 1A2CH 2QKTA 4GUXA 2F9PA 3KEEA 1QRWA 4IMQA 4BXSA 1SGQE 1KXAA 4YDPA 2ZQ2A 2FXRA 1K1MA 1QL8A 2Z17A 3KQDA 4Q7ZA 2F5YA 1ANEA 3PWCA 3QJNA 1JWTA 2XC5A 1RIWB 1U37A 2VPHA 1CA8B 1VR1H 2A5AA 2GT7A 1UJVA 1OYTH 4XFQA 1G30B 2XYAA 4JMYA 1OX1A 4K1SA 1FDPA 1SGRE 1V62A 4K8BA 3TLOA 5HDYA 1O5GH 3SHWA 5K0HA 1SGTA 1HLTH 1TONA 4AFUA 2HE4A 1K1IA 2GX4A 1ZSKA 3WKMA 1LQDB 3MNCA 1TX6A 1QQ4A 4YM9A 2ZCHP 1AU8A 1JRSA 1I16A 3MH5A 2ENOA 4K72A 3ID4A 1LCYA 1GBKA 3GOVB 1BE9A 4L8NA 4I8KA 2P8OB 2BB4A 3PV2A 1CHOG 1ELTA 1TBRH 5EU8A 1WIFA 3LC3A 1ZSJA 2KJPA 2EEIA 2OP9A 2QXJA 1YPHC 2IWPA 4NIVA 3CENA 2KRGA 3O5NA 1C2FA 2G2LA 2OBQA 3EA7A 2RCEA 1RS0A 4FU8A 3B23B 1CHGA 1DT2A 1LPGB 1GBLA 1QBNA 1YKTA 1WUNH 3R69A 2C4FH 1WTHD 2JXOA 2SGQE 1KTTB 1BB0B 1WF8A 5JB9S 3RMOH 5A8YA 4LZ4B 1WHAA 1DANH 1QL9A 3ZV8A 3SNDA 1KXDA 2NU3E 3TU7H 2PUXB 2ZDNA 2ZIQH 3A83A 3K65B 4XE4A 1F0TA 3WKLA 3A81A 1Z8JB 4H11A 2BX4A 1C2DA 2OD3B 4ZHLU 2BDYA 2P93A 1EAIA 3RXAA 1W0YH 1EAWA 1P05A 4GVUA 4JYTA 1V5QA 1P10A 3WY8A 2CMYA 4UU5A 5EOKA 1C2HA 3EQ0H 4FXGH 8ESTE 1SLVB 1DE7H 3AXAA 2SNVA 2EJYA 4R8TB 5HFFA 1JBUH 1IU2A 1WYKA 3A8BA 2VJ1A 4LOYH 8KME2 2FX4A 2QXGA 2FCFA 3EE0B 2ODPA 1GWAA 1P1DA 3U8TH 1O5EH 3KZEA 3SQEE 2GDEH 1PDRA 1O3FA 3PM3A 2GCTB 3LJOA 1S81A 4NMPA 3S9BA 1YPGH 1TGSZ 1DOJA 4YLQH 4YESB 1XMNB 2WPJS 5HM9A 4Q80A 3BTGE 1P3CA 3HGPA 1TGTA 4Y7AA 3Q76A 1GBHA 1P03A 1E37B 1VCQA 3U98H 1C5TA 3QDZB 2ZO3H 3A8DA 5HFDA 1ZTLA 1EKBB 1EB1H 4JZDH 4O3UA 1SLWB 3QIKA 3ATMA 1TA6A 5E6PB 3EAJA 1CT0E 4DIIH 1EUFA 1L1NA 2BY9X 3KIDU 2FI4E 3W95A 2ZQ1A 1BRBE 1MCTA 2O8TA 1QJ1B 2UWLA 3T28A 2DAZA 3UWJH 1CBWB 1GJ5H 1UFXA 2C8WB 2PV9B 2H2ZA 5C20A 2VINA 2TGTA 3BTFE 4NA8A 1TOCB 2H9EH 4IC5A 1BTZA 4ISLA 4B2BA 3RXLA 1ZPCA 1OPHB 4BAHB 1GDUA 1P2KA 2D1JA 4WMFA 5FCRA 2PTCE 7GCHG 3KHFA 2FOFA 4OGYA 1C2MA 8LPRA 5DO4H 1BTYA 4OAJA 1FY1A 1F0UA 1LHFH 1EQ9A 1Z8IB 2Y7XA 4WH6A 2BDCA 4IN2A 4TWWA 1WHDA 1IQFA 1PQAA 4X1RU 4Y11E 2RG3A 1THPB 4E35A 2XW9A 3GDSA 1A0HB 1VJ6A 5C1UA 2A7HA 1HUTH 3TNTA 2TBSA 1BTHH 2AWWA 1ZR0A 3PDVA 1KXBA 1OBXA 4Q2NA 4JORA 5JDUB 3F9GA 1KIGH 1L4ZA 1ZPZA 4EDJA 2DC2A 3SORA 4D7FA 4ASHA 1VGCC 1UHPA 4ISOA 1BT7A 2BX3A 4CRCA 1RRKA 3E17A 1HV7A 3PTBA 2NU1E 2VWNA 1W9EA 4XBCA 1BMMH 3SFJA 4X0WU 1JXPA 4U01A 1HAHH 1O36A 2NU2E 4TWYA 3FZZA 3RXBA 2BY6X 2TGDA 4TYDA 4ABIA 3DIWA 4FUFA 4CBNA 1N7EA 4ZXXH 1QRZA 5JYIA 2B9LA 3P8OA 4Y8ZA 3GY7A 3RMLH 2BYAX 1A61H 1OWKA 2KAIA 1K1OA 3UTUH 3AW1A 4AGJA 1B0FA 4ZHMU 1S6FA 1MBMA 3LNXA 1LKAA 2VIOA 1HAPH 2ZA5A 4BAKB 3U1IB 3V13A 1DWCH 2ZHQH 3N7OA 1W3CA 1X6DA 2ANWA 1A1RA 2EDPA 3BTKE 1S82A 1N99A 1WBGB 1GJBB 3K50A 1TWXB 5FBIA 5DPAA 2EEJA 5GCHF 3ODDA 1EP5A 4DVAU 3LDXH 3MO6A 4FUIA 3SOEA 1F0RA 1BBRE 1BDAA 2ZCLP 5FAHA 4KTCA 3TSWA 4OEPA 1YLDA 3ZRTA 4A7IB 3PLKA 1QB9A 3A7WA 4OS4A 4X6PA 3EGGC 1UVOA 4X8UH 3A86A 4ABDA 1RGWA 2OQUA 1C1OA 2BTCE 2BLQA 2KOHA 2ZTXA 4MQAA 2FS9A 4A92A 2BXUH 1C1TA 4CH2B 3PMJA 3CBZA 2BQ7B 4KTUA 3ZZ5A 1RTFB 3SHAH 1AI8H 1Z1JA 1GQ5A 1OBZA 3GY2A 3KZDA 3M7UA 3VQFA 1S84A 2Q6DA 3ESTA 3UREA 4MVNA 1GBDA 1Q7XA 3E3TA 1D3QB 1NFXA 1O3LA 2OC7A 4PROA 3VQGA 3QO6A 1QAVA 1C9PA 3PTNA 4ABGA 1MTVA 1NESE 2F83A 1QBVH 1ETTH 4J1YA 3OX7U 2BD3A 5L6NH 5GLJA 2FLBH 3ID1A 2UWOA 2FEQH 1F5LA 4E7NA 1O33A 1P2JA 1V2TT 3LGIA 1LTOA 1DDJA 1O2NA 3RXUA 2FMJA 1C5NH 1VB7A 2R0KA 4NSVA 2QKUA 4NIYA 3Q3XA 2QGRA 1TBZH 1X5RA 2WYGA 1D9IA 4RI0A 1MCVA 2D8WA 1V2LT 5AFYH 3T26A 3NFLA 1BRUP 3V7TA 1VITF 4INHA 3PS4A 1A0LA 1GI6A 2KL1A 1J15A 2BVXH 1MTUA 1L1GA 2W26A 5FCKA 5F67A 4KGAA 5HEYA 1P2MA 2OUAA 3RXPA 1OP0A 5GIBA 2P16A 3G01A 2BDBA 5E2PA 5JB8S 1ZSLA 2FOMB 2QF3A 4CRGA 5EZ0A 1CT2E 3ATLA 5A8ZA 1R6JA 3ELAH 3JZ1B 2F3CE 2D90A 1P57B 5H3JA 1Z1IA 6CHAC 5E21A 1DXPA 4FVDA 3PV5A 4RN6A 5DJ7A 2Q1JA 3RU4T 1O3IA 1TNLA 2FZZA 1KLJH 1NC6A 1D6WA 1WV7H 4WH8A 1QGFA 3BSQA 2ZP0H 2FOAA 3RU4E 2FWWA 3RXGA 1AB9C 3FY5A 2YNBA 1TGNA 5GXPA 3DORA 4MPVA 1P3EA 3TGKE 1IOEA 2EXGA 4JOPA 1IQKA 5DG6A 2R3YA 6LPRA 1TQ0B 2PSXA 1EP6A 2WV5A 2CSJA 3OY5U 3M61U 2G5MB 1Y59T 2QV1A 1L0ZA 1ABIH 1TLDA 4GAWA 4NIWA 1RGQA 2WUBA 4JYUH 2KG2A 4DURA 1O3CA 4Q6SA 4BTUB 1H9HE 2A1DB 5C3NA 4UEHH 3UPEA 4BOHA 2BZAA 1AE8H 2CN0H 2ZF0H 1V2JT 1RIWC 2JETB 2HALA 1TX8A 1QTFA 1FN8A 1A7SA 2QIQA 3GCTG 1BQYA 4NMQA 4PQWA 1BTWA 5FPYA 3ID3A 1QB1A 4NMSA
chains in the Genus database with same CATH superfamily
4ABHA 2AGGX 1WQSA 5FXLA 1OWHA 2AH4X 2E7KA 5DN6D 1T7CA 2WPIS 1TPOA 4E06H 1IQNA 5HGGA 5EQRA 4X2YA 3UWIA 3P92A 4REYA 1VCPA 4ZKNU 5KEDA 2KAWA 2P8OC 3SNCA 4ISHH 4DCDA 2BY7X 3GY8A 1H1BA 1YYY1 3QGLA 2LPRA 2FI3E 2FOGA 4X2XA 2HE2A 2H3MA 2OLGA 4K78A 5A0CA 5I46H 1OWDA 2JIKA 5GDSH 2BD2A 2R9PA 1O3HA 5F6MA 3MOCA 2BLWA 3Q77A 1GJCB 1P9UA 3OTJE 1INCA 1CQQA 3M35A 3JXTA 5EG4A 2EDVA 1GJ8B 2XC4A 5G1EA 4IN1A 1SHYA 4UFFH 4CRDA 3FN8A 2EEHA 2ZC9H 4DJZB 4AG1A 1LDTT 1PPCE 4NMRA 4KELA 1C1VH 2XBYA 3QTOH 4XDEA 1QLCA 1V2ST 5CHAB 3K9XB 9LPRA 3PDZA 1P2NA 2PKSB 1NO9H 1EJMA 1AY6H 3F9HA 3KCGH 2H3LA 4E34A 1OWEA 3RC5A 1MZAA 2VSPA 4NFFA 1C2GA 1GMCF 4CR9A 1M5ZA 1TQ7B 1YC0A 1L1JA 2M10A 4KFVA 3EYDA 1L2EA 3M5NA 2XWAA 2QCYA 1WI4A 1TPAE 4YT6H 3SGAE 2WZQA 4O9VA 3SU1A 3QWCH 1THRH 3F2GA 1NU9A 1VAEA 4DIHH 3D65E 2KV8A 4YOIA 3MNXA 2OC1A 2Z3EA 1C2EA 5E2OA 1MTWA 2ASUB 2RRMA 3KL6A 3E1XB 3MYWA 2YT7A 4Q2PA 3MHWU 2Q9VA 1L4DA 1TYNA 3SU3A 2QAAA 3GSLA 3GY6A 2IWOA 1VZQH 1K1JA 3PLBA 4P2AB 4WYTA 3IG6B 2GCHG 2AMDA 3FZDA 4BAMB 2PGBB 1F7ZA 1FNIA 1SQRA 2HLCA 2PLXA 1HJ8A 1PPHE 1CHOF 1O3EA 3ZZAA 1XUGA 2G4UA 2RA3A 3F9EA 3RXKA 1YCPK 3LOXA 2P3UB 2ZPLA 1J9CH 2VIPA 1C1UH 2KJDA 1UTNA 2YOLA 3FAOA 1GJAB 2LC6A 1MKWK 4K69A 1ZUBA 4B2CA 2BYGA 2LP6A 4X6MA 3UIRA 4OS5A 4ACAA 2LA8A 5E11A 3T29A 4B6FA 2FS8A 3W94A 1DWDH 3BTME 1GHBG 1J14A 4Q2KA 3TH4H 4MDSA 3SU6A 3URDA 7LPRA 2KX4A 2EC9H 1KXEA 4B1TA 2ZHWH 1GHZA 5EXNA 1DLEA 1O2IA 2QYIA 5HEDA 2YTWA 3A89A 3RXEA 1D3TB 1CBWC 1FXYA 1ELEE 1UTKA 4B2AA 4HI3A 2BQ6B 2AIQA 1GHWH 1O3PB 4YZUA 1GDNA 1C2JA 1N7FA 5HFEA 2F91A 5EW2H 1HAIH 3MU1A 2JINA 2VVUA 3D62A 1CGIE 2PWXA 2A2QH 2PHBA 3BV9B 2KCPA 4FUGA 2IJD1 1WH1A 1SLUB 2F9BH 1V5LA 5LGOA 2QG1A 1DITH 1GMHG 2PNTA 2VGCB 2FODA 1KSNA 2KYLA 2DE9A 3PMHB 1AB9B 2ZGHA 2QF0A 3F0OA 1GDQA 1OP8A 1GBEA 4Q6HA 2AGEX 1O34A 1C5OH 3FOAA 2M0VA 1SKYE 1UMAH 2YUBA 2P94A 3LGUA 1O2WA 2ZGBH 2AYWA 3SV7A 2YUYA 1O35A 1AUTC 2OCVB 1GBTA 1TAWA 1TALA 3SO3A 4AMHA 2ZPSA 1WG6A 3NFKA 4OEOA 1FY3A 2AHME 4Y7BA 5G4BA 3SUEA 5C0UA 1BFEA 1GHAF 1EOJA 1AO5A 1K1LA 3P6ZB 1DS2E 1GI9B 3CC0A 4LMMA 1O5CB 4RT0A 3TNSA 1C2LA 7KMEH 3UOUA 1W9QA 3NCLA 3SU0A 4DOQA 1YY3A 1O3KA 1O3OA 1QA0A 5L2YH 3TSZA 2A7CA 4M9FA 4WJG2 5HF1A 3E8LA 1P01A 3ZVFA 3O8BA 1TP5A 5DP4A 2B5TB 1DICA 2ZFFH 1C5VA 1GCDA 5LH8A 2ILNA 2EA3A 1S6LA 2ESTE 1T32A 3LC5A 3P17H 3EA8A 5DP7A 1UW7A 1GVKB 1GI1A 1FMGA 1AWHB 1TRYA 2V90A 2ZDAH 4FUEA 2QBWA 2OMJA 2XWBI 3RC6A 2NU0E 3N7EA 3RMMH 3RL8A 1KXCA 1ELAA 3SBKA 3ZZ7A 1BTPA 4Q7XA 3EGHC 2P3FH 3PROA 3GABA 2DKRA 1ZHRA 2PKUA 4U2WA 4CBOA 1JOUB 5DP9A 1HIAB 3NCVA 2G00A 1JIRA 1DPOA 3KQEA 3RXVA 3E91A 1AVGH 1GJ6A 2PSYA 4X6NA 4NA9H 3RP2A 3EE7A 1UTJA 2QN5T 2K1ZA 1O39A 2B0FA 4YOGA 1Z71A 3QE1A 4AORA 1GBAA 4HFPB 1KWAA 3F68H 5A8XA 3SN8A 1QRXA 1WI2A 2FYRA 1CSOE 4THNH 1E38B 1TOMH 2QF4A 4ESTE 1BMNH 4K3JA 5DP3A 1UTMA 2ZU2A 5K7RA 1V2RT 2SGDE 3MMGA 2J5UA 3S7HB 1SL3A 1IQJA 2A0QB 1BZXE 1OXGA 4UFEH 1SGPE 5GNDA 4WWYA 2PW8H 1W13U 3CNRA 2SGFE 5L2ZH 2I4SA 3Q3KA 5D13A 3ATIA 2NWNA 1XUFA 4TT3D 2B8OH 4FLNA 1ZOKA 2ANYA 1YWUA 1O3AA 2YMSB 2L4TA 1Z87A 2M0UA 1MTNB 1ZPBA 2Z7FE 1O2GH 2VB0A 1EZSC 2K1QA 3HATH 3NRLA 3MNBA 4BTTB 1EB2A 3LPRA 2ZCKP 6GCHG 3A87A 1WJLA 1QR3E 2GT8A 1N8OB 2OS6A 3SHUA 1FI8A 2BHGA 4A1TA 3TH3H 4WMEA 2GVFA 2M0ZA 1W0KD 4JOEA 1C1WH 2A4QA 3UY9A 2MHOA 4I33A 1NTEA 1LVBA 4MPXA 4X8VH 3MU4A 4LK4A 1OP2A 2XC0A 1ANDA 1AZZA 1OYQA 5F8ZA 2DB5A 1KLIH 3MFJA 1ELBA 1Q31A 3I29A 2EI8A 2VVVA 1GI8B 3A7TA 5EQSA 2EEGA 4ABJA 1QJ7B 3LH3A 1AUJA 1G32B 3M3VA 5F8TA 3TJNA 2FM2A 4KKDA 1WFGA 5CHBA 3T25A 5IYTA 2ZG0H 1CT4E 1U3BA 5FB8C 2JH0D 2I6QA 1O2SA 4K8YA 3HPKA 4SGBE 3SW2B 1X45A 2Q6GA 2WPHS 2BDAA 3R0FA 1NRNH 4UD9H 1K1NA 1V2WT 2ZU4A 3I78A 3GY5A 3FP7E 2A4GA 5JBTA 3ZZ9A 5E0HA 3KDKA 2AERH 3NGHA 1K9OE 1Z8GA 4XSKU 2JILA 2NU4E 3FANA 2ZHEH 3RLWH 1C1RA 2EY4C 1BBRH 4IW4E 5C1YA 2BDIA 1XUJA 4FUJA 5DP8A 2O8MA 2OZFA 1EAUA 4Y0ZE 3O8DA 5C5OA 2EEKA 5J4QA 4X2WA 4IS5A 1ZMJA 1ORFA 1QBOA 1TGBA 2VNTA 3BF6H 2A4RA 3GS9A 3VXEH 1GJ9B 4CRAA 5LPFA 2YT8A 3GY3A 1TFXA 4LZ1H 4ZKSU 3MO9A 4TY6A 4YOJA 1UJDA 2JSNA 1FAKH 2ZDKA 2Y5FA 4AZ2B 3M5LA 3DCLA 1OOKB 4NMVA 1MKXK 2FP7B 1TIOA 2UUYA 2OSGA 1MAYA 1RFNA 2VH0A 2OQSA 3LU9B 3ID2A 3QUMP 1SGCA 1Y8TA 1SB1H 4XRNA 3RLEA 1XUIA 2FIRH 4TPYA 4WVPE 2ULLA 5JXBA 2JH5D 5FX6A 1UO6A 7ESTE 3C27B 1U39A 3PYHA 4I7YH 2JETC 3T27A 1UF1A 1PPBH 2QT5A 2FOEA 2BDHA 3BTHE 2KQFA 5HIZA 1YCPH 3K2UA 4X1QU 2ZU5A 2VWLA 3TITA 3FP8E 3PMBB 4E7RG 1MKWH 1NFUA 2UZCA 2HGTH 1O37A 1EPTB 3E0PB 1MD8A 4UONA 1LO6A 1TMUH 1UVSH 1OSSA 1MZDA 2FE5A 2O8WA 1P0SH 4FVBA 3I18A 2BY8X 2ZDLA 2Z9JA 2QF5A 1HAGE 1TP3A 2AWXA 4AB8A 1EX3A 2CSSA 4ZMAH 1C5MD 1DUAA 3A82A 1V6DA 1YPEH 4UU6A 1MU6B 2R2MB 1IQEA 1FAXA 1GHYH 2Y5HA 1TQ3A 1CVWH 1QZ8A 3GISB 1SOTA 2W7RA 1TE0A 3U9AH 1O0DH 3AASA 4GLYA 1AKSB 1G3EA 1K1PA 5JBCS 1RJXB 4JZ1A 2Q6FA 3OU0A 9ESTA 1XUKA 2DM8A 1SVPA 3W1EA 3NZIA 1HAVB 1JMOH 1ZTKA 3SU5A 4MPWA 3FVFB 2CGAA 1YLNA 3MH7A 2ZDMA 2BVRH 2Y7ZA 4GSOA 3SGBE 3U8OH 1FPHH 2A5KA 4BNRA 4JCNA 1O2QA 1E36B 5EW1H 2GKVE 2M3MA 3T5FH 1V2NT 2AMPA 4AYVB 3H5CB 1BUIA 1ANBA 2P59A 5CHAC 1SQOA 1PQ5A 2PKSC 5DK1A 2AEIH 1W0ZU 2CF8H 5FPSA 2F9NA 1Z7KA 1GHXH 1L6OA 2P3WA 1A3BH 4JZFH 1UTPA 3R3GB 1UJUA 3U1JB 4WY3A 3PRBA 4TY7A 1P04A 1MTSA 3MWIU 3O8RA 3P70B 1BIOA 1SGFA 3GY4A 1WQVH 3O46A 2H9TH 2ZGCA 1P02A 1P8VC 1THSH 1MQ5A 3NKKA 2EHRA 1GPZA 2V3HH 4H4FA 1BHXF 1PPEE 1TX7A 5TCCA 1SFIA 1Z8RA 3M5MA 4Z0KA 5HXFA 4O03A 1P06A 3SUFA 4GHQA 1O2JA 5ETXA 1FIZA 1A46H 1GBMA 2ZFTA 3BEFB 1C5UA 4OGXA 2VIWA 3HPMA 3NXPA 4I8LA 4G69A 2UUFB 1W11U 5I7ZA 3GICB 3M3TA 5EJLA 4YT7H 1PJPA 1O3JA 5C67A 2XBVA 1NTPA 1GMDG 2WUCA 1AGJA 1SGEE 1TNJA 3UFAA 5B6LA 4AOQA 4MNYA 4Z33A 3CP7A 3V12A 1UEQA 1E1QD 1TRNA 3VB7A 5F3XA 4HZHA 4SGAE 3K1RA 5HFBA 2OGPA 1GHVH 2J2UA 4H6TA 1G3BA 1LHEH 2V3OH 3BG4B 3RLYH 2Z6BD 4JJ0A 4NXPA 3UNRA 3SJIA 3TPIZ 3UNSA 2PA1A 2CS5A 1W8BH 3AAVA 4BAOB 2A31A 1UEZA 2W6JD 4IGDA 1ESBA 1ETRH 2IPQX 5IL9A 4NCYA 4YO9A 2H2CA 1NRRH 4WXVA 1EAXA 1O2XA 3FO8D 2WYJA 1Z86A 1AQ7A 4Q3HA 4NFEA 2EGOA 2L4SA 3U69H 3CBXA 1IAUA 2G8TA 4IBLH 3SI4H 4XBDA 4F48B 4Z6AH 1KLTA 4BXWA 2GMTB 1KEFA 1MMJN 3AK5A 1MUEB 2Q3GA 1M9UA 1SHHB 3CYYA 1T8MA 2WINI 1UCYK 2QC2A 3BTQE 1ARCA 4GCHF 5SGAE 5EQQA 3FP6E 5JBBS 4JZEH 2VGCC 3P8GA 1F5KU 3BG8A 2LUIA 3KHVA 3WWBA 3P95A 2XRCA 1UHBB 3SNEA 3LGYA 1Y3WA 1IQLA 2PR3A 2CJIA 1ZGIA 2QA9E 4ZKRU 1T8LA 1QY6A 1WXRA 1C4Y2 1W7XH 4MNWA 4JOJA 1CO7E 3HKIB 3STIA 1DM4B 1Z6JH 3A84A 2KFWA 5GCHG 5FPTA 3VB6A 2JKHA 1NRQH 4RSPA 4B74A 1G9OA 2TGPZ 1W12U 3LKWA 4X1PU 1XX9A 2EDZA 1SSXA 4Z8JA 2ZDVH 5AF9H 4ABFA 1BCUH 1EZXC 3T2NA 2PP6A 4IC6A 4TPIZ 4XD7D 5DGJA 2GP9B 1O2MA 8GCHG 1TPSA 3HK6B 4X8SH 3IWMA 1BJUA 2F43B 3A7XA 1AMHA 4Y0YE 1AE5A 3M7QA 2M0TA 1QIXB 1H8IH 1J8AA 1GHBF 3OE7D 2F9VA 4RT1A 1Y3YA 3PMAB 5BPEA 4WYUA 2W3IA 3TJUA 2IWQA 1C1MA 1P9SA 2QXHA 1TNKA 5A09A 2BDGA 1DVAH 1ZLRA 3QN7A 3MU0A 1HPGA 1QCPA 1IQGA 1SPJA 4HG6A 2OCSA 3AAUA 3IITA 2SFAA 1ELVA 3CH8A 4WMDA 2BD8A 3SQHE 3ATWA 4DGJA 2EGNA 4E3BA 1IQMA 2J38A 3HK3B 3QK1A 1J17T 1MAXA 2HNTE 2Y82A 2G51A 1P2QA 3MTYA 3WW7A 1W0JD 1C2IA 1GMHF 4O97A 2C8XB 3D49H 1O2VA 2HVYB 3F3BA 1ELDE 5DKMA 5H4IB 2ZHFH 3GCOA 4FU7A 1C4V2 1DY8A 4Q2QA 2GV6A 3ATKA 4NGAH 2RCZA 3RUOA 3KF2A 1E0FD 3GYMA 2ZTZA 2W3KA 4MLFB 3ZZ3A 4D8NA 1LHGH 1QB6A 2D2DA 2VVCA 2Z3CA 3ZZ4A 2GZ9A 3SNBA 4ABBA 2GV7A 1EATA 1S0QA 2Y6TA 1V2OT 3ODFA 3QJMA 1HAZB 4K6YA 5FX5A 2PKTA 2O8UA 3RXHA 1RXPA 1VITG 5E22A 5C0TA 2QKVA 1MKXH 3ZVDA 1EZQA 2HRVA 1GGDB 1GI5A 3LIWA 3HGNA 4K1TA 1Z6EA 2KPLA 3F9FA 4D9RA 2O2TA 3S0NA 2ZNKH 2G55A 3A85A 2RDEA 2Y80A 4A6LA 1C2KA 5LPRA 4CREA 1TGCA 2YMSC 1MTNC 1ZOMA 2HLDD 2HPPH 4FUHA 2I04A 1RTLA 1O3NA 1UVTH 1TNHA 1HCGA 4ABEA 2HPQH 1NT1A 1K28D 1WFVA 3CBYA 1N8OC 2XNIA 4F4OC 4BTIB 1O3MA 4NXRA 3GYLB 2KOMA 1D3DB 2HGAA 2GZ7A 2R2WU 1GI7B 2I1NA 5IK2D 1D5GA 1H9LB 3SUZA 1O2TA 1AHTH 2K8IA 1C9TA 1EJAA 3GCHB 3M3SA 2W7SA 1FLEE 3GGEA 1LPKB 1TRMA 4YXWD 1OHHD 1CGJE 1Y3UA 4K2YA 1YP9A 1AFQB 3I1EA 2JWEA 1GJ7B 4HOPB 1ELFA 1SGFG 1KTSB 3RXQA 1RD3B 2W7UA 1N6DA 2I6SA 1O2RA 3B8JA 3BN9A 5B42A 3M7TA 3P8FA 3BIVH 4KTSA 1LVYA 4A5TS 4U32A 1A0JA 1S6HA 1DFPA 4MG3A 2GZ8A 1C5QA 2PTNA 3STJA 3ZIAD 4I32A 4GHNA 2OTVA 3QDOA 1O2PA 3KQ5A 3QGJA 1X8SA 2VIVA 2Y81A 2W4FA 1OKXA 5C1XA 1EZUC 3Q3YA 1ACBE 2FOCA 1BRCE 3N99A 3SUDA 3QLPH 2FX6A 2FYQA 4OS6A 2BM2A 1LVMA 1HFDA 1MFLA 1T31A 3KYFA 4ZROA 3A8CA 5JBAS 1BMAA 1BMLA 2EI6A 2YMSD 1KDQB 5LPEA 1CGHA 3R0HA 4RKOB 5AFZH 1FV9A 2BY5X 1AVXA 2FPZA 2IN2A 2PKAB 4B73A 2WPKS 2P95A 1HXFH 3OTPA 2WV9A 3DHKH 4CHAC 1JIMA 1QJ6B 1S0RA 3SJ8A 4Y76A 1PPFE 3ZYEA 3RXFA 1ZJDA 2C93B 1NFYA 4AFZA 1ZHMA 2H5DA 4D7GA 3SU4A 1CA0B 1NRPH 2Z9IA 1C5YB 1RZXA 2V7QD 5F03A 3BPUA 1SMFE 1NPMA 4ZKOU 4OS7A 1XXDA 1S5SA 4M7GA 3L4FD 1C5LH 1PYTC 3VG8A 3I4WA 1A4WH 4UFGH 1NM6A 4LXBH 2OQ5A 4FGMA 2OC8A 1HXEH 3A7ZA 3VB3A 3ZZCA 2G5NA 2JJ1D 3VGCB 1YPHE 3TSVA 1GI3A 1G3CA 3ZZ8A 1SQAA 5T6FA 5F8XA 1SI5H 3U28C 3SJKA 4MPAA 1P2IA 2AINA 2CV3A 1FZZA 1GI4A 5T6GA 2V35A 1OS8A 3BTTE 1KY9A 2JH6D 3SOSA 4JYVH 4NMTA 5C5NA 3A88A 4AYYB 4WXIA 2F0AA 2O9QA 1MQ6A 4B71A 3TVJB 3R68A 1A5IA 1ELCA 1EPTC 1LKBA 1ZYOA 2FESH 4Q4LA 3UNQA 1HIAA 3KDGA 1GMCG 5T1VA 3RXJA 4B76A 4IMZA 1GCTB 3N7DA 1SQTA 1OZIA 2AWUA 4E05H 1C5XB 3PO1C 1AN1E 2VWMA 1HDTH 2W5EA 3NK8A 2LOBA 2G4TA 1LHCH 4YLUA 2ZKSA 4YTAA 2SGEE 5EODA 1FN6A 1FY5A 2TIOA 2W6ID 3E6PH 1UK2A 1N7TA 1HYLA 5CE1A 2EQNA 5C2ZA 1F2SE 3ENSB 3ZVAA 2KM0A 1UCYH 4H42U 1PQ7A 2O8LA 2WPDD 7GCHF 2V6NA 1PYTD 2Z9KA 4HTCH 4ZH8A 3PRDA 1NY22 2AMQA 3KN2A 5CDFE 4JOKA 3VXFH 1UVUH 1ESAA 3TK5A 4F8KA 2TRMA 3V0XA 1QA7A 4KP0A 5EJ1A 1FY4A 3UR6A 3LT3A 3L6PA 2J92A 3DJ1A 2J9NA 1BTXA 1P2OA 1V2MT 1QNJA 3LJJA 4UFDH 4MNVA 1O2ZA 1BITA 2KJKA 4AG2A 3CS7A 2BD5A 1G3DA 3SV8A 3CS0A 1B7XB 2VU8E 3VB5A 4FOUC 1X7AC 5IDKA 2XTTB 2FDAA 2ODQA 4X6OA 2CHAB 2DE8A 3L33A 3DD2H 3BEIB 3VB4A 3C1KA 2A5IA 4INKA 1ABJH 1W14U 3V3MA 1QFKH 3QZQA 1LVOA 3QX5H 5A2PA 1TMTH 2A2XH 3M5OA 3PLPA 1COWD 1K2I1 2ZFQH 1C1NA 1T8OA 4NZQA 4P0CA 2WV4A 4A1VA 4OS2A 4AB9A 2HOBA 3DT0H 3RXIA 2Z9LA 1AVWA 4FUDA 5DP5A 3K6ZA 3O8CA 1Y3VA 3B76A 5KGOA 2J98B 1GBCA 1ARBA 3SV2H 1MC7A 2VRFA 1IQIA 3KNXA 4BANB 2FLRH 3NUMA 1K22H 1MH0A 1VA8A 5L30H 2A32A 1P09A 5HF4A 4Y8YA 1W10U 1DSUA 1FC9A 1TA2A 1U6QA 2ZGJA 1D3PB 1G9IE 5TJXA 1YPMH 2ZHDA 2CK3D 1TB6H 2ANMH 3LGWA 4FUCA 2FI5E 1BTUA 1J16A 4DG4A 1C1SA 5A0AE 5HETA 2KA9A 3RL7A 1GHAG 3BG4C 3KGPA 4DT7B 2AFQB 2OBOA 2IOTA 2PFEA 4Y10E 2X7ZA 2FO9A 4NWKA 1FC7A 1A5HA 1H8HD 2FNEA 3VFEA 1O2HA 2L6OA 2J94A 1UCYE 3TH2H 4DW2U 2H5CA 5EPNA 4YYXA 2EI7A 3TJOA 4X1SU 3GCNA 2GMTC 4NMOA 1YF4A 2KOJA 3B9FH 4K60A 2F9OA 1H8DH 1T8NA 3BTWE 1RTKA 1SGIB 2KBSA 1ZTJA 2PGQB 4ASUD 3VEQB 2F4LA 1A5GH 1AD8H 1O5DH 2D26C 2XOKD 3ZYDA 3SU2A 5A2MH 1OWIA 4CHAB 2LNCA 2D8IA 4GPGA 3U8RH 4WF8A 3DSOA 3A7VA 1B8QA 2XNDD 4GHTA 1YCPM 4H6SB 2BD4A 1YM0A 1MFGA 4CR5A 1O5AB 2I6VA 1N6XA 2WL7A 1EPTA 3SUGA 4GVCA 1AZ8A 5B6OA 1W7GH 4BAQB 2PZDA 2Z94A 1V6BA 5EGMA 3BTDE 1YBWA 2OXSA 1OWJA 2AS9A 2HNTF 1GBBA 3FFGA 1Y7NA 4AN7A 2FOBA 1AIXH 1T2MA 3MU8A 1K21H 2OPGA 1PFXC 3JZ2B 3SHCH 5C17A 1SBWA 1SG8B 2BMGB 3LONA 3M37A 1WAYB 2J34A 5HMAA 2KR7A 1P12E 2V0BA 1GMDF 1O30A 2UWPA 1VJAU 3LH1A 3SJOA 2VZ5A 1AKSA 3RXSA 4JK6A 1DWEH 1HGTH 2P3TB 3RMNH 3MH6A 1O5FH 1FY8E 4NSYA 4P02A 2TPIZ 3GDVA 3S69A 4O06A 1HAVA 1U38A 2JOAA 4ZAEA 5JPMH 2G81E 3EA9A 5HJ1A 2VWOA 4F55A 2KZ4A 4NZLA 1Y5BT 4Z1MD 3SYJA 3DJ3A 1GI2A 1TBQH 2XCFA 1BHXB 2XBXA 3M36A 1UTOA 3S9CA 1NN6A 3PO1B 2XXLA 1DLKB 1GJDB 1LMWB 1PQ8A 2GDDA 3ZZDA 3SGQE 1WOFA 3RXRA 2ZGXH 2XBWA 2ODYB 1FC6A 3SV6A 1JRTA 1EJNA 5FHTA 1GG6C 1SR5C 1NROH 2JJ2D 4XBBA 3GJ9A 2F9UA 1C5SA 4N6XA 3ZVGA 4RKJB 4J2YB 2CXVA 2IPHA 4R2ZA 4B75A 2ZU3A 1Q2WA 3OSYA 4FU9A 1KXFA 1V2PT 1HJAC 2A4OA 3SJ9A 1XXFA 2BOHB 1IU0A 2RA0A 3SZNA 3RXCA 1D6RA 2JDID 1WU1A 1QL7A 2LELA 4P00A 1DSTA 5G1DA 1GBIA 2KPKA 1QURH 2FOHA 3NWUA 3TMHA 5AVDA 1UVPA 2KAIB 1GGDC 1SGYE 2VSVA 3ZZ6A 3BTEE 2IWNA 2C8YB 2OINA 3I77A 1O2KA 3Q00A 4I8GA 1GL1A 8GCHF 4FUBA 1ZGVA 1ZJKA 3GCTF 1UM7A 3QZRA 2G5VA 1SGDE 5ESTE 4HGCA 3RC4A 1B0EA 2GZVA 1O38A 5F53A 1QQUA 1EFRD 3RXDA 4NWLA 3TK6A 3TJVA 1C4U2 2AGIX 6ESTA 1ZRKA 3AW0A 3K6YA 4JOGA 3HKJB 1UEPA 1N6FA 1FIWA 2CF9H 3F2FA 2ZECA 4NNMA 3KQCA 1CU1A 2ZPQA 4Q63A 1OBYA 1GJ4H 3GCHC 5DP6A 3UUZA 5EPYA 3BEUA 1FCFA 1BOQA 1DXWA 3TIUA 1LQEA 5EIYA 3D23A 3PWBA 2A7JA 1AFQC 1Q3OA 1ID5H 1C5ZB 1HAYB 3OYPA 2THFB 2L97A 1TNGA 1HAXB 4ZXYH 1FJSA 1HB0B 1NBMD 1RGRA 3MNSA 3UQOA 4UDWH 1G37A 4D9QA 1LPZB 3MU5A 2R3UA 1EOLA 1C1QA 3SNAA 4NIXA 1UHBA 4R0IA 2BXTH 1VCWA 1SFQB 2ANKH 3UB0A 1EXFA 1IQHA 4I8JA 1O3BA 1GQ4A 1TMBH 1N6EA 1GL0E 2I0LA 4NG9H 1QAVB 1IHSH 1HAOH 2UUKB 3KQBA 3SI3H 3HPTB 1XKAC 3OFND 4VGCC 1WSSH 4MNXA 4MTBA 3GDUA 2QE7D 1P1EA 1ZMLA 1O32A 3LGTA 1TABE 1NF3C 5ESBA 1Y5UT 1K32A 3MO3A 3UR9A 4MPUA 1XVOA 2WHXA 1N1LA 1W9OA 2ZFRH 4CRBA 1ANCA 3H7TA 2BD7A 2HWLB 3RXTA 2FTLE 1CA0C 1GM1A 2KCYA 2ZPMA 2ALPA 2H6MA 5E8EH 4AX9H 4ZUHA 2K0QA 1ZMNA 3K82A 2H9HA 1V2QT 1F0SA 2GTBA 1P11E 5HM2A 3T62A 1UJ1A 1S83A 2LC7A 5FBEA 4AFQA 4K1EA 3VGCC 2WPLS 5I25A 1V2UT 4JOHA 1O5BB 1NZQH 4Q7YA 1XVMA 1AWFH 1O31A 3RXMA 2GCHF 2L74A 3DFJA 2JIZD 1E34B 1A3EH 1KMHB 2Z3DA 1HNEE 1I92A 3ZV9A 5ABWA 1MD7A 3URCA 4JL7A 5GPIB 4CH8B 2VIDA 1FQ3A 1DUEA 3AVZA 4AGKA 3BIUH 1FPCH 4JK5A 2REYA 1ELGA 1SC8U 4JZIA 2EAQA 1YBOA 1F5RA 1UK3A 1V2VT 5EXLA 4XHVA 4D76A 2VH6A 2DLUA 1YGCH 3A7YA 2C8ZB 2ZTYA 3TGJE 4K5ZA 1Y5AT 1F92A 3UOPA 5BRRE 2SNWA 2D92A 1GCTC 3RXOA 3DUXH 1VGCB 2ZFPH 2SGPE 5J4SA 3QGNB 3DJAA 5HIYA 1S85A 3RM0H 2B7DH 2FTMA 3RM2H 3UQVA 3VPKA 1C5WB 3ZZBA 1UM1A 5T3HA 4UE7H 3KYGA 2VIQA 2STAE 1W2KH 2M2AA 1GBFA 1UITA 4ACBA 1T4UH 2TGAA 2V1WA 2ALVA 2J4IA 4Y79A 1GG6B 1H9IE 3ZVCA 2G52A 3MH4A 1TNIA 4NNLA 5PTPA 4K75A 3TGIE 1V1TA 2EV8A 2R0LA 5E1YA 3QTVH 3F0PA 4Q2OA 3EGKH 1PPGE 2OC0A 5HYOA 1O2YA 2GJGA 5A0BA 3HVQC 1XM1A 1HJAB 1ZRBA 4DY7B 1PPZA 2V3MA 1D4PB 1YLCA 1HBTH 2QY0B 2XCNA 1C5RA 5EYZA 4JJ3A 1GI0A 1HRTH 1H4WA 1BJVA 5TCAA 1UEWA 2ZEBA 4QT8C 1LHDH 1DX5M 3PB1E 4A1XA 2RDLA 2CHAC 3F6UH 3MQKC 1IHTH 1MU8B 1VJ9U 2IJOB 1ZZZA 1NS3A 1O3GA 4ZCNA 4ISIH 1X5QA 1BBRK 1SOZA 1C5PA 1UTQA 1WF7A 4X8TH 2R4HA 4X1NU 4HOPA 4KFWA 1O3DA 2ZI2H 1MBQA 2EGKA 4Y8XA 4GCHG 1QHRB 3ZVEA 1G2LA 2J95A 5HEBA 1SLXB 4X2VA 1C1PA 2HVXA 2PUQH 2A45B 2WPMS 2K20A 1Y3XA 3RU4D 4GVDA 2ZPRA 1NRSH 1DWBH 4INLA 2AIPA 2DUCA 1GVZA 1O2UA 3MI4A 5E0JA 1VITH 2C90B 1IHJA 5EXMA 2FN5A 3OY6U 1FUJA 3FKSD 2HNTC 5T6DA 4XOJA 3H7OA 2H2BA 1T4VH 5AHGH 2BOKA 1RY4A 2STBE 2OK5A 1KDQA 4OS1A 5C94A 2VWRA 1GVLA 1V3XA 3E16B 4ISNA 4Y71A 4ZHAA 2KCOA 2BD9A 1G2MA 2PKAA 2Z9GA 2GCTC 2I0IA 1X5NA 3EDXB 2ZZUH 2JREA 2GD4B 3SV9A 3PV4A 3RDZA 4AFSA 2ZFSA 3OEHD 4U30A 4F49A 4JOFA 1ETSH 1BA8B 2H1UA 1B5GH 2DMZA 5CMXH 3ZVBA 1WTGH 4NA7A 3L3TA 1N6YA 3P8NA 1YPLH 1ESTA 4K76A 1Q3XA 1WCZA 1Q3PA 2BQWB 2BZ6H 4VGCB 2BLVA 1ZHPA 1QAUA 1NFWA 5GJ4B 3DFLA 4Y6DA 1EASA 3ITIA 2MX6A 2ZWLH 3LGVA 2C3SA 5E0GA 3A8AA 1SGNE 1FONA 2BVSH 4CRFA 1YPJH 2GGVB 4ABAA 1KYNA 1O2LA 1YPKH 3NPSA 1AFEH 4O3TA 2Y5GA 3E0NB 1HJ9A 4I31A 1XZ9A 2DLSA 5DTHA 2ZU1A 6GCHF 1UTLM 2SGAA 4NXQA 5HFCA 6CHAB 1NU7B 1BRAA 1V2KT 1CE5A 3A80A 2BLOA 3DA9B 1O2OA 1E35B 2M5TA 1FX0B 3LNYA 1GBJA 4TSFD 2UUJB 3S7KB 1UK4A 2YNAA 3S9AA 3F1SB 1TPPA 1XUHA 2QXIA 3E90B 1DY9A 3TK9A 5GWZA 1G36A 2DJTA 1XKBC 2KCAA 4I8HA 2PDZA 1A2CH 2QKTA 4GUXA 5HKKD 2F9PA 3KEEA 1QRWA 4IMQA 4BXSA 1SGQE 1KXAA 4YDPA 2ZQ2A 2FXRA 1K1MA 1QL8A 5FL7D 2Z17A 3KQDA 4Q7ZA 2F5YA 1ANEA 3PWCA 3QJNA 1JWTA 2XC5A 1RIWB 1U37A 2VPHA 1CA8B 1VR1H 2A5AA 2GT7A 1UJVA 1OYTH 4XFQA 1G30B 2XYAA 4JMYA 1OX1A 4K1SA 1FDPA 1SGRE 1V62A 4K8BA 3TLOA 5HDYA 1O5GH 3SHWA 5K0HA 1SGTA 1HLTH 1TONA 4AFUA 1E79D 2HE4A 1K1IA 2GX4A 1ZSKA 3WKMA 1LQDB 3MNCA 1TX6A 1QQ4A 4YM9A 2ZCHP 1AU8A 1JRSA 1I16A 3MH5A 2ENOA 4K72A 3ID4A 1LCYA 1GBKA 3GOVB 1BE9A 4L8NA 4I8KA 2P8OB 2BB4A 3PV2A 1CHOG 1ELTA 1TBRH 5EU8A 1WIFA 3LC3A 1ZSJA 2KJPA 2EEIA 2OP9A 2QXJA 1YPHC 2IWPA 4NIVA 3CENA 2KRGA 3O5NA 1C2FA 2G2LA 2OBQA 3EA7A 2RCEA 1RS0A 4FU8A 3B23B 1CHGA 4AC9A 3H09A 1DT2A 1LPGB 1GBLA 1QBNA 1YKTA 2J98A 1WUNH 3R69A 2C4FH 1WTHD 2JXOA 2SGQE 1KTTB 3OAAD 1BB0B 1WF8A 5JB9S 3RMOH 5A8YA 4LZ4B 1WHAA 1DANH 1QL9A 3ZV8A 3SNDA 1KXDA 2NU3E 3TU7H 2PUXB 2ZDNA 2ZIQH 3A83A 3K65B 4XE4A 1F0TA 3WKLA 3A81A 1Z8JB 4H11A 2BX4A 1C2DA 2OD3B 4ZHLU 2BDYA 2P93A 1EAIA 3RXAA 1W0YH 1EAWA 1P05A 4GVUA 4JYTA 1V5QA 1P10A 3WY8A 2CMYA 4UU5A 5EOKA 1C2HA 3EQ0H 4FXGH 8ESTE 1SLVB 1DE7H 3AXAA 2SNVA 2EJYA 4R8TB 5HFFA 1JBUH 1IU2A 1WYKA 3A8BA 2VJ1A 4LOYH 8KME2 2FX4A 2QXGA 5KECA 2FCFA 3EE0B 2ODPA 1GWAA 1P1DA 3U8TH 4FETA 1O5EH 3KZEA 3SQEE 2GDEH 1PDRA 1O3FA 3PM3A 4B6EA 2GCTB 3LJOA 1S81A 4NMPA 3S9BA 1YPGH 1TGSZ 1DOJA 4YLQH 4YESB 1XMNB 2WPJS 3UAIC 5HM9A 4Q80A 1VKYA 3BTGE 1P3CA 3HGPA 1TGTA 2RFKC 4Y7AA 3Q76A 1GBHA 1P03A 3WWFA 1E37B 1VCQA 3U98H 1C5TA 3QDZB 2ZO3H 3A8DA 5HFDA 1ZTLA 1EKBB 1EB1H 4JZDH 4O3UA 1SLWB 3QIKA 3ATMA 1TA6A 5E6PB 3EAJA 1CT0E 1E1RD 4DIIH 1EUFA 1L1NA 2BY9X 3KIDU 1MABB 2FI4E 2J97A 3W95A 2ZQ1A 1BRBE 1MCTA 2O8TA 1QJ1B 2UWLA 3T28A 3SZEA 3DSPA 2DAZA 3UWJH 1CBWB 1GJ5H 1UFXA 2C8WB 2PV9B 2H2ZA 5C20A 2VINA 2TGTA 3BTFE 4NA8A 1TOCB 2H9EH 4IC5A 1BTZA 4ISLA 4B2BA 3RXLA 1ZPCA 1OPHB 4BAHB 1GDUA 1P2KA 2D1JA 4WMFA 5FCRA 2PTCE 7GCHG 2VBCA 3KHFA 2FOFA 4OGYA 1C2MA 8LPRA 5DO4H 1BTYA 4OAJA 1FY1A 1F0UA 1LHFH 1EQ9A 1Z8IB 2Y7XA 4WH6A 2BDCA 4IN2A 4TWWA 1X9ZA 1WHDA 1IQFA 1PQAA 4X1RU 4Y11E 2RG3A 1THPB 4E35A 2XW9A 3GDSA 1A0HB 1VJ6A 5C1UA 2A7HA 1HUTH 3TNTA 2TBSA 1BTHH 1NBME 2AWWA 1ZR0A 3PDVA 1KXBA 1OBXA 4Q2NA 4JORA 5JDUB 3F9GA 1KIGH 1L4ZA 1ZPZA 4EDJA 2DC2A 3SORA 4D7FA 4ASHA 1VGCC 1UHPA 4ISOA 1BT7A 2BX3A 4CRCA 1RRKA 3E17A 1HV7A 1H8ED 3PTBA 2NU1E 2VWNA 1W9EA 4XBCA 1BMMH 3SFJA 4X0WU 1JXPA 4U01A 1HAHH 1O36A 2NU2E 4TWYA 3FZZA 3RXBA 2BY6X 2TGDA 4TYDA 4ABIA 3DIWA 4FUFA 4CBNA 1N7EA 4ZXXH 1QRZA 5JYIA 2B9LA 3P8OA 4Y8ZA 3GY7A 3RMLH 2BYAX 1A61H 1OWKA 2KAIA 1K1OA 3UTUH 3AW1A 4AGJA 1B0FA 4ZHMU 1S6FA 1MBMA 3OEED 3LNXA 1LKAA 2VIOA 1HAPH 2ZA5A 4BAKB 3U1IB 3V13A 1DWCH 2ZHQH 3N7OA 1W3CA 1X6DA 2ANWA 1A1RA 2EDPA 3BTKE 1S82A 1N99A 1WBGB 1GJBB 3K50A 1TWXB 5FBIA 4I86A 5DPAA 2EEJA 5GCHF 3ODDA 1EP5A 4DVAU 3LDXH 3MO6A 4FUIA 3SOEA 1F0RA 1BBRE 1BDAA 2ZCLP 5FAHA 4KTCA 3TSWA 4OEPA 1YLDA 3ZRTA 4A7IB 3PLKA 1QB9A 3A7WA 4OS4A 4X6PA 3EGGC 1UVOA 4X8UH 3A86A 4ABDA 1K0HA 1RGWA 2OQUA 5DSFA 1C1OA 2BTCE 2BLQA 2KOHA 2ZTXA 4MQAA 2FS9A 4A92A 2BXUH 1C1TA 4CH2B 3PMJA 3CBZA 2BQ7B 1WDIA 4KTUA 1RTFB 3ZZ5A 3SHAH 1AI8H 1Z1JA 1GQ5A 1OBZA 3GY2A 3KZDA 3M7UA 3VQFA 1S84A 2Q6DA 3ESTA 3UREA 4MVNA 1GBDA 1Q7XA 3E3TA 1D3QB 1NFXA 1O3LA 2OC7A 4PROA 3VQGA 3QO6A 1QAVA 1C9PA 3PTNA 4ABGA 1MTVA 1NESE 2F83A 1QBVH 1ETTH 4J1YA 3OX7U 2BD3A 5L6NH 5GLJA 2FLBH 3ID1A 2UWOA 2FEQH 1F5LA 4E7NA 1O33A 1P2JA 1V2TT 3LGIA 1LTOA 1DDJA 1O2NA 3RXUA 2FMJA 1C5NH 1VB7A 2R0KA 4NSVA 2QKUA 4NIYA 3DSGA 3Q3XA 4DT4A 2QGRA 1TBZH 1X5RA 2WYGA 1D9IA 4RI0A 1MCVA 2D8WA 1V2LT 5AFYH 3T26A 3NFLA 1BRUP 3V7TA 1VITF 4INHA 3PS4A 1A0LA 1GI6A 2KL1A 1J15A 2BVXH 1MTUA 1L1GA 2W26A 5FCKA 5EJZA 5F67A 4KGAA 5HEYA 1BMFD 1P2MA 2OUAA 3RXPA 1OP0A 5GIBA 2P16A 2WSSD 3G01A 2BDBA 5E2PA 5JB8S 1ZSLA 2FOMB 2QF3A 4CRGA 5EZ0A 1CT2E 3ATLA 5A8ZA 1R6JA 3ELAH 3JZ1B 2F3CE 2D90A 1P57B 5H3JA 1Z1IA 6CHAC 5E21A 1DXPA 4FVDA 3PV5A 4RN6A 5DJ7A 2Q1JA 3RU4T 1O3IA 1TNLA 2FZZA 1KLJH 1NC6A 1D6WA 1WV7H 4WH8A 1QGFA 3BSQA 2ZP0H 2FOAA 3RU4E 2FWWA 3RXGA 1AB9C 3FY5A 2YNBA 3F2HA 1TGNA 5GXPA 3DORA 4MPVA 1P3EA 3TGKE 1IOEA 2EXGA 4JOPA 1IQKA 5DG6A 2R3YA 6LPRA 1TQ0B 2PSXA 1EP6A 2WV5A 2CSJA 3OY5U 3M61U 2G5MB 1Y59T 2QV1A 1L0ZA 1ABIH 1TLDA 4GAWA 4NIWA 1RGQA 2WUBA 4JYUH 2KG2A 4DURA 1O3CA 4Q6SA 4BTUB 1H9HE 2A1DB 5C3NA 4UEHH 3UPEA 4BOHA 2BZAA 1AE8H 2CN0H 2ZF0H 1V2JT 1RIWC 2JETB 2HALA 1TX8A 1QTFA 1FN8A 1A7SA 2QIQA 3GCTG 1BQYA 4NMQA 4PQWA 1BTWA 5FPYA 5ILBA 3ID3A 2GEFA 1QB1A 4NMSA 4OM9A
chains in the Genus database with same CATH topology
4ABHA 2AGGX 1WQSA 5FXLA 1OWHA 2AH4X 2E7KA 1T7CA 2WPIS 1TPOA 4E06H 1IQNA 5HGGA 5EQRA 4X2YA 3UWIA 3P92A 4REYA 1VCPA 4ZKNU 2KAWA 2P8OC 3SNCA 4ISHH 4DCDA 2BY7X 3GY8A 1H1BA 1YYY1 3QGLA 2LPRA 2FI3E 2FOGA 4X2XA 2HE2A 2H3MA 2OLGA 4K78A 5A0CA 5I46H 1OWDA 2JIKA 5GDSH 2BD2A 2R9PA 1O3HA 5F6MA 3MOCA 2BLWA 3Q77A 1GJCB 1P9UA 3OTJE 1INCA 1CQQA 3M35A 3JXTA 5EG4A 2EDVA 1GJ8B 2XC4A 5G1EA 4IN1A 1SHYA 4UFFH 4CRDA 2EEHA 2ZC9H 4DJZB 4AG1A 1LDTT 1PPCE 4NMRA 4KELA 1C1VH 2XBYA 3QTOH 4XDEA 1QLCA 1V2ST 5CHAB 3K9XB 9LPRA 3PDZA 1P2NA 2PKSB 1NO9H 1EJMA 1AY6H 3F9HA 3KCGH 2H3LA 4E34A 1OWEA 3RC5A 1MZAA 2VSPA 4NFFA 1C2GA 1GMCF 4CR9A 1M5ZA 1TQ7B 1YC0A 1L1JA 2M10A 4KFVA 3EYDA 1L2EA 3M5NA 2XWAA 2QCYA 1WI4A 1TPAE 4YT6H 3SGAE 4O9VA 3SU1A 3QWCH 1THRH 1NU9A 1VAEA 4DIHH 3D65E 2KV8A 4YOIA 3MNXA 2OC1A 2Z3EA 1C2EA 5E2OA 1MTWA 2ASUB 2RRMA 3KL6A 3E1XB 3MYWA 2YT7A 4Q2PA 3MHWU 2Q9VA 1L4DA 1TYNA 3SU3A 2QAAA 3GSLA 3GY6A 2IWOA 1VZQH 1K1JA 3PLBA 4P2AB 4WYTA 3IG6B 2GCHG 2AMDA 3FZDA 4BAMB 2PGBB 1F7ZA 1FNIA 2HLCA 2PLXA 1HJ8A 1PPHE 1CHOF 1O3EA 3ZZAA 1XUGA 2G4UA 2RA3A 3F9EA 3RXKA 1YCPK 3LOXA 2P3UB 2ZPLA 1J9CH 2VIPA 1C1UH 2KJDA 1UTNA 2YOLA 3FAOA 1GJAB 2LC6A 1MKWK 4K69A 1ZUBA 4B2CA 2BYGA 4X6MA 3UIRA 4OS5A 2LA8A 5E11A 3T29A 2FS8A 3W94A 1DWDH 3BTME 1GHBG 1J14A 4Q2KA 3TH4H 4MDSA 3SU6A 3URDA 7LPRA 2EC9H 1KXEA 4B1TA 2ZHWH 1GHZA 5EXNA 1DLEA 1O2IA 2QYIA 5HEDA 2YTWA 3A89A 3RXEA 1D3TB 1CBWC 1FXYA 1ELEE 1UTKA 4B2AA 4HI3A 2BQ6B 2AIQA 1GHWH 1O3PB 4YZUA 1GDNA 1C2JA 1N7FA 5HFEA 2F91A 5EW2H 1HAIH 3MU1A 2JINA 2VVUA 3D62A 1CGIE 2PWXA 2A2QH 2PHBA 3BV9B 4FUGA 1WH1A 1SLUB 2F9BH 1V5LA 5LGOA 2QG1A 1DITH 1GMHG 2PNTA 2VGCB 2FODA 1KSNA 2KYLA 2DE9A 3PMHB 1AB9B 2ZGHA 2QF0A 1GDQA 1OP8A 1GBEA 4Q6HA 2AGEX 1O34A 1C5OH 2M0VA 1UMAH 2YUBA 2P94A 3LGUA 1O2WA 2ZGBH 2AYWA 3SV7A 2YUYA 1O35A 1AUTC 2OCVB 1GBTA 1TAWA 1TALA 3SO3A 4AMHA 2ZPSA 1WG6A 3NFKA 4OEOA 1FY3A 4Y7BA 5G4BA 3SUEA 1BFEA 1GHAF 1EOJA 1AO5A 1K1LA 3P6ZB 1DS2E 1GI9B 3CC0A 4LMMA 1O5CB 3TNSA 1C2LA 7KMEH 3UOUA 1W9QA 3NCLA 3SU0A 4DOQA 1O3KA 1O3OA 1QA0A 5L2YH 3TSZA 2A7CA 4WJG2 5HF1A 3E8LA 1P01A 3ZVFA 3O8BA 1TP5A 5DP4A