1SOTA

Crystal structure of the degs stress sensor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
312
structure length
283
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 283
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sotA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sotA02
2EHRA 2AYWA 2Q1JA 3MYWA 2GT8A 1C5XB 3BIUH 1Z1JA 4CHAB 2JKHA 2IWOA 1KLIH 4X6PA 5PTPA 3SJKA 1F2SE 4OS7A 4OGXA 4UFGH 1UO6A 2VU8E 2P3TB 4FVBA 2QKVA 3LJJA 1Z6JH 3O8CA 1WV7H 2ZTZA 1OSSA 4ISIH 2I6VA 2ZPLA 3PO1C 1ABJH 3F9EA 2BDHA 3RXEA 1H8IH 1GDQA 4UU6A 4AN7A 1JXPA 1BUIA 5AF9H 5HEYA 3SV9A 1HPGA 1V6BA 3LGWA 5EQQA 3BG8A 5EGMA 1D3PB 1GMDF 1NO9H 4JZ1A 4WMDA 2PZDA 2WPKS 4ZMAH 1KXAA 2VGCC 3ODDA 2RRMA 2ZPRA 3T26A 2OMJA 2P93A 1GBAA 4NMRA 3BV9B 1HAVA 4I8HA 5LPEA 2CS5A 1GHVH 4JZIA 6CHAB 2Y5GA 4J1YA 3S9AA 2AWXA 2R2WU 1V2KT 2LPRA 2HGAA 4F8KA 1XM1A 1KDQB 4KFVA 1S6HA 2G8TA 2PKSC 4KTSA 3VGCB 5LPFA 1HAIH 5GCHG 1Z6EA 3MWIU 3SQHE 5CMXH 4YDPA 1J16A 2Y82A 2PGQB 3GY2A 1F92A 1MFLA 2H5CA 3ATWA 3MNSA 5C20A 3K6ZA 2R4HA 4A5TS 1V2LT 1RGRA 1GHBG 1ZGIA 2F9PA 3TH2H 1HAGE 4D7GA 3K2UA 1SGIB 3F68H 1FAKH 1Y5UT 2BDBA 1FY4A 2V3HH 1KXEA 3QGNB 1VITG 4XBBA 1CGJE 4YOGA 4IMQA 4O97A 3RXDA 1RIWB 3VXFH 5E21A 1TQ0B 1GBHA 1NS3A 1UTMA 2B8OH 1FXYA 1NM6A 4ASHA 4FUBA 1HAOH 2ZFSA 1XUGA 2RCZA 3UIRA 4UU5A 2ZFFH 1WOFA 2ASUB 3BTDE 3VB3A 3JZ2B 1FN6A 4X6NA 1TNIA 3GYMA 1PQ7A 2ZNKH 1ZMLA 5HFBA 2QCYA 1SQAA 3BTFE 3E91A 1O3NA 1QIXB 1EZQA 2VVUA 2XCFA 4EDJA 1EAIA 1SQTA 3UTUH 4KP0A 1TGNA 1ZSKA 5F03A 5AFYH 1YPGH 1MUEB 1SC8U 2THFB 1N6DA 3MFJA 3MNBA 2ZU1A 1P11E 4BXSA 1EP5A 3P8GA 2I0LA 3ZZ5A 1MKWK 1ZTKA 1BB0B 1FNIA 3VEQB 5BRRE 1OP8A 2HPPH 8KME2 2YUBA 1GBIA 2G4UA 1O5BB 2ZU5A 5E1YA 2QKTA 2FLRH 5B6LA 3MH6A 2WPMS 3L3TA 2FOEA 3SV7A 4QT8C 4OEPA 1V2TT 3RXBA 1TYNA 3GJ9A 1AU8A 3TPIZ 5CHAB 2BY8X 2C4FH 2M0ZA 1C2JA 3EA8A 1VITF 2A7JA 3R68A 3QTVH 3L4FD 4MPAA 1T32A 1CT4E 4ZHLU 1YM0A 2FOGA 4CRGA 1X6DA 4H6TA 1S5SA 1TWXB 3HPMA 2JETB 3RC6A 3RXHA 5DO4H 1WU1A 2FXRA 4ZKOU 4YOJA 4A1XA 3CH8A 5J4QA 1TPAE 3MMGA 1HCGA 1W9OA 1OPHB 3F9HA 4UE7H 1GI4A 4DW2U 1IOEA 1YP9A 2VSPA 3SUFA 1U3BA 3B9FH 3ELAH 3LGTA 3RXAA 1GI5A 2FDAA 4PQWA 1FI8A 2TPIZ 4IC5A 4VGCB 1AGJA 2AMQA 1LVYA 2Z7FE 3IG6B 1VCPA 4NWKA 2BLVA 4FU9A 1P2IA 4K1TA 1O35A 2AGEX 4ZHAA 1HJ9A 2EA3A 3EE0B 2Q9VA 2P8OB 2ZU2A 2C8ZB 1SGNE 2B7DH 3GDSA 3FP8E 1SGPE 1V5QA 3BTQE 1W8BH 3JZ1B 1LO6A 4GAWA 1C1QA 1CE5A 1KXDA 2F9UA 4Q2KA 4TWWA 2G00A 2K1ZA 2G81E 4WY3A 1QL9A 3D49H 1SLWB 2QF0A 1GI7B 2W5EA 4NGAH 3F9GA 1Q3XA 4X1SU 1YPJH 1P57B 2OINA 1BTZA 3RXQA 1BTYA 4TWYA 1K28D 2EJYA 4GHNA 5G1EA 1TNKA 5GJ4B 2HWLB 1S6FA 1GJBB 1THPB 3TGIE 1TBRH 1UHPA 2JINA 2PKAB 3PTNA 4DVAU 4JOPA 4ISHH 3LH3A 1SGDE 2M0VA 1GMHF 1H4WA 2QT5A 2ZDKA 1A4WH 1HAXB 4MPUA 4XBCA 4K8BA 1JWTA 2M0UA 1G32B 2ZGXH 2VH0A 2WPHS 1RZXA 2ENOA 1RGQA 2GZ8A 3P8FA 4KTUA 2FM2A 3T25A 1MTNC 4IN1A 2KG2A 4XDEA 3E1XB 1YF4A 2IWPA 2CF9H 3KHVA 2D8IA 2D1JA 4DIHH 3GDVA 2Y7XA 3MO6A 1KXBA 1T31A 1XUFA 4YM9A 3GOVB 3ZV8A 4HTCH 2XXLA 1ETSH 1C5UA 4NA7A 1FV9A 1L2EA 1AD8H 1WUNH 2WV5A 1C2IA 1GL1A 3ZZ3A 2RCEA 3LOXA 1P05A 4ZKSU 4Z33A 1KXCA 4GUXA 4I8KA 3GDUA 1W9QA 1THRH 3F6UH 4OS1A 3I18A 3RXUA 1KIGH 5EODA 2H2CA 1ZHMA 4AORA 1NRNH 3PMJA 9ESTA 1ZRKA 3ZZ6A 1D6WA 4XFQA 4UD9H 2FE5A 1MAXA 3M5NA 1N7EA 3TITA 3LNYA 2GCHF 3STIA 5T6DA 2H6MA 4JYVH 3BEIB 1G2LA 2PV9B 2ZDAH 2D8WA 1BCUH 1RFNA 3P70B 4X1NU 3QE1A 1O2YA 3I29A 3E90B 1P0SH 4Q7ZA 4CHAC 2Z9GA 1P09A 2UZCA 4CREA 1QA7A 1SSXA 2VWMA 3ITIA 2QY0B 1CA0B 2PTNA 3RMNH 3U9AH 5GPIB 4CRFA 3RXRA 1CHOG 3AAVA 1YGCH 3VB7A 1NT1A 3EAJA 1SHHB 2CV3A 1QBOA 3JXTA 2WPIS 6ESTA 2VPHA 2H2BA 2C3SA 1O30A 5C1XA 2O8LA 3SOSA 5FPYA 1RXPA 5TCCA 3PS4A 1KEFA 3W94A 1LHCH 1RD3B 2OPGA 1T4UH 1P3CA 2JH0D 2P16A 2VJ1A 3NXPA 2DLUA 3MO9A 2F5YA 5HYOA 1C5TA 1EP6A 4BXWA 4JYTA 1DX5M 1ZJKA 1AFQB 2J2UA 1MBQA 3M7QA 4NMSA 1K1MA 5F8XA 1NFXA 2HLCA 1DANH 3ZZ8A 1FZZA 2OTVA 1FY5A 1HNEE 4NZQA 3MNXA 3VGCC 1TGSZ 1HIAB 2NU4E 1PPGE 2OD3B 2ZPSA 1A2CH 2TGDA 3IITA 3ODFA 3LNXA 1KSNA 1O2KA 3LH1A 3DHKH 3HGNA 3TJVA 5A0BA 1XKAC 1TNGA 1SOZA 5L2YH 3QZRA 4B1TA 1OXGA 3TNSA 2REYA 3SNBA 1CGIE 2BVRH 3LIWA 1B5GH 5HM2A 3SOEA 1P9UA 4HI3A 2KL1A 1WG6A 1O3LA 1LVOA 2ZWLH 4B73A 1XUJA 2FPZA 1TONA 3BTGE 1K2I1 4O9VA 1INCA 4K76A 5D13A 2VWOA 3V12A 1NRRH 2FO9A 3A89A 3PYHA 1GG6B 1SGCA 2ILNA 3CP7A 1TRYA 4DJZB 1NFYA 1AKSB 1BDAA 1UEZA 2OBOA 3KQDA 1GI9B 2H9TH 3A88A 4ABAA 5F67A 1E34B 3BTTE 2ZU3A 3IWMA 1FIWA 2CJIA 3SN8A 1N6EA 1QAUA 3URCA 4AFZA 1BA8B 2ODQA 1QRZA 4FUCA 1IQHA 4CRBA 1TALA 3SNDA 1A1RA 1DICA 2M0TA 1HDTH 1QJ1B 8ESTE 2AGIX 5JBBS 3GY4A 1MTSA 1C5VA 1UVSH 4YT7H 1XKBC 3I4WA 1GGDB 1TIOA 1NF3C 4K6YA 4Q3HA 3E3TA 3KQEA 5A8XA 4GHTA 3ZZCA 2PLXA 2BZAA 1F7ZA 5A2PA 2Z3CA 4FVDA 5CHAC 1FIZA 3AVZA 5E2PA 1BTHH 1BTXA 5C67A 1P12E 3GGEA 2FOBA 4Y8ZA 1O2VA 4BAOB 2BVXH 1UEQA 4X1RU 3U1IB 3LGVA 3NGHA 3PWCA 3QX5H 4X8UH 2VH6A 2ZGBH 4Q80A 4CH2B 1X8SA 5C1YA 3SUEA 1VCWA 2BD7A 1QGFA 1B0FA 4BOHA 1BHXF 2Y7ZA 3F9FA 1ANDA 3QJNA 3GCTG 3T29A 1ID5H 3SUZA 2ZCHP 1BRBE 1AVGH 2AH4X 2EGNA 1WI2A 1E35B 4VGCC 1DWDH 1D9IA 1C1SA 2IWNA 1SMFE 3TSVA 2MX6A 4A1TA 1TRMA 3KEEA 2H2ZA 1MCTA 5ABWA 1O3FA 2EAQA 1GJDB 4NXQA 1YPMH 1P2KA 3BG4B 1DS2E 4HOPA 1Z8IB 3BTHE 2WUCA 2VZ5A 3FAOA 3KF2A 2J34A 3GY7A 1GHWH 2ZQ2A 3FP6E 1V2JT 1N8OB 3BIVH 3T27A 2J95A 3SNAA 3NFKA 1ZTJA 3MNCA 5DJ7A 3RXMA 1JIRA 2AERH 2Z9LA 1GJ4H 2GDEH 1NROH 1AVXA 3F1SB 4HZHA 2BDAA 4JOHA 2ZFRH 3BTME 1O2NA 3SU0A 1C5WB 5K7RA 2W26A 1PQ8A 1SGTA 4MNWA 1FJSA 1IQLA 2DAZA 2DKRA 2VIDA 1QRWA 1CO7E 1QL8A 4ABIA 1ESAA 3M5OA 1P3EA 4U01A 1TOCB 4RKOB 3OY6U 1HRTH 3A8AA 2KPLA 5H4IB 1D3DB 1UTJA 2DE8A 2FLBH 1ANEA 1ELCA 1FPCH 4NMVA 1P9SA 1SI5H 2BQ6B 1P1EA 3STJA 4WYUA 3NUMA 2QYIA 4E3BA 2NU2E 2ZDMA 4Q2OA 1O0DH 2FZZA 4AG2A 1PPHE 1PPZA 1J14A 1P10A 3A80A 4NA8A 3SU5A 1C1UH 3TK5A 1EZXC 3L6PA 2DC2A 4OS5A 1BJVA 3BTKE 4UEHH 2EV8A 2H3LA 2ZP0H 1V2WT 1F0RA 1C2HA 5FAHA 2PGBB 1BT7A 2SGQE 4XOJA 9LPRA 3QWCH 2YT8A 4E7NA 3FFGA 2O8WA 3M35A 3ZVEA 5LH8A 4JOKA 1C5PA 1RJXB 2QV1A 2KAIA 3RL7A 1QBVH 1VJAU 1XUKA 1YYY1 3P6ZB 1GCTB 2A0QB 1TQ7B 5FBIA 2KV8A 1NFWA 2PHBA 5HM9A 3HPTB 2F9OA 5IYTA 2FTMA 3AASA 3SGAE 3W95A 5FCRA 2FOAA 2XC5A 2C90B 5K0HA 3SV8A 4GCHF 4P2AB 4WH8A 4K8YA 5EG4A 5FPTA 2QGRA 8GCHF 1O32A 1X5NA 5DGJA 2KOJA 2K20A 4I31A 2PNTA 1QA0A 5EZ0A 2ALPA 3ATKA 5C1UA 2BYGA 1A7SA 1O3OA 5GWZA 5G1DA 3GSLA 1C5RA 1GVZA 3SHCH 3A84A 1C5LH 5A2MH 1TRNA 2ZPMA 3A7WA 3QDZB 1O2XA 1Q2WA 3DIWA 3RXKA 4A1VA 1A5HA 2SGFE 8LPRA 1C9TA 2OCSA 3ID1A 1E38B 1TX7A 3A81A 1TE0A 3TJOA 3KIDU 2B9LA 2F0AA 1EASA 2BD2A 3T2NA 4K72A 3EYDA 3H5CB 5I46H 1P03A 4X6OA 1DSTA 4D7FA 1NC6A 3DD2H 5GNDA 5B6OA 1S85A 1NTEA 1SFQB 4CR9A 4D9RA 4NXPA 1J8AA 3K65B 3ATLA 4ABFA 1HJ8A 3ZV9A 1G3DA 1GHXH 4MNVA 1YCPH 3PWBA 1AFQC 2VB0A 1TB6H 2VRFA 2BLOA 1PPFE 5HGGA 4X8SH 3DT0H 2M10A 1PPEE 3VPKA 5L6NH 1V62A 5TCAA 1EAXA 1Y5BT 1OWHA 4Y10E 1GBJA 1OZIA 2FI5E 2R2MB 4RN6A 1P02A 1TA6A 3MI4A 4ZUHA 3UQOA 2Y81A 3LGUA 3MH5A 3DUXH 1QAVB 5JB8S 1P2OA 3QDOA 4R0IA 3GY6A 1SGEE 4I33A 4AMHA 4Y8XA 1KWAA 1NRQH 4JL7A 1QNJA 1BRAA 4U30A 2MHOA 1BTWA 1EPTB 2BQWB 2FYRA 1ZMNA 2OS6A 1WF8A 1TPOA 2ZI2H 4AFUA 3Q3XA 1WJLA 1EATA 1GVKB 5C3NA 1KDQA 1O2GH 3MU8A 4JORA 1EXFA 1TX6A 5FCKA 1QJ6B 2A32A 1QFKH 3GCOA 1UVUH 2OQUA 4JZFH 3TU7H 3OU0A 1HXEH 5FB8C 2OZFA 1H9LB 1G36A 2CHAB 1GI2A 2R9PA 3KGPA 1VCQA 3KQBA 2ZTYA 1BTPA 3B76A 3SV6A 4B2CA 1UF1A 1IQJA 1FY1A 2GZ9A 4WF8A 2ZQ1A 5AHGH 3RXJA 3UREA 5LGOA 2FEQH 2KJKA 1OBXA 2BLWA 1O5AB 5GIBA 3LC3A 4NA9H 2A4OA 1OWEA 1IHSH 3LONA 1UJVA 1Z71A 1WH1A 1TP3A 1E37B 3E17A 3S9CA 1C9PA 3H7TA 6GCHG 1CHGA 4ISNA 1GBCA 1Y59T 2OSGA 1SLXB 1K22H 5GCHF 1DXPA 3M37A 2GMTC 5BPEA 1JRTA 3RM2H 4BNRA 1WFVA 1LPGB 1TFXA 1CT0E 1GHBF 5HJ1A 1HAYB 4H11A 1GGDC 4H6SB 1UITA 1U38A 1EOJA 3SBKA 1C5NH 1K1IA 2V35A 1ARBA 2FOCA 5EQRA 4INKA 3TK6A 2C93B 5L30H 1D5GA 1C1VH 3RL8A 3CBZA 1Z86A 2HVXA 5I25A 1GI1A 1V2PT 4ISOA 1O33A 3AAUA 4NNLA 1UCYE 4BTTB 2OQSA 1Y3VA 2PA1A 2AMPA 3VQGA 2J94A 1S0QA 2FMJA 2QXIA 4NSVA 1GCDA 1P2QA 1W14U 1SFIA 4BAHB 2P3UB 1HFDA 1G3EA 1ETRH 4JOJA 1RGWA 4A7IB 3UNQA 1G37A 2SGEE 3ZVGA 2LOBA 2GCTB 1DE7H 1KYNA 1EB1H 1EUFA 2BXTH 1UEPA 2WINI 4K60A 4R2ZA 1OP2A 3NCLA 1KY9A 1IQKA 4LXBH 2QBWA 2FN5A 1HBTH 3QK1A 5DP3A 5F6MA 1B8QA 3MTYA 5E8EH 4AFSA 1ELFA 1UK3A 2F91A 3BG4C 3LU9B 1ORFA 2FX4A 3KQCA 3A7ZA 1C5YB 1Q3OA 5JDUB 3LPRA 4GHQA 1HJAC 1UHBA 3RXFA 2Z9KA 1TBQH 1LQDB 3DFJA 1KLTA 2QXGA 4IGDA 1YPLH 4X2WA 2ANMH 3D65E 2ZHWH 3PMBB 1QJ7B 1HB0B 1JBUH 1CA8B 2BQ7B 4F4OC 3RU4T 3RUOA 1O2QA 3QZQA 1QB6A 1OWIA 4N6XA 1Z7KA 2BD9A 1C5QA 2P3FH 1FC7A 4MQAA 3KHFA 3BN9A 5HFEA 2ALVA 1TGTA 4FUIA 4B2AA 3D23A 2VSVA 1CGHA 4K78A 1EJNA 6LPRA 2CF8H 1KTSB 1BBRE 2QIQA 1F0TA 5EW2H 1GVLA 1C4U2 5EU8A 4YLUA 3URDA 3FY5A 4I7YH 3EDXB 5EXNA 2OP9A 2C8YB 4K1SA 5DPAA 1O37A 1YCPK 4FUJA 1P06A 4RSPA 4DIIH 1V2NT 1V2UT 3NZIA 4LMMA 2ZFQH 2ESTE 2PKAA 4MPXA 4ABJA 4CRAA 2OQ5A 5E0JA 2AIPA 2VIVA 2BOHB 4XHVA 2BDGA 3HK6B 2QA9E 4FXGH 1F5RA 4MTBA 3UQVA 1GI3A 1THSH 2GP9B 3K82A 2AMDA 2Q6FA 3UOUA 1DY9A 1KXFA 1ZLRA 2ZU4A 4X2XA 4AYVB 4AX9H 4XSKU 1ZZZA 2F9VA 1O2PA 1ELAA 1C1NA 2Z3EA 2DJTA 2BY6X 3L33A 2ANYA 1WTGH 2O8TA 1GI0A 1A3EH 3RXPA 4THNH 2Q6GA 1G9IE 3MU0A 2OBQA 1ACBE 3RMMH 1Y7NA 1O34A 1T7CA 1WQSA 2LC7A 2HNTC 2VWLA 1FN8A 1J9CH 1BTUA 1DWBH 3VXEH 4AFQA 2A7HA 4AB8A 5HMAA 2UUFB 2BHGA 4Y76A 5EPNA 2ZHFH 1TQ3A 4JOGA 1DWCH 2BDYA 3DJ3A 1LTOA 2ZPQA 1O31A 4FUFA 2DLSA 2BX3A 1B7XB 1GHAG 2B0FA 3PV2A 2BYAX 1TABE 3QUMP 4F49A 4I8JA 2P3WA 1NU9A 3A82A 3RU4E 3ATMA 3AW1A 4MNXA 3ZZBA 3TK9A 3CS7A 3RP2A 7KMEH 4LZ4B 4FUGA 3SU3A 2L4SA 1UK4A 4GVUA 1SHYA 1QQ4A 5HF1A 4ZKNU 1N6FA 3H7OA 3ID2A 2VNTA 1GI8B 2ZKSA 4TY6A 2BLQA 3PV5A 1AHTH 1A61H 3BTWE 3SV2H 3M5LA 1O3GA 1AIXH 1G30B 4MLFB 3RXTA 2UWLA 5H3JA 2WYJA 1DUAA 1GBTA 2XNIA 1H9IE 4BANB 3O8BA 3LKWA 4AYYB 1O3BA 1TPSA 4U32A 2TRMA 4DOQA 2VIQA 5J4SA 1GBDA 4B76A 1G3BA 1VAEA 2G52A 1AB9B 2FI3E 2QXJA 2ZHEH 1I16A 1TGBA 1SPJA 2W7RA 2XWBI 2VIWA 4IBLH 3Q00A 3VB4A 5EW1H 2FWWA 2F9NA 6CHAC 4YZUA 3EA7A 1IHJA 4INHA 3ZZ9A 2Y5HA 4AB9A 1MZDA 2I04A 5F8TA 1W0YH 3TMHA 1DXWA 4WVPE 5C5OA 4IN2A 1L4ZA 1V2VT 1O3AA 3SJ8A 1UJDA 1V1TA 1T2MA 3ZZAA 2VGCB 2OUAA 3ID3A 1V2MT 3UWJH 1AZ8A 1GHAF 1A0LA 4ZAEA 3HPKA 2AWUA 2EC9H 4CBNA 4OEOA 2PR3A 5A0AE 1ZYOA 2WV4A 1ZHRA 1EPTC 2TGAA 4NCYA 2ZDVH 1P2JA 4NZLA 2FTLE 3LGIA 1UTLM 1OYQA 1O2LA 1D3TB 1CHOF 3SI4H 3A7YA 3FZDA 4UFEH 1HIAA 1ZSJA 3MU1A 1R6JA 1QLCA 1RIWC 2TGTA 2ZDNA 4GPGA 4DY7B 2ZTXA 1MBMA 1PQAA 3V13A 4RI0A 5LPRA 4NMOA 4B75A 1M5ZA 1GQ4A 3TGJE 2BTCE 5T6GA 4WH6A 3U98H 2ANWA 3R69A 3C27B 2GD4B 2SGPE 4JOFA 1RTLA 1OYTH 2G4TA 4O3TA 4FUDA 1QY6A 3MHWU 4CBOA 1S0RA 1O5CB 3A8CA 4NMTA 1L0ZA 1Z1IA 1O2WA 4DT7B 2OC0A 5HDYA 2QN5T 3P8OA 3HKIB 4P0CA 3VFEA 2Q6DA 4LOYH 2EDZA 1MQ6A 1EZSC 2FYQA 1C2LA 5EPYA 2P94A 2OGPA 5HFCA 1AKSA 3U69H 1W12U 2JREA 3PMAB 1TPPA 3GICB 1TMUH 3Q77A 4PROA 1O38A 1T8LA 1MTVA 4J2YB 4OS2A 2ANKH 4REYA 1UTKA 1GHZA 4ABBA 3RXLA 3O46A 4Y11E 2ZFTA 2QXHA 3OYPA 2G5MB 5FXLA 1WBGB 3E0NB 3SHWA 1ABIH 3GY3A 1UM7A 4XBDA 3VQFA 5EYZA 1FY3A 4DGJA 1BRUP 4MPVA 3S7KB 3QN7A 1U39A 2JETC 1BMAA 1GDNA 2LC6A 1DLKB 5ESTE 3BEFB 1C1PA 1X45A 1AMHA 2Y6TA 3SORA 1P2MA 4KTCA 2GTBA 1WSSH 2Z9JA 2GCTC 2SGAA 1ETTH 1O3EA 2O9QA 3DORA 1LKBA 3A87A 1LCYA 1IQIA 2ZIQH 3SGQE 1LPKB 2G51A 2YOLA 3K1RA 1GBLA 2SNVA 4Q7XA 2P8OC 2WPLS 4Y7BA 1DPOA 2G5VA 3HKJB 1C2DA 3ZVFA 5HF4A 3ZVDA 4Y0ZE 1ANCA 1NRPH 3UNRA 2VINA 1LVMA 2BVSH 4HFPB 2J9NA 1Z8GA 1O2ZA 2ODPA 2ZGCA 4TPIZ 1EJAA 3UOPA 1GBMA 1V6DA 3TVJB 3TJUA 1XZ9A 1AWHB 1FONA 1HXFH 2H9HA 2XBYA 3QTOH 2UUKB 3ZVAA 3VB6A 2KYLA 2ULLA 4A6LA 4UONA 3CYYA 2IWQA 2PKTA 1NY22 3E16B 1RRKA 4ESTE 1H1BA 4JOEA 1LPZB 2UWPA 3SNEA 1Y3XA 3I78A 3FP7E 3EGKH 4Q7YA 3BPUA 1GBEA 3BEUA 5DK1A 1UTOA 2CXVA 3GCTF 5E11A 1CBWB 1FPHH 1V2RT 1VJ6A 2D90A 1QB1A 2RA0A 2DB5A 5FX5A 1QR3E 2A5IA 4X2VA 2YNBA 2DUCA 1IQEA 1WIFA 2GV7A 3SW2B 1BQYA 1E36B 2QG1A 1EB2A 1EAWA 1LHGH 2FX6A 3M3SA 1MKWH 3D62A 1SB1H 1O2IA 4DG4A 3SJIA 2ZF0H 1XUIA 4OS6A 4K69A 1A0HB 5E2OA 2RDLA 1EAUA 4XE4A 3A86A 1K1LA 2WUBA 2W7SA 1BFEA 1C5ZB 1HGTH 1LVBA 2KAWA 3DJAA 2IN2A 3R0FA 3QIKA 5HEBA 2STBE 5HETA 4Q2PA 1TGCA 3PTBA 1M9UA 3GY8A 1ZPZA 1JIMA 1TX8A 5EOKA 3A85A 4WYTA 4H4FA 3CS0A 2ZCLP 2PUXB 2LNCA 1TAWA 4CRDA 3KN2A 1C2MA 4K5ZA 2BX4A 1I92A 2PKUA 2DMZA 1LHEH 7LPRA 1AY6H 1RS0A 1WI4A 1ZRBA 2FCFA 3KCGH 3OTPA 2ZEBA 4TY7A 4WMEA 4OS4A 1GJ9B 1MU6B 4UFDH 1BMNH 2ZGHA 1Z8RA 4JK6A 1H8DH 1W13U 5A09A 2SGDE 2FOHA 2XC4A 3A8DA 1Q3PA 1SVPA 3MH7A 3U1JB 4D9QA 3E8LA 3SQEE 4IC6A 1TNLA 2BY7X 2QAAA 4BTIB 1AE5A 3HATH 4NIYA 3SI3H 2CSJA 2Y80A 1CQQA 1GJAB 2XYAA 3P8NA 1YPHC 2A1DB 1O3MA 1LKAA 2ZGJA 2Z17A 1YLDA 4JK5A 2PFEA 5AFZH 2CGAA 1CA0C 3LC5A 1ZSLA 2A2QH 1O2TA 1UMAH 1GHYH 3U8TH 3ENSB 5I7ZA 2EI8A 1BOQA 3T28A 5FBEA 1V2ST 1BZXE 4Y7AA 3BTEE 4LZ1H 3S0NA 4L8NA 1GI6A 1ZUBA 4CR5A 1CT2E 1VB7A 4NIWA 1Z87A 3RXCA 4GLYA 4X8TH 3HVQC 1T8NA 5EQSA 2JH6D 1SGFA 4X1PU 4AGKA 3NWUA 1OX1A 1S84A 1E0FD 2H5DA 3CBXA 4UDWH 3UY9A 1O3IA 4FUHA 1HAVB 4IMZA 1AB9C 3CENA 4E34A 3TSZA 1K1OA 1AN1E 4NWLA 1LHDH 5ESBA 3ZZDA 1PYTD 1K32A 2J92A 3ZVCA 3K6YA 3DA9B 1VGCB 1GJ7B 3LT3A 4D8NA 3I1EA 5GLJA 2AS9A 4JYUH 1O2HA 3S9BA 1X7AC 3KZDA 1XX9A 4O06A 3V3MA 2A4QA 2W7UA 1XXDA 2HALA 5CE1A 2KPKA 2AEIH 1VZQH 4Q6HA 4ZXXH 2OLGA 3SO3A 2IOTA 1O5DH 4U2WA 2M5TA 3A83A 1DSUA 2BDCA 4SGAE 4I32A 3M61U 1MFGA 3UNSA 1XVOA 3UPEA 2GZVA 1N7TA 1NTPA 3OSYA 3SU1A 2NWNA 2L97A 1N7FA 3TNTA 3T5FH 3SJ9A 1KLJH 1WCZA 1PPCE 1W0ZU 1K9OE 4WXVA 4WJG2 1C4Y2 3PM3A 3ESTA 1K1PA 1AZZA 3QLPH 1GG6C 1AUJA 1N1LA 3QGLA 1DWEH 5A8ZA 1QAVA 1EX3A 2GGVB 5EXLA 2EI7A 1F5KU 2NU3E 4Z0KA 5IDKA 1O2SA 4FU8A 4Q6SA 2BD4A 1AUTC 1EPTA 1TNHA 5T3HA 2FS8A 1ELTA 1ZTLA 4NNMA 1F5LA 1ELGA 1BITA 4AOQA 1V5LA 2JIKA 1WHAA 1W9EA 3A7XA 1A5IA 1YPKH 3CBYA 3GY5A 3S7HB 4ZKRU 2BXUH 3PB1E 2GZ7A 2FP7B 3OX7U 2YT7A 2G2LA 1T8OA 1AWFH 2ZCKP 4K1EA 4ZH8A 1Q7XA 1MCVA 1Q31A 1XUHA 4B71A 2KA9A 4MDSA 2EXGA 3QJMA 2L4TA 1SGFG 1Y3YA 2BB4A 5HFFA 4KFWA 1GQ5A 2OC8A 1YC0A 1UFXA 1ZR0A 2FESH 4GSOA 4I8LA 5E0HA 2I6QA 4Q2NA 1T8MA 1EZUC 1IU2A 3A8BA 4FUEA 1F0UA 3UR9A 1SLVB 2PW8H 7GCHG 2I1NA 2VVVA 4WWYA 1O5GH 2PSXA 1LMWB 2C8XB 1C2FA 2KRGA 3A7VA 4ZHMU 5SGAE 4NXRA 1P2NA 2AGGX 2UUJB 3SGBE 3SU4A 3P92A 2BOKA 1SGQE 2ZECA 4YOIA 2G5NA 1DM4B 2UUYA 1ZJDA 4G69A 2Z3DA 1ELEE 1TMTH 1UTQA 3RXGA 2H1UA 1EOLA 2HNTF 1WTHD 2QKUA 2EGOA 1O3JA 3GCHB 4JCNA 2OC1A 1C4V2 4Z6AH 1BE9A 1EQ9A 2HRVA 1XVMA 4WMFA 1NESE 1HYLA 2E7KA 1RTKA 3O8DA 4Y71A 6GCHF 1L1JA 5DP8A 1O2RA 3P17H 1GMHG 2LA8A 2VWNA 4TPYA 3HK3B 1QRXA 1ARCA 1PPBH 1ZOMA 5AVDA 1O3PB 1IQGA 1UHBB 1DVAH 2HGTH 4K75A 1GMCG 3KNXA 2A5KA 1DUEA 1N8OC 3MOCA 3E0PB 2R3UA 4JMYA 4KKDA 1UTPA 3ZYDA 2JH5D 7GCHF 5JBAS 1FMGA 3PLPA 3RXOA 2OXSA 1C2EA 4E7RG 3K50A 2AINA 2FI4E 1C1MA 1O3DA 1QTFA 4B2BA 3RM0H 3Q3KA 2W3KA 3DJ1A 1V2OT 5DP9A 1DDJA 2ZHQH 2ZG0H 3U8RH 1TP5A 1MD7A 2ZZUH 1C5SA 2HE2A 3UUZA 5HXFA 1GL0E 2BZ6H 4X0WU 5DP5A 3ZRTA 1NN6A 3MU5A 1CU1A 3FVFB 3NK8A 1O2JA 4YTAA 1OP0A 2TBSA 4HGCA 1AI8H 1CBWC 1TNJA 2FIRH 1LHFH 1BIOA 1MH0A 1MU8B 4KGAA 1SQOA 1BMLA 1MC7A 1ESBA 2VIOA 3EGHC 1Y3WA 1SGRE 1ELDE 2TIOA 1WYKA 3M5MA 2BD5A 2GCHG 2OCVB 4CRCA 1FC6A 2BM2A 3MH4A 1WAYB 2D26C 4ABEA 2BMGB 2WYGA 1EJMA 1BRCE 1TOMH 2Z9IA 1GMCF 3G01A 2W3IA 2GT7A 1A0JA 3TIUA 5JXBA 1DITH 2HNTE 3SZNA 1TA2A 1MAYA 1V3XA 1S83A 3AW0A 3PDVA 1W2KH 2FNEA 2JOAA 3M36A 2DM8A 1NFUA 4BAQB 2GKVE 2FOFA 1J15A 3O8RA 1JMOH 4YLQH 1VJ9U 1X5RA 3PMHB 3U8OH 1GCTC 3GISB 1WFGA 1OS8A 2ZHDA 2KOMA 5FHTA 2DE9A 2STAE 3RXSA 1WQVH 1ELVA 1OBYA 2F3CE 3ZYEA 3QGJA 5FX6A 1DFPA 1YBWA 3E6PH 2J38A 2H9EH 1C5OH 1WF7A 2A45B 2V3OH 1UK2A 3RXIA 3TJNA 5JBCS 1P1DA 2I4SA 2KQFA 3UWIA 2A2XH 2HPQH 1BHXB 1QBNA 2M3MA 5E22A 2HOBA 3HGPA 1GPZA 1TBZH 1MKXH 4YESB 5DP7A 3MO3A 1UCYH 2BD8A 2OC7A 2CSSA 4ISLA 1FLEE 1GJCB 2V1WA 2V0BA 1A46H 2IJOB 1FQ3A 3ATIA 1W10U 1YCPM 1G9OA 2EDVA 1JRSA 2VWRA 1OWDA 2P95A 4K2YA 5JYIA 1FUJA 2IPHA 2A7CA 4NMPA 1L4DA 3ZZ7A 2VIPA 5L2ZH 3PO1B 1MTUA 2F9BH 5TJXA 1ZOKA 1C2GA 4GVDA 1DT2A 3TSWA 1TMBH 3SU2A 1QQUA 3LJOA 2V6NA 4Q2QA 3PV4A 4Y6DA 2XC0A 4I8GA 1AFEH 1W11U 1W3CA 2R0KA 3MU4A 2AWWA 2SFAA 1BMMH 1AE8H 1VGCC 3Q76A 4DURA 1GDUA 1NRSH 1UJ1A 4ABGA 1OKXA 1ZHPA 1SR5C 2PTCE 4KELA 1UEWA 4GVCA 2QC2A 3I77A 2K1QA 1C1OA 3RC4A 3B8JA 2AIQA 1AO5A 2XBWA 2A31A 1VA8A 1YBOA 5DP6A 1GJ5H 4Z8JA 2XW9A 1OOKB 3RLYH 3K9XB 4Y79A 1J17T 1GBBA 4FU7A 1JOUB 1YPEH 3EA9A 2PKSB 4MPWA 1W7XH 2XBVA 1GM1A 5T6FA 4OGYA 3SU6A 1MZAA 2H3MA 2YTWA 3TLOA 2LUIA 1NZQH 3RC5A 3RLWH 3M7TA 4IS5A 3RDZA 1O3CA 3ZZ4A 4E05H 2BY5X 1SL3A 1BBRH 1C1WH 1FDPA 1PYTC 4ABDA 3ID4A 3S69A 2BD3A 2ZA5A 5JBTA 3EQ0H 5DG6A 5JB9S 2Z94A 2CHAC 1GJ8B 1MD8A 2CMYA 1UVOA 5FPSA 1VITH 2RG3A 1C1TA 1K1NA 5EXMA 4O03A 1OWKA 5C2ZA 1N99A 2KOHA 4TYDA 1BJUA 1W7GH 2KBSA 3SHUA 1Z8JB 1QL7A 1T4VH 2FODA 2ODYB 3QO6A 5F8ZA 5GXPA 1CSOE 5HEDA 4AG1A 3NFLA 2Z6BD 2BDIA 1O3HA 1IAUA 2O8UA 4E35A 2SNWA 2FS9A 3TH4H 1DLEA 4M7GA 3VB5A 2XRCA 3R0HA 4X2YA 1QURH 2BY9X 3LDXH 5A0CA 3B23B 3EGGC 1GBFA 3RLEA 4NFFA 1SOTA 4YT6H 2W4FA 2XTTB 2UWOA 3OTJE 4E06H 2FOMB 2J4IA 1QCPA 2R0LA 1ZMJA 3KZEA 3M7UA 2HE4A 1C5MD 1O36A 1S82A 2EEKA 2ZC9H 1MTWA 1N6YA 4A92A 1X5QA 2GMTB 2A4RA 1F0SA 2GX4A 3PLBA 5HFDA 3A7TA 3FZZA 3N7OA 4YYXA 3KL6A 1KTTB 2AFQB 2PSYA 1ZGVA 1UM1A 1YLCA 1WHDA 1ZPCA 4ABHA 1OWJA 1Y8TA 1HUTH 3GYLB 3P95A 2EDPA 2NU0E 3CC0A 3SUDA 1CVWH 2GV6A 4BAKB 4CH8B 4AZ2B 2D92A 2WPJS 3SNCA 3WY8A 3WKLA 3RXVA 1D3QB 3GCHC 1IHTH 3SFJA 4NMQA 2KJDA 4MNYA 5C5NA 3RMLH 3SUGA 1PDRA 1NU7B 1LQEA 2A5AA 4NSYA 1O5FH 4UFFH 1K1JA 4OAJA 5DP4A 5G4BA 1IU0A 1K21H 4HOPB 1P8VC 7ESTE 4SGBE 4INLA 1L1GA 2G55A 1L6OA 1U37A 2B5TB 1C2KA 2YUYA 4LK4A 1SGYE 2ZFPH 4X8VH 1IQFA 2RA3A 1XMNB 3T62A 1MKXK 1O39A 4NIVA 1C1RA 4K3JA 2KJPA 1ELBA 2I6SA 2YNAA 1MMJN 1UCYK 2D2DA 4Y0YE 1S81A 2XBXA 1QB9A 1FCFA 1SLUB 1PFXC 1DY8A 1ZPBA 3BSQA 1O2UA 2F83A 2ZO3H 2EEJA 4H42U 4Y8YA 4MVNA 1VR1H 2CN0H 3SJOA 1HJAB 5A8YA 2JXOA 2X7ZA 1UTNA 1RY4A 1U6QA 3TH3H 4YO9A 1GWAA 1D4PB 2XWAA 4WXIA 2Y5FA 1O5EH 3ZVBA 1UVPA 2P59A 3UFAA 3NPSA 1UJUA 3DFLA 2EEIA 1OBZA 4ZROA 1Y5AT 2GVFA 1G2MA 1FY8E 3PROA 4D76A 4BAMB 4FGMA 2EI6A 1O2OA 5GDSH 2EEHA 5JPMH 1ANBA 3FANA 1H9HE 3WKMA 1A5GH 1HAZB 3M3VA 3V7TA 2XCNA 4GCHG 2EEGA 2EGKA 8GCHG 1DOJA 1QHRB 4DCDA 5E0GA 4O3UA 1AVWA 3C1KA 2PWXA 1RTFB 1MTNB 4X6MA 3UR6A 2JWEA 1O3KA 1V2QT 2JILA 1MQ5A 1AQ7A 3NKKA 4ZXYH 1HV7A 2ZDLA 1P01A 5DKMA 1YKTA 3RMOH 2Q3GA 1GJ6A 3TGKE 1PQ5A 4NFEA 1HAHH 2GDDA 1PJPA 1ESTA 1G3CA 2KAIB 4MG3A 4X1QU 1Y3UA 1EKBB 2PDZA 1N6XA 1FC9A 1SG8B 1YPHE 2VVCA 1BBRK 4NG9H 4NIXA 2NU1E 1A3BH 2WL7A 4RKJB 5DTHA 4R8TB 5ETXA 2I0IA 2O8MA 3SHAH 3R3GB 1GMDG 3V0XA 1UVTH 3O5NA 1TLDA 1LDTT 4B74A 3GCNA 1D6RA 5E6PB 3LGYA 1XXFA 4AGJA 2TGPZ 2V90A 3M3TA 1HAPH 3PDZA 1GBKA 3Q3YA 4BTUB 3AXAA 1B0EA 1L1NA 1HLTH 5F3XA 1IQNA 3RU4D 1O2MA 1FAXA 3OY5U 3PLKA 4JZDH 1NPMA 1SBWA 2QF3A 2C8WB 4IW4E 2PUQH 1P04A 2A4GA 3BF6H 2O2TA 1IQMA 2R3YA 4JZEH
chains in the Genus database with same CATH superfamily
2EHRA 2AYWA 2Q1JA 3MYWA 2GT8A 1C5XB 3BIUH 1Z1JA 4CHAB 2JKHA 2IWOA 1KLIH 4X6PA 5PTPA 3SJKA 1F2SE 4OS7A 4OGXA 4UFGH 1UO6A 2VU8E 2P3TB 4FVBA 2QKVA 3LJJA 1Z6JH 3O8CA 1VKYA 1WV7H 2ZTZA 1OSSA 4ISIH 2I6VA 2ZPLA 3PO1C 1ABJH 3F9EA 2BDHA 3RXEA 1H8IH 1GDQA 4UU6A 4AN7A 1JXPA 1BUIA 5AF9H 5HEYA 3SV9A 1HPGA 1V6BA 3LGWA 5EQQA 3BG8A 5EGMA 3N7DA 1D3PB 1GMDF 1NO9H 4JZ1A 4WMDA 2PZDA 2J97A 2WPKS 4ZMAH 1KXAA 2VGCC 3ODDA 2RRMA 2ZPRA 3T26A 2OMJA 2P93A 1GBAA 4NMRA 3BV9B 1HAVA 4I8HA 5LPEA 2CS5A 1GHVH 4JZIA 6CHAB 2Y5GA 4J1YA 3S9AA 2AWXA 3N99A 2R2WU 1V2KT 2LPRA 2HGAA 4F8KA 1XM1A 1KDQB 4KFVA 1S6HA 2G8TA 2PKSC 4KTSA 3VGCB 5LPFA 1HAIH 5GCHG 1Z6EA 3MWIU 3SQHE 5CMXH 4YDPA 1J16A 2Y82A 1EFRD 2PGQB 4B6FA 3GY2A 1F92A 1MFLA 2H5CA 3ATWA 3MNSA 5C20A 3K6ZA 2R4HA 4A5TS 1V2LT 1RGRA 1GHBG 1ZGIA 2F9PA 3TH2H 1HAGE 4D7GA 3K2UA 1SGIB 3F68H 1FAKH 1Y5UT 2BDBA 1FY4A 1QZ8A 2V3HH 1KXEA 3QGNB 1VITG 4XBBA 1CGJE 4YOGA 4IMQA 4O97A 3RXDA 1RIWB 3VXFH 5E21A 1TQ0B 1GBHA 1NS3A 1UTMA 2B8OH 1FXYA 1NM6A 4ASHA 4FUBA 1HAOH 2ZFSA 1XUGA 2RCZA 3UIRA 4UU5A 2ZFFH 1WOFA 2ASUB 3BTDE 3VB3A 3JZ2B 1FN6A 4X6NA 1TNIA 3GYMA 1PQ7A 2WPDD 2ZNKH 1ZMLA 5HFBA 2QCYA 1SQAA 3BTFE 3E91A 1O3NA 1QIXB 1EZQA 2VVUA 2XCFA 4EDJA 1EAIA 1SQTA 3UTUH 4KP0A 1TGNA 1ZSKA 5F03A 5AFYH 1YPGH 1MUEB 1SC8U 2THFB 1N6DA 3MFJA 3MNBA 2ZU1A 1P11E 4BXSA 1EP5A 3P8GA 2I0LA 3ZZ5A 1MKWK 1ZTKA 1BB0B 1FNIA 3VEQB 5BRRE 1OP8A 2HPPH 8KME2 2YUBA 1GBIA 2G4UA 1O5BB 2ZU5A 5E1YA 2QKTA 2FLRH 5B6LA 3MH6A 2WPMS 3L3TA 2FOEA 3SV7A 1X9ZA 4QT8C 4OEPA 1V2TT 3RXBA 1TYNA 3GJ9A 5EIYA 1AU8A 3TPIZ 5CHAB 2BY8X 2C4FH 2M0ZA 1C2JA 3EA8A 1VITF 2A7JA 3R68A 3QTVH 3L4FD 4MPAA 2XOKD 1T32A 1CT4E 4ZHLU 2F4LA 1YM0A 2FOGA 4CRGA 1X6DA 4H6TA 1S5SA 1TWXB 3HPMA 2JETB 3RC6A 4JJ3A 3RXHA 5DO4H 1WU1A 2FXRA 4ZKOU 4YOJA 4A1XA 3CH8A 5J4QA 1TPAE 3MMGA 1HCGA 1W9OA 1OPHB 3F9HA 4UE7H 1GI4A 4DW2U 1IOEA 1YP9A 2VSPA 3SUFA 1U3BA 3B9FH 3ELAH 3LGTA 3RXAA 1GI5A 2FDAA 4PQWA 1FI8A 2TPIZ 4IC5A 4VGCB 1AGJA 2AMQA 5EJZA 1LVYA 2Z7FE 3IG6B 1VCPA 4NWKA 2BLVA 2OK5A 4FU9A 1P2IA 4K1TA 1O35A 2AGEX 4Z1MD 4ZHAA 1HJ9A 2EA3A 3EE0B 2Q9VA 2P8OB 2KZ4A 2ZU2A 2C8ZB 1SGNE 2B7DH 3GDSA 3FP8E 1SGPE 1V5QA 3BTQE 2EQNA 1W8BH 3JZ1B 1LO6A 4GAWA 1C1QA 1CE5A 1KXDA 2F9UA 4Q2KA 4TWWA 2G00A 2WSSD 2K1ZA 2G81E 4WY3A 1QL9A 3D49H 1SLWB 2QF0A 1GI7B 2W5EA 4NGAH 3F9GA 1Q3XA 4X1SU 1YPJH 1P57B 2OINA 1BTZA 3RXQA 1BTYA 4TWYA 1K28D 2EJYA 4GHNA 5G1EA 1TNKA 5GJ4B 2HWLB 1S6FA 1GJBB 1THPB 3TGIE 1TBRH 1UHPA 2JINA 2PKAB 3PTNA 4DVAU 2KCAA 4JOPA 4ISHH 3LH3A 1SGDE 2M0VA 1GMHF 1H4WA 2QT5A 2ZDKA 1A4WH 1HAXB 4MPUA 4XBCA 4K8BA 1JWTA 2M0UA 1G32B 2ZGXH 2VH0A 2WPHS 1RZXA 4TSFD 2ENOA 1RGQA 2GZ8A 3P8FA 4KTUA 2FM2A 3T25A 1MTNC 4IN1A 2KG2A 4XDEA 3E1XB 1YF4A 2IWPA 2CF9H 3KHVA 2D8IA 2D1JA 4DIHH 3GDVA 2Y7XA 3MO6A 1KXBA 1T31A 1XUFA 4YM9A 3GOVB 3NRLA 3ZV8A 4HTCH 2XXLA 1ETSH 1C5UA 4NA7A 1FV9A 1L2EA 1AD8H 1WUNH 2WV5A 1C2IA 1GL1A 3ZZ3A 2RCEA 3LOXA 1P05A 3KYFA 4Z33A 1KXCA 4GUXA 4I8KA 4ZKSU 3GDUA 1W9QA 1THRH 3F6UH 4OS1A 2GEFA 3I18A 3RXUA 1KIGH 5EODA 2H2CA 1ZHMA 4AORA 1NRNH 3PMJA 9ESTA 1ZRKA 3ZZ6A 1D6WA 4XFQA 4UD9H 2FE5A 1MAXA 3M5NA 1N7EA 3TITA 3LNYA 2GCHF 3STIA 5T6DA 2H6MA 4JYVH 3BEIB 1G2LA 2PV9B 2ZDAH 2D8WA 1BCUH 1RFNA 3P70B 4X1NU 3QE1A 1O2YA 3I29A 3E90B 1P0SH 4Q7ZA 4CHAC 2Z9GA 1P09A 2UZCA 4CREA 1QA7A 1SSXA 2VWMA 3ITIA 2QY0B 1CA0B 2PTNA 3RMNH 3U9AH 5GPIB 4CRFA 3RXRA 1CHOG 3AAVA 1YGCH 3VB7A 1NT1A 3EAJA 1SHHB 2CV3A 1QBOA 3JXTA 2WPIS 6ESTA 2VPHA 2H2BA 2C3SA 1O30A 5C1XA 2O8LA 3SOSA 5FPYA 1RXPA 3PRBA 5TCCA 3PS4A 3GABA 1KEFA 3W94A 1LHCH 1RD3B 2OPGA 1T4UH 1P3CA 2JH0D 2P16A 2VJ1A 3NXPA 2DLUA 3MO9A 2F5YA 5HYOA 1C5TA 1EP6A 4BXWA 4JYTA 1DX5M 1ZJKA 1AFQB 2J2UA 1MBQA 3M7QA 4NMSA 1K1MA 5F8XA 1NFXA 2HLCA 1DANH 3ZZ8A 1FZZA 2OTVA 2JSNA 1FY5A 1HNEE 4NZQA 3MNXA 3VGCC 1TGSZ 1HIAB 2NU4E 1PPGE 2OD3B 2ZPSA 1A2CH 2TGDA 3IITA 3ODFA 3LNXA 1KSNA 1O2KA 3LH1A 3DHKH 3HGNA 3TJVA 5A0BA 1XKAC 1TNGA 1SOZA 5L2YH 3QZRA 4B1TA 1OXGA 3TNSA 2REYA 3SNBA 1CGIE 2BVRH 3LIWA 1B5GH 5HM2A 3SOEA 1P9UA 4HI3A 2KL1A 1WG6A 1O3LA 1LVOA 2ZWLH 4B73A 1XUJA 2FPZA 1TONA 3BTGE 1K2I1 4O9VA 1INCA 4K76A 5D13A 3DSPA 2VWOA 3V12A 1NRRH 2FO9A 3A89A 3PYHA 1GG6B 1SGCA 2ILNA 3CP7A 1TRYA 4XD7D 4DJZB 1NFYA 1AKSB 1BDAA 3FO8D 1UEZA 2OBOA 3KQDA 1GI9B 2H9TH 3A88A 4ABAA 5F67A 1E34B 3BTTE 2ZU3A 3IWMA 1FIWA 2CJIA 3SN8A 1N6EA 1QAUA 3URCA 4AFZA 1BA8B 2ODQA 1QRZA 4FUCA 1IQHA 4CRBA 1TALA 3SNDA 5B42A 1A1RA 1DICA 2M0TA 1HDTH 1QJ1B 8ESTE 2AGIX 5JBBS 3GY4A 1MTSA 1C5VA 1UVSH 5F53A 4YT7H 1XKBC 3I4WA 1GGDB 5CHBA 1TIOA 1NF3C 4K6YA 4Q3HA 3E3TA 1SKYE 3KQEA 5A8XA 4GHTA 3ZZCA 2PLXA 2BZAA 2KFWA 1F7ZA 5A2PA 2Z3CA 4FVDA 5CHAC 1FIZA 3AVZA 5E2PA 1BTHH 1BTXA 5C67A 1P12E 3GGEA 2GJGA 2FOBA 4Y8ZA 1O2VA 4BAOB 2BVXH 1UEQA 4X1RU 3U1IB 3LGVA 3NGHA 3PWCA 3QX5H 4X8UH 2VH6A 2ZGBH 4Q80A 4CH2B 1X8SA 5C1YA 3SUEA 1VCWA 2BD7A 1QGFA 1B0FA 4BOHA 1BHXF 2Y7ZA 2YMSB 3F9FA 1ANDA 3QJNA 3GCTG 3T29A 3DSGA 1ID5H 3SUZA 2ZCHP 1BRBE 1AVGH 2AH4X 2EGNA 1WI2A 1E35B 4VGCC 1DWDH 1D9IA 1C1SA 2IWNA 1SMFE 3TSVA 2MX6A 4A1TA 1TRMA 3KEEA 2H2ZA 1MCTA 5ABWA 1O3FA 2EAQA 1GJDB 4NXQA 1YPMH 1P2KA 3BG4B 1DS2E 4HOPA 1Z8IB 3BTHE 2WUCA 2VZ5A 3FAOA 3KF2A 2J34A 3GY7A 1GHWH 2ZQ2A 3FP6E 1V2JT 1N8OB 3BIVH 3T27A 2J95A 3SNAA 3NFKA 1ZTJA 3MNCA 5DJ7A 3RXMA 1JIRA 2AERH 2Z9LA 1GJ4H 2GDEH 1NROH 1AVXA 3F1SB 4HZHA 2EY4C 2BDAA 4JOHA 2ZFRH 3BTME 1O2NA 3SU0A 1C5WB 5K7RA 2W26A 1PQ8A 1SGTA 4MNWA 1FJSA 1IQLA 2DAZA 2DKRA 2VIDA 1QRWA 1CO7E 1QL8A 4ABIA 1ESAA 3M5OA 1P3EA 4U01A 1TOCB 4RKOB 3OY6U 1HRTH 3A8AA 3GS9A 2KPLA 5H4IB 1D3DB 1UTJA 2DE8A 2FLBH 1ANEA 1ELCA 1FPCH 2KX4A 4NMVA 1P9SA 1SI5H 3KYGA 2BQ6B 1P1EA 3STJA 4WYUA 3NUMA 2QYIA 4E3BA 2NU2E 2ZDMA 4Q2OA 1O0DH 2FZZA 4AG2A 1PPHE 1PPZA 1J14A 1P10A 3A80A 4NA8A 3SU5A 1C1UH 3TK5A 1EZXC 3L6PA 2DC2A 4OS5A 1BJVA 3BTKE 3F2GA 4UEHH 2EV8A 2H3LA 4RT0A 2ZP0H 1V2WT 3FOAA 1F0RA 1C2HA 5FAHA 2PGBB 1BT7A 2K8IA 2SGQE 4XOJA 9LPRA 1H8ED 3QWCH 2YT8A 4E7NA 3FFGA 2O8WA 3M35A 3ZVEA 5LH8A 4JOKA 1C5PA 1RJXB 2F43B 2QV1A 2KAIA 3RL7A 1QBVH 1VJAU 1XUKA 1YYY1 3P6ZB 1GCTB 2A0QB 1TQ7B 5FBIA 2KV8A 1NFWA 2PHBA 5HM9A 3HPTB 2F9OA 5IYTA 2FTMA 3AASA 3SGAE 3W95A 5FCRA 2FOAA 2XC5A 2C90B 5K0HA 3SV8A 4GCHF 4P2AB 4WH8A 4K8YA 5EG4A 5FPTA 2QGRA 8GCHF 1O32A 1X5NA 2KM0A 5DGJA 2KOJA 2K20A 4I31A 2PNTA 1QA0A 5EZ0A 2ALPA 3ATKA 5ILBA 5C1UA 2BYGA 1A7SA 2L6OA 1O3OA 5GWZA 5G1DA 3GSLA 3WWBA 1C5RA 1GVZA 3SHCH 3A84A 1C5LH 5A2MH 1TRNA 2ZPMA 3A7WA 3QDZB 1O2XA 1Q2WA 3DIWA 3RXKA 4A1VA 1A5HA 2SGFE 8LPRA 1C9TA 2OCSA 3ID1A 1E38B 1TX7A 3A81A 1TE0A 3TJOA 3KIDU 2QE7D 2B9LA 2F0AA 1EASA 2BD2A 3T2NA 4K72A 3EYDA 3H5CB 5I46H 1P03A 4X6OA 1DSTA 4D7FA 1NC6A 3OFND 3DD2H 5GNDA 5B6OA 5C17A 1S85A 1NTEA 1SFQB 4CR9A 4D9RA 4NXPA 1J8AA 3K65B 3ATLA 4ABFA 1HJ8A 3ZV9A 1G3DA 2LELA 1GHXH 4MNVA 1YCPH 4YXWD 3PWBA 1AFQC 3EE7A 2VB0A 1TB6H 2VRFA 2BLOA 1WXRA 1PPFE 5HGGA 4X8SH 2J5UA 3DT0H 2M10A 1PPEE 3VPKA 5L6NH 1V62A 5TCAA 1EAXA 1Y5BT 1OWHA 4Y10E 1GBJA 1OZIA 2FI5E 2R2MB 4RN6A 1P02A 1TA6A 3MI4A 4ZUHA 3UQOA 2Y81A 3LGUA 3MH5A 3F2HA 1H8HD 1OHHD 1QAVB 3DUXH 5JB8S 1P2OA 3QDOA 4R0IA 3GY6A 1SGEE 4I33A 4AMHA 4Y8XA 1KWAA 1NRQH 4JL7A 1QNJA 1BRAA 4U30A 2MHOA 1BTWA 1EPTB 2BQWB 2FYRA 1ZMNA 2OS6A 1WF8A 1TPOA 2ZI2H 4AFUA 3Q3XA 1WJLA 1EATA 1GVKB 5C3NA 1KDQA 1O2GH 3MU8A 4JORA 1EXFA 1TX6A 5FCKA 1QJ6B 2A32A 1QFKH 3GCOA 1UVUH 2OQUA 4JZFH 3TU7H 3OU0A 1HXEH 5FB8C 2OZFA 1H9LB 1G36A 2CHAB 1GI2A 2R9PA 3KGPA 1VCQA 3KQBA 2ZTYA 1BTPA 3B76A 3SV6A 4B2CA 1UF1A 2IJD1 1IQJA 1FY1A 2GZ9A 4WF8A 2ZQ1A 5AHGH 3RXJA 3UREA 5LGOA 2FEQH 2KJKA 1OBXA 2BLWA 1O5AB 5GIBA 3LC3A 4NA9H 2A4OA 1OWEA 1IHSH 3LONA 1UJVA 1Z71A 1WH1A 1TP3A 1E37B 3E17A 3S9CA 1C9PA 3H7TA 6GCHG 1CHGA 4ISNA 1GBCA 1Y59T 2OSGA 1SLXB 1K22H 5GCHF 1DXPA 3M37A 2GMTC 5BPEA 1JRTA 3RM2H 4BNRA 1WFVA 1LPGB 1TFXA 1CT0E 1GHBF 5HJ1A 1HAYB 4H11A 1GGDC 4H6SB 1UITA 1U38A 1EOJA 3SBKA 1C5NH 1K1IA 2V35A 1ARBA 2FOCA 5EQRA 4INKA 3TK6A 2C93B 5L30H 1D5GA 1C1VH 3RL8A 3CBZA 1Z86A 2HVXA 5I25A 1GI1A 1V2PT 4ISOA 2KCPA 1O33A 3AAUA 4NNLA 1UCYE 1BMFD 4BTTB 2OQSA 1Y3VA 2PA1A 2AMPA 3VQGA 2J94A 1S0QA 2FMJA 2QXIA 4NSVA 1GCDA 1P2QA 1W14U 1SFIA 1W0JD 2P3UB 4BAHB 1HFDA 1G3EA 1ETRH 4JOJA 1RGWA 4A7IB 3UNQA 1G37A 2SGEE 3ZVGA 2LOBA 2GCTB 1DE7H 1KYNA 1EB1H 1EUFA 2V3MA 2BXTH 1UEPA 2WINI 4K60A 4R2ZA 1OP2A 3NCLA 2W6ID 1KY9A 1IQKA 4LXBH 2QBWA 2FN5A 1HBTH 3QK1A 4XRNA 5DP3A 4ZCNA 5F6MA 1B8QA 3MTYA 5E8EH 4AFSA 3FKSD 1ELFA 1UK3A 2F91A 3BG4C 3LU9B 4P02A 1ORFA 2FX4A 3KQCA 3A7ZA 1C5YB 1Q3OA 5JDUB 3LPRA 1YY3A 1HJAC 1UHBA 4GHQA 3RXFA 2Z9KA 1TBQH 1LQDB 3DFJA 1KLTA 2QXGA 4IGDA 1YPLH 4X2WA 2ANMH 3D65E 2ZHWH 3PMBB 1QJ7B 1HB0B 1JBUH 1CA8B 2BQ7B 3NCVA 4F4OC 3RU4T 3RUOA 3SZEA 1O2QA 3QZQA 1QB6A 1OWIA 4N6XA 1Z7KA 2BD9A 1C5QA 2P3FH 1FC7A 4MQAA 3KHFA 3BN9A 5HFEA 2ALVA 1TGTA 4FUIA 4B2AA 1NBME 3D23A 2VSVA 1CGHA 2K0QA 4K78A 1EJNA 4DT4A 6LPRA 2CF8H 1KTSB 1BBRE 2QIQA 1F0TA 4F55A 5EW2H 1GVLA 1C4U2 5EU8A 4YLUA 3URDA 3FY5A 1SQRA 4I7YH 3EDXB 5EXNA 2OP9A 2C8YB 4K1SA 5DPAA 1O37A 1YCPK 4FUJA 1P06A 4RSPA 4DIIH 1V2NT 1V2UT 3NZIA 4LMMA 2ZFQH 2ESTE 2PKAA 4MPXA 4ABJA 4CRAA 2OQ5A 5E0JA 2AIPA 2VIVA 2BOHB 4XHVA 2BDGA 3HK6B 2QA9E 2HVYB 4FXGH 1F5RA 4MTBA 3UQVA 1GI3A 1THSH 2GP9B 3K82A 2AMDA 2Q6FA 4Q63A 1DY9A 1KXFA 1ZLRA 2ZU4A 3UOUA 4X2XA 2JJ2D 4AYVB 4AX9H 4XSKU 1ZZZA 2F9VA 1O2PA 1ELAA 1C1NA 2Z3EA 2DJTA 2BY6X 3L33A 2ANYA 1WTGH 2O8TA 1GI0A 1A3EH 2HLDD 3RXPA 4THNH 2Q6GA 1G9IE 4ACBA 3MU0A 2OBQA 1ACBE 3RMMH 1Y7NA 1O34A 1T7CA 1WQSA 2LC7A 2HNTC 2VWLA 1FN8A 3KDGA 1J9CH 1BTUA 2IPQX 1DWBH 1COWD 3VXEH 4AFQA 2A7HA 4AB8A 5HMAA 2UUFB 2BHGA 4Y76A 5EPNA 2PP6A 2ZHFH 1TQ3A 4JOGA 1DWCH 2BDYA 3DJ3A 4OM9A 1LTOA 2ZPQA 1O31A 4FUFA 2DLSA 2BX3A 1B7XB 1GHAG 2B0FA 3PV2A 2BYAX 1TABE 3QUMP 4F49A 4I8JA 3PRDA 2P3WA 1NU9A 3A82A 3RU4E 3ATMA 3AW1A 4MNXA 3ZZBA 3TK9A 3CS7A 3RP2A 7KMEH 4LZ4B 4FUGA 3SU3A 2L4SA 1UK4A 4GVUA 1SHYA 1QQ4A 5HF1A 1E1RD 4ZKNU 1N6FA 3H7OA 3ID2A 2VNTA 1GI8B 2ZKSA 4TY6A 2BLQA 3PV5A 1AHTH 1A61H 3BTWE 3SV2H 3M5LA 1O3GA 1AIXH 1G30B 4MLFB 3RXTA 2UWLA 5H3JA 2WYJA 1DUAA 4HG6A 1GBTA 2XNIA 1H9IE 4BANB 3O8BA 3LKWA 4AYYB 1O3BA 1TPSA 4U32A 2TRMA 4DOQA 2VIQA 5J4SA 1GBDA 4B76A 1G3BA 1VAEA 2G52A 1AB9B 2FI3E 2QXJA 2ZHEH 1I16A 1TGBA 1SPJA 2W7RA 2XWBI 2VIWA 4IBLH 3Q00A 3VB4A 5EW1H 2FWWA 2F9NA 6CHAC 4YZUA 3EA7A 1IHJA 4INHA 3ZZ9A 2Y5HA 4AB9A 1MZDA 2I04A 5F8TA 1W0YH 3TMHA 1DXWA 4WVPE 5C5OA 4IN2A 1L4ZA 1V2VT 1O3AA 3SJ8A 2RDEA 1UJDA 1V1TA 1T2MA 3ZZAA 2VGCB 2OUAA 3ID3A 1V2MT 3UWJH 1AZ8A 1GHAF 1A0LA 4ZAEA 3HPKA 2AWUA 2EC9H 4CBNA 4OEOA 2PR3A 5A0AE 1ZYOA 2WV4A 1ZHRA 1EPTC 2TGAA 4JJ0A 2ZDVH 1P2JA 4NCYA 4NZLA 2FTLE 3LGIA 1UTLM 1OYQA 1O2LA 1D3TB 1CHOF 3SI4H 3A7YA 3FZDA 4UFEH 1HIAA 1ZSJA 3MU1A 1R6JA 1QLCA 1RIWC 2TGTA 2ZDNA 4GPGA 4DY7B 2ZTXA 3WW7A 5IK2D 1MBMA 4FETA 1PQAA 3OEHD 3V13A 4RI0A 5LPRA 4NMOA 4B75A 1M5ZA 1GQ4A 3TGJE 2RFKC 2BTCE 5T6GA 4WH6A 3U98H 2ANWA 3R69A 3C27B 2GD4B 2SGPE 4JOFA 1RTLA 1OYTH 2G4TA 4O3TA 4FUDA 1QY6A 3MHWU 4CBOA 1S0RA 1O5CB 3A8CA 4NMTA 1L0ZA 2M2AA 1Z1IA 1O2WA 1MABB 2OC0A 3F2FA 4DT7B 5HDYA 2QN5T 3P8OA 3HKIB 4P0CA 3VFEA 2Q6DA 4LOYH 2EDZA 1MQ6A 2YMSD 1EZSC 2FYQA 1C2LA 5EPYA 2P94A 2OGPA 5HFCA 1AKSA 3U69H 1W12U 2JREA 3PMAB 1TPPA 3GICB 1TMUH 3Q77A 1KMHB 4PROA 1O38A 1T8LA 1MTVA 4J2YB 4OS2A 2ANKH 4REYA 3DCLA 5FL7D 1UTKA 1GHZA 4ABBA 3RXLA 3O46A 4Y11E 2ZFTA 2QXHA 3OYPA 2G5MB 5FXLA 1WBGB 3E0NB 3SHWA 1ABIH 3GY3A 1UM7A 4XBDA 3VQFA 5EYZA 1FY3A 4DGJA 1BRUP 4MPVA 3S7KB 3QN7A 1U39A 2JETC 1BMAA 1GDNA 2LC6A 1DLKB 5ESTE 3BEFB 1C1PA 1X45A 1AMHA 2J98B 2Y6TA 3SORA 1P2MA 4KTCA 2GTBA 1WSSH 2Z9JA 2GCTC 2SGAA 1ETTH 1O3EA 2O9QA 3DORA 2L74A 1LKBA 3A87A 1LCYA 1IQIA 2ZIQH 3SGQE 1LPKB 2G51A 2YOLA 3K1RA 1GBLA 2SNVA 4Q7XA 2P8OC 2WPLS 4Y7BA 1DPOA 5C0UA 2G5VA 3HKJB 1C2DA 3ZVFA 5HF4A 3ZVDA 4Y0ZE 1ANCA 1NRPH 3UNRA 2VINA 1LVMA 2BVSH 4HFPB 2J9NA 1Z8GA 1O2ZA 2ODPA 2ZGCA 4TPIZ 1EJAA 3UOPA 1GBMA 3WWFA 1V6DA 3TVJB 3TJUA 1XZ9A 1AWHB 1FONA 1HXFH 2H9HA 2XBYA 3QTOH 2UUKB 3ZVAA 3VB6A 2KYLA 2ULLA 4A6LA 5C0TA 4UONA 3CYYA 4Q4LA 2IWQA 2PKTA 1NY22 3E16B 1RRKA 4ESTE 1H1BA 4JOEA 1LPZB 2UWPA 3SNEA 1Y3XA 3I78A 3FP7E 3EGKH 4Q7YA 3BPUA 1GBEA 3BEUA 5DK1A 1UTOA 2CXVA 3GCTF 5E11A 1CBWB 1FPHH 2LP6A 1V2RT 1VJ6A 2D90A 1QB1A 2RA0A 2DB5A 5FX5A 4AC9A 1QR3E 2A5IA 4X2VA 2YNBA 2DUCA 1IQEA 1WIFA 2GV7A 3SW2B 1BQYA 1E36B 2QG1A 1EB2A 1EAWA 1LHGH 2FX6A 3M3SA 1MKWH 3D62A 1SB1H 1O2IA 4DG4A 3SJIA 2ZF0H 1XUIA 4OS6A 4K69A 1A0HB 5E2OA 2RDLA 1EAUA 4XE4A 3A86A 1K1LA 2WUBA 2W7SA 1BFEA 5HIYA 1C5ZB 1HGTH 1LVBA 2KAWA 3DJAA 2IN2A 3KQ5A 3R0FA 3MQKC 3QIKA 5HEBA 2STBE 5HETA 4Q2PA 1TGCA 3PTBA 1M9UA 3GY8A 1ZPZA 1JIMA 1TX8A 5EOKA 3A85A 4WYTA 4H4FA 3CS0A 2ZCLP 2PUXB 2LNCA 1TAWA 4CRDA 3KN2A 1C2MA 4K5ZA 2BX4A 3UB0A 1I92A 5CDFE 2PKUA 2DMZA 1LHEH 1E1QD 7LPRA 1AY6H 1RS0A 1WI4A 1ZRBA 2FCFA 3KCGH 3OTPA 2ZEBA 4TY7A 4WMEA 4OS4A 1GJ9B 1MU6B 4UFDH 3F3BA 1BMNH 2ZGHA 1Z8RA 4JK6A 1H8DH 1W13U 5A09A 2SGDE 2FOHA 2XC4A 3A8DA 1Q3PA 1SVPA 3MH7A 3U1JB 4D9QA 3E8LA 3SQEE 4IC6A 1TNLA 2BY7X 2QAAA 4BTIB 1AE5A 3HATH 4NIYA 3SI3H 2CSJA 2Y80A 1CQQA 1GJAB 2XYAA 3P8NA 1YPHC 2A1DB 1O3MA 1LKAA 2ZGJA 2Z17A 1YLDA 4JK5A 2PFEA 5AFZH 2CGAA 1CA0C 3LC5A 1ZSLA 2A2QH 1O2TA 1UMAH 1GHYH 3U8TH 3ENSB 5I7ZA 2EI8A 1BOQA 3T28A 5FBEA 1V2ST 1BZXE 4Y7AA 3BTEE 4LZ1H 3S0NA 4L8NA 1GI6A 1ZUBA 4CR5A 1CT2E 2QF4A 1VB7A 4NIWA 1Z87A 3RXCA 4GLYA 4X8TH 3HVQC 1T8NA 5EQSA 1FX0B 2JH6D 1SGFA 4X1PU 4AGKA 3NWUA 1OX1A 1S84A 1E0FD 2H5DA 3CBXA 4UDWH 3UY9A 1O3IA 4FUHA 1HAVB 4IMZA 3OE7D 1AB9C 3CENA 4E34A 3TSZA 1K1OA 1AN1E 4NWLA 1LHDH 5ESBA 3ZZDA 1PYTD 1K32A 2J92A 3ZVCA 3K6YA 3DA9B 1VGCB 1GJ7B 3LT3A 4D8NA 3I1EA 5GLJA 2AS9A 4JYUH 1O2HA 3S9BA 1X7AC 3KZDA 1XX9A 4O06A 3V3MA 2A4QA 2W7UA 1XXDA 2HALA 5CE1A 2KPKA 2AEIH 1VZQH 5IL9A 4Q6HA 4ZXXH 3VG8A 2OLGA 3SO3A 2IOTA 1O5DH 4U2WA 2M5TA 3A83A 1DSUA 2BDCA 4SGAE 4I32A 3M61U 4B6EA 1MFGA 3UNSA 1XVOA 3UPEA 2KCOA 2GZVA 1N7TA 1NTPA 2CK3D 3OSYA 3SU1A 2NWNA 2L97A 1N7FA 3TNTA 3T5FH 3SJ9A 1KLJH 1WCZA 1PPCE 1W0ZU 1K9OE 4WXVA 4WJG2 1C4Y2 3PM3A 3ESTA 1K1PA 1AZZA 3QLPH 1GG6C 1AUJA 1N1LA 5KEDA 3QGLA 1DWEH 5A8ZA 1QAVA 1EX3A 2GGVB 5EXLA 2EI7A 1F5KU 2NU3E 4Z0KA 5IDKA 1O2SA 4FU8A 4Q6SA 2BD4A 1AUTC 1EPTA 1TNHA 5T3HA 2FS8A 1ELTA 1ZTLA 4NNMA 1F5LA 1ELGA 1BITA 3F0PA 4AOQA 1V5LA 2JIKA 1WHAA 1W9EA 3A7XA 1A5IA 1YPKH 3CBYA 3GY5A 3S7HB 4ZKRU 2BXUH 3PB1E 2GZ7A 2FP7B 3OX7U 2YT7A 2G2LA 1T8OA 1AWFH 2ZCKP 4K1EA 4ZH8A 1Q7XA 1MCVA 1Q31A 1XUHA 4B71A 2KA9A 4MDSA 2EXGA 3QJMA 2L4TA 1SGFG 1Y3YA 2BB4A 5HFFA 4KFWA 1GQ5A 2OC8A 1YC0A 1UFXA 1ZR0A 2FESH 4GSOA 4I8LA 5E0HA 2I6QA 4Q2NA 1T8MA 1EZUC 1IU2A 3A8BA 4FUEA 1F0UA 3UR9A 1SLVB 2PW8H 2V7QD 7GCHG 2I1NA 2VVVA 4WWYA 1O5GH 2PSXA 1LMWB 2C8XB 4I86A 1C2FA 2KRGA 3A7VA 3N7EA 4ZHMU 5SGAE 4ACAA 3CNRA 4NXRA 1P2NA 2AGGX 2UUJB 3SGBE 3SU4A 3P92A 2BOKA 1SGQE 2ZECA 4YOIA 2G5NA 1DM4B 2UUYA 1ZJDA 4G69A 2Z3DA 1ELEE 1TMTH 1UTQA 2YMSC 3RXGA 2H1UA 1EOLA 2HNTF 1WTHD 2KCYA 2QKUA 3FN8A 2EGOA 1O3JA 3GCHB 4JCNA 2OC1A 1C4V2 4Z6AH 1BE9A 1EQ9A 2HRVA 1XVMA 4WMFA 1NESE 1HYLA 2E7KA 1RTKA 3O8DA 4Y71A 6GCHF 1L1JA 5DP8A 1O2RA 3P17H 1GMHG 2LA8A 2VWNA 4TPYA 5EJ1A 3HK3B 1QRXA 1ARCA 1PPBH 1ZOMA 5AVDA 3OEED 1O3PB 1IQGA 3KDKA 1UHBB 1DVAH 2HGTH 4K75A 1GMCG 3KNXA 2A5KA 1DUEA 1N8OC 3MOCA 3E0PB 2R3UA 4JMYA 4KKDA 1UTPA 3ZYDA 2JH5D 7GCHF 5JBAS 1FMGA 3PLPA 3RXOA 4FLNA 1K0HA 2OXSA 1C2EA 4E7RG 3K50A 2AINA 2FI4E 1C1MA 1O3DA 1QTFA 4B2BA 3RM0H 3Q3KA 2W3KA 3DJ1A 1V2OT 5DP9A 1DDJA 2ZHQH 2ZG0H 3U8RH 1TP5A 1MD7A 2ZZUH 1C5SA 2HE2A 3UUZA 5HXFA 1GL0E 2BZ6H 4X0WU 5DP5A 3ZRTA 1NN6A 3MU5A 1CU1A 3FVFB 3NK8A 1O2JA 4YTAA 1OP0A 2TBSA 4HGCA 1AI8H 1CBWC 1TNJA 2FIRH 1LHFH 1BIOA 1MH0A 1MU8B 4KGAA 1SQOA 4FOUC 1BMLA 1MC7A 1ESBA 2VIOA 3EGHC 1Y3WA 1SGRE 1ELDE 2TIOA 1WYKA 3M5MA 2BD5A 2GCHG 2OCVB 4CRCA 1FC6A 2BM2A 4TT3D 3MH4A 1WAYB 2D26C 4ABEA 2BMGB 4P00A 2WYGA 1EJMA 1BRCE 1TOMH 2Z9IA 1GMCF 3G01A 2WZQA 2W3IA 2GT7A 1A0JA 4RT1A 3TIUA 5JXBA 1DITH 2AHME 2HNTE 3DSOA 3SZNA 1TA2A 1MAYA 1V3XA 1S83A 3U28C 3AW0A 3PDVA 1W2KH 4F48B 2FNEA 2JOAA 3M36A 2DM8A 1NFUA 4BAQB 2GKVE 2FOFA 1J15A 3O8RA 1JMOH 4YLQH 1VJ9U 1X5RA 3PMHB 3U8OH 1GCTC 3GISB 1WFGA 1OS8A 2ZHDA 2KOMA 5FHTA 4M9FA 2DE9A 2STAE 3RXSA 1WQVH 1ELVA 1OBYA 2F3CE 3ZYEA 3QGJA 5FX6A 1DFPA 1YBWA 3E6PH 2J38A 2H9EH 1C5OH 1WF7A 2A45B 2V3OH 1UK2A 3RXIA 3TJNA 5JBCS 1P1DA 2I4SA 2KQFA 3UWIA 2A2XH 2HPQH 1BHXB 3AK5A 1QBNA 2M3MA 5E22A 2HOBA 3HGPA 1GPZA 1TBZH 1MKXH 4YESB 5DP7A 3MO3A 1UCYH 2BD8A 2OC7A 2CSSA 4ISLA 1FLEE 1GJCB 2V1WA 2V0BA 1A46H 2IJOB 1FQ3A 3ATIA 1W10U 1YLNA 1YCPM 3ZIAD 1G9OA 3UAIC 2EDVA 1JRSA 2VWRA 1OWDA 2P95A 4K2YA 5JYIA 1FUJA 2IPHA 2A7CA 4NMPA 5KGOA 1L4DA 3ZZ7A 2VIPA 5L2ZH 3PO1B 1MTUA 2F9BH 5TJXA 1ZOKA 1C2GA 4GVDA 2QF5A 1DT2A 3TSWA 1TMBH 3SU2A 1QQUA 3LJOA 2V6NA 4Q2QA 3PV4A 4Y6DA 2XC0A 4I8GA 1AFEH 1S6LA 1W11U 1W3CA 2R0KA 3MU4A 2AWWA 2SFAA 1BMMH 1AE8H 1VGCC 3F0OA 3Q76A 4DURA 1GDUA 1NRSH 1UJ1A 4ABGA 1OKXA 1ZHPA 1SR5C 2PTCE 4KELA 1UEWA 4GVCA 2QC2A 3I77A 2K1QA 2XNDD 1C1OA 3RC4A 3B8JA 2AIQA 1AO5A 2XBWA 2A31A 1VA8A 1YBOA 5DP6A 1GJ5H 4Z8JA 2XW9A 1OOKB 3RLYH 3K9XB 4Y79A 1J17T 1GBBA 4FU7A 1JOUB 1YPEH 3EA9A 2PKSB 4MPWA 1W7XH 2XBVA 1GM1A 1W0KD 4OGYA 5T6FA 3SU6A 1MZAA 2H3MA 2YTWA 2VBCA 3TLOA 2LUIA 5T1VA 1NZQH 3RC5A 3RLWH 3M7TA 4IS5A 3RDZA 1O3CA 3ZZ4A 4E05H 2BY5X 1SL3A 1BBRH 1C1WH 1FDPA 1PYTC 4ABDA 3ID4A 3S69A 2BD3A 2ZA5A 5JBTA 3EQ0H 5DG6A 5JB9S 2Z94A 2CHAC 1GJ8B 1MD8A 2CMYA 1UVOA 5FPSA 1VITH 2RG3A 1C1TA 1K1NA 5EXMA 1E79D 4O03A 1OWKA 5C2ZA 1N99A 2KOHA 1UW7A 4TYDA 1BJUA 1W7GH 2KBSA 3SHUA 1Z8JB 1QL7A 1T4VH 2FODA 2ODYB 3QO6A 5F8ZA 5GXPA 1CSOE 5HEDA 4AG1A 3NFLA 2Z6BD 2BDIA 1O3HA 3W1EA 1IAUA 2O8UA 4E35A 2SNWA 2FS9A 3TH4H 1DLEA 4M7GA 3VB5A 2XRCA 3R0HA 4X2YA 1QURH 2BY9X 3LDXH 5A0CA 3B23B 3EGGC 1GBFA 3RLEA 4NFFA 1SOTA 4YT6H 2W4FA 2XTTB 2UWOA 3OTJE 4E06H 2FOMB 2J4IA 1QCPA 2R0LA 1ZMJA 3KZEA 3M7UA 2HE4A 1C5MD 1O36A 1S82A 2WHXA 2EEKA 2ZC9H 1MTWA 1N6YA 4A92A 1X5QA 2GMTB 2A4RA 1F0SA 3OAAD 2GX4A 3PLBA 5HFDA 3A7TA 3FZZA 3N7OA 4YYXA 3KL6A 1KTTB 2AFQB 2PSYA 1ZGVA 1UM1A 1YLCA 2JIZD 1WHDA 1ZPCA 4ABHA 1OWJA 1Y8TA 1HUTH 3GYLB 3P95A 2EDPA 2NU0E 5HIZA 3CC0A 3SUDA 1CVWH 2GV6A 3H09A 4BAKB 4CH8B 4AZ2B 2D92A 2WPJS 3SNCA 3WY8A 3WKLA 3RXVA 1D3QB 3GCHC 1IHTH 3SFJA 4NMQA 2KJDA 4MNYA 5C5NA 3RMLH 3SUGA 1PDRA 1NU7B 1LQEA 2A5AA 4NSYA 1WDIA 1O5FH 4UFFH 1K1JA 4OAJA 5DP4A 5G4BA 1IU0A 1K21H 4HOPB 1P8VC 7ESTE 4SGBE 5EJLA 4INLA 1L1GA 2G55A 2J98A 1L6OA 1U37A 2B5TB 1C2KA 2YUYA 4LK4A 1SGYE 2ZFPH 4X8VH 1IQFA 2RA3A 1XMNB 3T62A 1MKXK 1O39A 4NIVA 1C1RA 4K3JA 2KJPA 1ELBA 2I6SA 2YNAA 1MMJN 1UCYK 2D2DA 4Y0YE 1S81A 2XBXA 1QB9A 1FCFA 1SLUB 1PFXC 1DY8A 1ZPBA 3BSQA 5C94A 1O2UA 2F83A 2ZO3H 2EEJA 4H42U 4Y8YA 4MVNA 1VR1H 2CN0H 3SJOA 1HJAB 5DN6D 5A8YA 2JXOA 2X7ZA 1UTNA 5HKKD 1RY4A 1U6QA 3TH3H 1YWUA 4YO9A 1GWAA 1D4PB 2JJ1D 1NBMD 2XWAA 4WXIA 2Y5FA 1O5EH 3ZVBA 1UVPA 2P59A 3UFAA 3NPSA 1UJUA 3DFLA 2EEIA 1OBZA 4ZROA 1Y5AT 2GVFA 1G2MA 1FY8E 3PROA 4D76A 4BAMB 4FGMA 2EI6A 1O2OA 5GDSH 2EEHA 5JPMH 1ANBA 3FANA 1H9HE 3WKMA 1A5GH 1HAZB 3M3VA 3V7TA 2XCNA 4GCHG 2EEGA 2EGKA 8GCHG 1DOJA 1QHRB 4DCDA 5E0GA 4O3UA 1AVWA 3C1KA 2PWXA 5DSFA 1RTFB 1MTNB 4X6MA 3UR6A 2JWEA 1O3KA 1V2QT 2JILA 1MQ5A 1AQ7A 3NKKA 4ZXYH 1HV7A 2ZDLA 1P01A 5DKMA 1YKTA 3RMOH 2Q3GA 1GJ6A 3TGKE 2WV9A 1PQ5A 4NFEA 1HAHH 2GDDA 1PJPA 1ESTA 1G3CA 2KAIB 4MG3A 4ASUD 4X1QU 1Y3UA 1EKBB 2PDZA 1N6XA 1FC9A 1SG8B 1YPHE 2VVCA 1BBRK 4NG9H 4NIXA 2NU1E 1A3BH 2WL7A 4RKJB 3SYJA 5DTHA 4R8TB 5ETXA 2I0IA 2O8MA 3SHAH 3R3GB 1GMDG 3V0XA 1UVTH 3O5NA 1TLDA 1LDTT 4B74A 3GCNA 1D6RA 5E6PB 3LGYA 1XXFA 2KR7A 2TGPZ 2V90A 4AGJA 3M3TA 1HAPH 3PDZA 1GBKA 3Q3YA 2W6JD 4BTUB 3AXAA 1B0EA 1L1NA 1HLTH 5F3XA 5KECA 1IQNA 3RU4D 1O2MA 1FAXA 3OY5U 3PLKA 4JZDH 1NPMA 1SBWA 2QF3A 2C8WB 4IW4E 2PUQH 1P04A 2JDID 2A4GA 3BF6H 2O2TA 1IQMA 2R3YA 4JZEH
chains in the Genus database with same CATH topology
2EHRA 2AYWA 2Q1JA 3MYWA 2GT8A 1C5XB 3BIUH 1Z1JA 4CHAB 2JKHA 2IWOA 1KLIH 4X6PA 5PTPA 3SJKA 1F2SE 4OS7A 4OGXA 4UFGH 1UO6A 2VU8E 2P3TB 4FVBA 2QKVA 3LJJA 1Z6JH 3O8CA 1WV7H 2ZTZA 1OSSA 4ISIH 2I6VA 2ZPLA 3PO1C 1ABJH 3F9EA 2BDHA 3RXEA 1H8IH 1GDQA 4UU6A 4AN7A 1JXPA 1BUIA 5AF9H 5HEYA 3SV9A 1HPGA 1V6BA 3LGWA 5EQQA 3BG8A 5EGMA 1D3PB 1GMDF 1NO9H 4JZ1A 4WMDA 2PZDA 2WPKS 4ZMAH 1KXAA 2VGCC 3ODDA 2RRMA 2ZPRA 3T26A 2OMJA 2P93A 1GBAA 4NMRA 3BV9B 1HAVA 4I8HA 5LPEA 2CS5A 1GHVH 4JZIA 6CHAB 2Y5GA 4J1YA 3S9AA 2AWXA 2R2WU 1V2KT 2LPRA 2HGAA 4F8KA 1XM1A 1KDQB 4KFVA 1S6HA 2G8TA 2PKSC 4KTSA 3VGCB 5LPFA 1HAIH 5GCHG 1Z6EA 3MWIU 3SQHE 5CMXH 4YDPA 1J16A 2Y82A 2PGQB 3GY2A 1F92A 1MFLA 2H5CA 3ATWA 3MNSA 5C20A 3K6ZA 2R4HA 4A5TS 1V2LT 1RGRA 1GHBG 1ZGIA 2F9PA 3TH2H 1HAGE 4D7GA 3K2UA 1SGIB 3F68H 1FAKH 1Y5UT 2BDBA 1FY4A 2V3HH 1KXEA 3QGNB 1VITG 4XBBA 1CGJE 4YOGA 4IMQA 4O97A 3RXDA 1RIWB 3VXFH 5E21A 1TQ0B 1GBHA 1NS3A 1UTMA 2B8OH 1FXYA 1NM6A 4ASHA 4FUBA 1HAOH 2ZFSA 1XUGA 2RCZA 3UIRA 4UU5A 2ZFFH 1WOFA 2ASUB 3BTDE 3VB3A 3JZ2B 1FN6A 4X6NA 1TNIA 3GYMA 1PQ7A 2ZNKH 1ZMLA 5HFBA 2QCYA 1SQAA 3BTFE 3E91A 1O3NA 1QIXB 1EZQA 2VVUA 2XCFA 4EDJA 1EAIA 1SQTA 3UTUH 4KP0A 1TGNA 1ZSKA 5F03A 5AFYH 1YPGH 1MUEB 1SC8U 2THFB 1N6DA 3MFJA 3MNBA 2ZU1A 1P11E 4BXSA 1EP5A 3P8GA 2I0LA 3ZZ5A 1MKWK 1ZTKA 1BB0B 1FNIA 3VEQB 5BRRE 1OP8A 2HPPH 8KME2 2YUBA 1GBIA 2G4UA 1O5BB 2ZU5A 5E1YA 2QKTA 2FLRH 5B6LA 3MH6A 2WPMS 3L3TA 2FOEA 3SV7A 1X9ZA 4QT8C 4OEPA 1V2TT 3RXBA 1TYNA 3GJ9A 1AU8A 3TPIZ 5CHAB 2BY8X 2C4FH 2M0ZA 1C2JA 3EA8A 1VITF 2A7JA 3R68A 3QTVH 3L4FD 4MPAA 1T32A 1CT4E 4ZHLU 1YM0A 2FOGA 4CRGA 1X6DA 4H6TA 1S5SA 1TWXB 3HPMA 2JETB 3RC6A 4JJ3A 3RXHA 5DO4H 1WU1A 2FXRA 4ZKOU 4YOJA 4A1XA 3CH8A 5J4QA 1TPAE 3MMGA 1HCGA 1W9OA 1OPHB 3F9HA 4UE7H 1GI4A 4DW2U 1IOEA 1YP9A 2VSPA 3SUFA 1U3BA 3B9FH 3ELAH 3LGTA 3RXAA 1GI5A 2FDAA 4PQWA 1FI8A 2TPIZ 4IC5A 4VGCB 1AGJA 2AMQA 1LVYA 2Z7FE 3IG6B 1VCPA 4NWKA 2BLVA 4FU9A 1P2IA 4K1TA 1O35A 2AGEX 4ZHAA 1HJ9A 2EA3A 3EE0B 2Q9VA 2P8OB 2ZU2A 2C8ZB 1SGNE 2B7DH 3GDSA 3FP8E 1SGPE 1V5QA 3BTQE 1W8BH 3JZ1B 1LO6A 4GAWA 1C1QA 1CE5A 1KXDA 2F9UA 4Q2KA