2KBSA

Solution structure of harmonin pdz2 in complex with the carboxyl tail peptide of cadherin23
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
KEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVAAAGRELFMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Harmonin
publication title Assembling stable hair cell tip link complex via multidentate interactions between harmonin and cadherin 23
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/cell adhesion
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kbsA00
2PA1A 3K50A 2EEHA 4K78A 1V6BA 2R4HA 2P3WA 3PV5A 2AINA 2QKUA 5D13A 1WF8A 2UZCA 2LUIA 4PQWA 2OGPA 4NXPA 5H3JA 3NFKA 5F3XA 5HEYA 2IWNA 4JORA 1WI2A 3VQGA 1Q3OA 2EDZA 2LC7A 3I1EA 1W9OA 1XZ9A 2IWPA 5GNDA 2HE4A 1VJ6A 4Q2PA 1N6EA 1X6DA 2KG2A 1RY4A 1D5GA 2K20A 4NMVA 2EEGA 4NXQA 1TQ3A 1UEQA 1Z86A 5E11A 1Q3PA 3DJAA 4E35A 4F8KA 4YYXA 2RRMA 3HVQC 4KFVA 5A2PA 1KWAA 1SOTA 3R0HA 1UEWA 2ZPLA 2KPLA 2EXGA 3B76A 5JXBA 3RL7A 1X45A 4G69A 3SFJA 4O06A 2WL7A 1V62A 2Z17A 3LNXA 4K76A 2KJKA 1UM7A 4Q2OA 2Q9VA 1MFLA 2CS5A 4JOKA 2LC6A 2QBWA 2H2BA 3ID3A 1LCYA 2VWRA 3CC0A 2AWWA 4OEOA 2VSVA 1Z87A 3E17A 2RCZA 2QKTA 2HE2A 4NXRA 4UU5A 5G1EA 3R69A 2KJPA 1I92A 1VAEA 2DLUA 3CBXA 1OBZA 4E3BA 2M0TA 1WHAA 2W7RA 4OEPA 4YDPA 2I6VA 4JOFA 2VSPA 3QE1A 1RGRA 1Q7XA 2KA9A 1KY9A 4HOPB 2QT5A 2E7KA 3I4WA 1WH1A 3GDSA 5HFCA 5E1YA 4AMHA 1U3BA 5EZ0A 2PDZA 3AXAA 2LA8A 3BPUA 3GGEA 1QAUA 5HF1A 2KYLA 2OZFA 2LOBA 2R3YA 1UJVA 4OAJA 1WI4A 4NMRA 4LMMA 2W4FA 4JOEA 2OCSA 1FC6A 5HDYA 2HGAA 1M5ZA 2IWQA 3ID4A 2EDVA 2MHOA 4K72A 3TMHA 1UEPA 4GVDA 2YT7A 1N99A 1WFGA 3O5NA 1QAVB 1UJDA 1FC7A 1TP5A 4Q2QA 4EDJA 1N6DA 3MH4A 1Y7NA 4R2ZA 1X5NA 2KL1A 2G2LA 2JOAA 1G9OA 3STJA 1QAVA 4IC6A 4XHVA 3GDUA 3TSVA 2V90A 5HF4A 2JIKA 2M0UA 2PNTA 3NGHA 2L97A 3NFLA 1UJUA 3GCOA 2KOHA 2KBSA 3QJNA 1K32A 1UM1A 1IU0A 2L4SA 1IHJA 4NMSA 4JL7A 4H11A 3MH7A 1IU2A 3SUZA 3PS4A 4MPAA 4NMQA 3PDVA 3HPKA 2FCFA 5E6PB 4KFWA 3QDOA 4GVCA 2KV8A 2I0IA 4NMPA 2EEJA 1WHDA 2PZDA 1P1EA 2CSJA 1N7EA 1MC7A 2Z9IA 2I1NA 2V1WA 1NF3C 4E34A 3O46A 3OU0A 2L4TA 3PV4A 1OBXA 3DORA 4JOHA 1RZXA 3ZRTA 1BE9A 3ID1A 2I0LA 2VPHA 1BFEA 2DJTA 2M0ZA 5FHTA 2JILA 4JOGA 4Q2NA 1N7TA 1GQ4A 2H3MA 3ID2A 2PKUA 3VQFA 3SOEA 3WKMA 1B8QA 2KJDA 5GLJA 3PV2A 3QO6A 2FNEA 2YUYA 4JOJA 5G1DA 2FE5A 2EJYA 1U38A 2H2CA 2M10A 3EGHC 4NNMA 5HEDA 5I7ZA 1VA8A 3L4FD 5DTHA 5HFDA 4NNLA 2GZVA 2EGKA 4P0CA 2D90A 3I18A 3FY5A 3KZDA 1UHPA 2EEIA 2O2TA 2JXOA 5HFBA 2EDPA 5HEBA 1Y8TA 3RL8A 2ENOA 4Z33A 2KOJA 2CSSA 2AWXA 5HETA 2OQSA 1VB7A 2K1ZA 1R6JA 2OPGA 1PDRA 4WYTA 1W9EA 4FGMA 2KRGA 2VRFA 4REYA 2G5MB 1N6FA 3PDZA 3GSLA 1SOZA 1WIFA 1OZIA 4K75A 2AWUA 2KPKA 3QIKA 5F67A 4WYUA 3K1RA 2KQFA 3OTPA 2ZPMA 1TE0A 2DKRA 2OSGA 1V5LA 3CBYA 3WKLA 3DJ3A 4P2AB 2JINA 5E22A 2REYA 1UFXA 5HJ1A 1FCFA 2H3LA 3CBZA 2EAQA 1U37A 1WG6A 1ZUBA 4GHNA 5E21A 1UITA 4Q3HA 3TSWA 3LNYA 5B6LA 1X5RA 2F0AA 5HFFA 3GCNA 3KHFA 1WFVA 2YUBA 1X8SA 4RI0A 2OMJA 1UEZA 2D92A 2M0VA 1I16A 2F5YA 2M3MA 2X7ZA 2DAZA 2Q3GA 4NMTA 3SHUA 3DJ1A 4Z8JA 1X5QA 2YTWA 1WF7A 2QG1A 3JXTA 1RGWA 1W9QA 5FB8C 2DMZA 3CS0A 1QLCA 2I4SA 2KOMA 3TSZA 2DM8A 1GQ5A 2JREA 5EYZA 2KAWA 1TP3A 2DB5A 1UF1A 2BYGA 2EGNA 2PKTA 3K82A 1N7FA 1U39A 3QGLA 3CYYA 3CH8A 3SHWA 1VCWA 1ZOKA 3QJMA 3GJ9A 4Q6SA 3GDVA 1KEFA 4JOPA 1YBOA 1V5QA 1OBYA 1WJLA 2EGOA 4Q6HA 2MX6A 2FN5A 2YT8A 1P1DA 2QKVA 2DLSA 3KZEA 3RLEA 4K6YA 4NMOA 1L6OA 2EV8A 4L8NA 5HFEA 2D8IA 1FC9A 1MFGA 4HOPA 1T2MA 3DIWA 2VZ5A 3MH6A 2JWEA 1V1TA 2DC2A 3EGGC 1NTEA 2IWOA 1GM1A 4N6XA 3HPMA 4UU6A 2I04A 3R68A 2OS6A 2EHRA
chains in the Genus database with same CATH superfamily
2PA1A 3K50A 2EEHA 4K78A 1V6BA 2R4HA 2P3WA 3PV5A 2AINA 2QKUA 5D13A 1WF8A 2UZCA 2LUIA 4PQWA 2OGPA 4NXPA 5H3JA 3NFKA 5F3XA 5HEYA 2IWNA 4JORA 1WI2A 3VQGA 1Q3OA 2EDZA 2LC7A 3I1EA 1W9OA 1XZ9A 2IWPA 5GNDA 2HE4A 1VJ6A 4Q2PA 1N6EA 1X6DA 2KG2A 1RY4A 1D5GA 2K20A 4NMVA 2EEGA 4NXQA 1TQ3A 1UEQA 1Z86A 5E11A 1Q3PA 3DJAA 4E35A 4F8KA 4YYXA 2RRMA 3HVQC 4KFVA 5A2PA 1KWAA 1SOTA 3R0HA 1UEWA 2ZPLA 2KPLA 2EXGA 3B76A 5JXBA 3RL7A 1X45A 4G69A 3SFJA 4O06A 2WL7A 1V62A 2Z17A 3LNXA 4K76A 2KJKA 1UM7A 4Q2OA 2Q9VA 1MFLA 2CS5A 4JOKA 2LC6A 2QBWA 2H2BA 3ID3A 1LCYA 2VWRA 3CC0A 2AWWA 4OEOA 2VSVA 1Z87A 3E17A 2RCZA 2QKTA 2HE2A 4NXRA 4UU5A 5G1EA 3R69A 2KJPA 1I92A 1VAEA 2DLUA 3CBXA 1OBZA 4E3BA 2M0TA 1WHAA 2W7RA 4OEPA 4YDPA 2I6VA 4JOFA 2VSPA 3QE1A 1RGRA 1Q7XA 2KA9A 1KY9A 4HOPB 2QT5A 2E7KA 3I4WA 1WH1A 3GDSA 5HFCA 5E1YA 4AMHA 1U3BA 5EZ0A 2PDZA 3AXAA 2LA8A 3BPUA 3GGEA 1QAUA 5HF1A 2KYLA 2OZFA 2LOBA 2R3YA 1UJVA 4OAJA 1WI4A 4NMRA 4LMMA 2W4FA 4JOEA 2OCSA 1FC6A 5HDYA 2HGAA 1M5ZA 2IWQA 3ID4A 2EDVA 2MHOA 4K72A 3TMHA 1UEPA 4GVDA 2YT7A 1N99A 1WFGA 3O5NA 1QAVB 1UJDA 1FC7A 1TP5A 4Q2QA 4EDJA 1N6DA 3MH4A 1Y7NA 4R2ZA 1X5NA 2KL1A 3KDKA 2G2LA 2JOAA 1G9OA 3STJA 1QAVA 4IC6A 4XHVA 3GDUA 3TSVA 2V90A 5HF4A 2JIKA 2M0UA 2PNTA 3NGHA 2L97A 3NFLA 1UJUA 3GCOA 2KOHA 2KBSA 3QJNA 1K32A 1UM1A 1IU0A 2L4SA 1IHJA 4NMSA 4JL7A 4H11A 3MH7A 1IU2A 3SUZA 3PS4A 4MPAA 4NMQA 3PDVA 3HPKA 2FCFA 5E6PB 4KFWA 3QDOA 4GVCA 2KV8A 2I0IA 4NMPA 2EEJA 1WHDA 2PZDA 1P1EA 2CSJA 1N7EA 1MC7A 2Z9IA 2I1NA 2V1WA 1NF3C 4E34A 3O46A 3OU0A 2L4TA 3PV4A 1OBXA 3DORA 4JOHA 1RZXA 3ZRTA 1BE9A 3ID1A 3KDGA 2GEFA 2I0LA 2VPHA 1BFEA 2DJTA 2M0ZA 5FHTA 2JILA 4JOGA 4Q2NA 1N7TA 3GABA 1GQ4A 2H3MA 3ID2A 2PKUA 4JJ0A 3VQFA 3SOEA 3WKMA 1B8QA 2KJDA 5GLJA 3PV2A 3QO6A 2FNEA 2YUYA 4JOJA 5G1DA 2FE5A 2EJYA 1U38A 2H2CA 2M10A 3EGHC 4NNMA 5HEDA 5I7ZA 1VA8A 3L4FD 5DTHA 5HFDA 4NNLA 2GZVA 2EGKA 4P0CA 2D90A 3I18A 3FY5A 3KZDA 1UHPA 2EEIA 2O2TA 2JXOA 5HFBA 2EDPA 5HEBA 1Y8TA 3RL8A 2ENOA 4Z33A 2KOJA 2CSSA 4FLNA 2AWXA 5HETA 2OQSA 1VB7A 2K1ZA 5B42A 1R6JA 2OPGA 1PDRA 4WYTA 1W9EA 4FGMA 2KRGA 2VRFA 4REYA 2G5MB 1N6FA 3PDZA 3GSLA 1SOZA 1WIFA 1OZIA 4K75A 2AWUA 2KPKA 3QIKA 5F67A 4WYUA 3K1RA 2KQFA 3OTPA 2ZPMA 1TE0A 2DKRA 2OSGA 1V5LA 3CBYA 3WKLA 3DJ3A 4P2AB 2JINA 5E22A 2REYA 1UFXA 5HJ1A 1FCFA 2H3LA 3CBZA 2EAQA 1U37A 1WG6A 1ZUBA 4GHNA 5E21A 1UITA 4Q3HA 3TSWA 3LNYA 5B6LA 1X5RA 2F0AA 5HFFA 3GCNA 3KHFA 1WFVA 2YUBA 1X8SA 4RI0A 2OMJA 1UEZA 2D92A 2M0VA 1I16A 2F5YA 2M3MA 2X7ZA 2DAZA 2Q3GA 4NMTA 3SHUA 3DJ1A 4Z8JA 1X5QA 2YTWA 1WF7A 2QG1A 3JXTA 1RGWA 1W9QA 5FB8C 2DMZA 3CS0A 1QLCA 2I4SA 2KOMA 3TSZA 2DM8A 1GQ5A 2JREA 5EYZA 2KAWA 1TP3A 2DB5A 1UF1A 2BYGA 2EGNA 2PKTA 3K82A 1N7FA 5ILBA 1U39A 3QGLA 3CYYA 3CH8A 3SHWA 1VCWA 1ZOKA 3QJMA 3GJ9A 1X9ZA 4Q6SA 3GDVA 1KEFA 4JOPA 1YBOA 1V5QA 1OBYA 1WJLA 2EGOA 4Q6HA 2MX6A 2FN5A 2JSNA 2YT8A 1P1DA 2QKVA 2DLSA 3KZEA 3RLEA 4K6YA 4NMOA 3NCVA 1L6OA 2EV8A 4L8NA 5HFEA 2D8IA 1FC9A 1MFGA 4HOPA 1T2MA 4JJ3A 3DIWA 2VZ5A 3MH6A 5IL9A 2JWEA 1V1TA 2DC2A 3EGGC 1NTEA 2IWOA 1GM1A 4N6XA 3HPMA 4UU6A 2I04A 3R68A 2OS6A 2EHRA
chains in the Genus database with same CATH topology
2PA1A 3K50A 2EEHA 4K78A 1V6BA 2R4HA 2P3WA 3PV5A 2AINA 2QKUA 5D13A 1WF8A 2UZCA 2LUIA 4PQWA 2OGPA 4NXPA 5H3JA 3NFKA 5F3XA 5HEYA 2IWNA 4JORA 1WI2A 3VQGA 1Q3OA 2EDZA 2LC7A 3I1EA 1W9OA 1XZ9A 2IWPA 5GNDA 2HE4A 1VJ6A 4Q2PA 1N6EA 1X6DA 2KG2A 1RY4A 1D5GA 2K20A 4NMVA 2EEGA 4NXQA 1TQ3A 1UEQA 1Z86A 5E11A 1Q3PA 3DJAA 4E35A 4F8KA 4YYXA 2RRMA 3HVQC 4KFVA 5A2PA 1KWAA 1SOTA 3R0HA 1UEWA 2ZPLA 2KPLA 2EXGA 3B76A 5JXBA 3RL7A 1X45A 4G69A 3SFJA 4O06A 2WL7A 1V62A 2Z17A 3LNXA 4K76A 2KJKA 1UM7A 4Q2OA 2Q9VA 1MFLA 2CS5A 4JOKA 2LC6A 2QBWA 2H2BA 3ID3A 1LCYA 2VWRA 3CC0A 2AWWA 4OEOA 2VSVA 1Z87A 3E17A 2RCZA 2QKTA 2HE2A 4NXRA 4UU5A 5G1EA 3R69A 2KJPA 1I92A 1VAEA 2DLUA 3CBXA 1OBZA 4E3BA 2M0TA 1WHAA 2W7RA 4OEPA 4YDPA 2I6VA 4JOFA 2VSPA 3QE1A 1RGRA 1Q7XA 2KA9A 1KY9A 4HOPB 2QT5A 2E7KA 3I4WA 1WH1A 3GDSA 5HFCA 5E1YA 4AMHA 1U3BA 5EZ0A 2PDZA 3AXAA 2LA8A 3BPUA 3GGEA 1QAUA 5HF1A 2KYLA 2OZFA 2LOBA 2R3YA 1UJVA 4OAJA 1WI4A 4NMRA 4LMMA 2W4FA 4JOEA 2OCSA 1FC6A 5HDYA 2HGAA 1M5ZA 2IWQA 3ID4A 2EDVA 2MHOA 4K72A 3TMHA 1UEPA 4GVDA 2YT7A 1N99A 1WFGA 3O5NA 1QAVB 1UJDA 1FC7A 1TP5A 4Q2QA 4EDJA 1N6DA 3MH4A 1Y7NA 4R2ZA 1X5NA 2KL1A 3KDKA 2G2LA 2JOAA 1G9OA 3STJA 1QAVA 4IC6A 4XHVA 3GDUA 3TSVA 2V90A 5HF4A 2JIKA 2M0UA 2PNTA 3NGHA 2L97A 3NFLA 1UJUA 3GCOA 2KOHA 2KBSA 3QJNA 1K32A 1UM1A 1IU0A 2L4SA 1IHJA 4NMSA 4JL7A 4H11A 3MH7A 1IU2A 3SUZA 3PS4A 4MPAA 4NMQA 3PDVA 3HPKA 2FCFA 5E6PB 4KFWA 3QDOA 4GVCA 2KV8A 2I0IA 4NMPA 2EEJA 1WHDA 2PZDA 1P1EA 2CSJA 1N7EA 1MC7A 2Z9IA 2I1NA 2V1WA 1NF3C 4E34A 3O46A 3OU0A 2L4TA 3PV4A 1OBXA 3DORA 4JOHA 1RZXA 3ZRTA 1BE9A 3ID1A 3KDGA 2GEFA 2I0LA 2VPHA 1BFEA 2DJTA 2M0ZA 5FHTA 2JILA 4JOGA 4Q2NA 1N7TA 3GABA 1GQ4A 2H3MA 3ID2A 2PKUA 4JJ0A 3VQFA 3SOEA 3WKMA 1B8QA 2KJDA 5GLJA 3PV2A 3QO6A 2FNEA 2YUYA 4JOJA 5G1DA 2FE5A 2EJYA 1U38A 2H2CA 2M10A 3EGHC 4NNMA 5HEDA 5I7ZA 1VA8A 3L4FD 5DTHA 5HFDA 4NNLA 2GZVA 2EGKA 4P0CA 2D90A 3I18A 3FY5A 3KZDA 1UHPA 2EEIA 2O2TA 2JXOA 5HFBA 2EDPA 5HEBA 1Y8TA 3RL8A 2ENOA 4Z33A 2KOJA 2CSSA 4FLNA 2AWXA 5HETA 2OQSA 1VB7A 2K1ZA 5B42A 1R6JA 2OPGA 1PDRA 4WYTA 1W9EA 4FGMA 2KRGA 2VRFA 4REYA 2G5MB 1N6FA 3PDZA 3GSLA 1SOZA 1WIFA 1OZIA 4K75A 2AWUA 2KPKA 3QIKA 5F67A 4WYUA 3K1RA 2KQFA 3OTPA 2ZPMA 1TE0A 2DKRA 2OSGA 1V5LA 3CBYA 3WKLA 3DJ3A 4P2AB 2JINA 5E22A 2REYA 1UFXA 5HJ1A 1FCFA 2H3LA 3CBZA 2EAQA 1U37A 1WG6A 1ZUBA 4GHNA 5E21A 1UITA 4Q3HA 3TSWA 3LNYA 5B6LA 1X5RA 2F0AA 5HFFA 3GCNA 3KHFA 1WFVA 2YUBA 1X8SA 4RI0A 2OMJA 1UEZA 2D92A 2M0VA 1I16A 2F5YA 2M3MA 2X7ZA 2DAZA 2Q3GA 4NMTA 3SHUA 3DJ1A 4Z8JA 1X5QA 2YTWA 1WF7A 2QG1A 3JXTA 1RGWA 1W9QA 5FB8C 2DMZA 3CS0A 1QLCA 2I4SA 2KOMA 3TSZA 2DM8A 1GQ5A 2JREA 5EYZA 2KAWA 1TP3A 2DB5A 1UF1A 2BYGA 2EGNA 2PKTA 3K82A 1N7FA 5ILBA 1U39A 3QGLA 3CYYA 3CH8A 3SHWA 1VCWA 1ZOKA 3QJMA 3GJ9A 1X9ZA 4Q6SA 3GDVA 1KEFA 4JOPA 1YBOA 1V5QA 1OBYA 1WJLA 2EGOA 4Q6HA 2MX6A 2FN5A 2JSNA 2YT8A 1P1DA 2QKVA 2DLSA 3KZEA 3RLEA 4K6YA 4NMOA 3NCVA 1L6OA 2EV8A 4L8NA 5HFEA 2D8IA 1FC9A 1MFGA 4HOPA 1T2MA 4JJ3A 3DIWA 2VZ5A 3MH6A 5IL9A 2JWEA 1V1TA 2DC2A 3EGGC 1NTEA 2IWOA 1GM1A 4N6XA 3HPMA 4UU6A 2I04A 3R68A 2OS6A 2EHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA1 A;  3K50 A;  2EEH A;  4K78 A;  1V6B A;  2R4H A;  2P3W A;  3PV5 A;  2AIN A;  2QKU A;  5D13 A;  1WF8 A;  2UZC A;  2LUI A;  4PQW A;  2OGP A;  4NXP A;  5H3J A;  3NFK A;  5F3X A;  5HEY A;  2IWN A;  4JOR A;  1WI2 A;  3VQG A;  1Q3O A;  2EDZ A;  2LC7 A;  3I1E A;  1W9O A;  1XZ9 A;  2IWP A;  5GND A;  2HE4 A;  1VJ6 A;  4Q2P A;  1N6E A;  1X6D A;  2KG2 A;  1RY4 A;  1D5G A;  2K20 A;  4NMV A;  2EEG A;  4NXQ A;  1TQ3 A;  1UEQ A;  1Z86 A;  5E11 A;  1Q3P A;  3DJA A;  4E35 A;  4F8K A;  4YYX A;  2RRM A;  3HVQ C;  4KFV A;  5A2P A;  1KWA A;  1SOT A;  3R0H A;  1UEW A;  2ZPL A;  2KPL A;  2EXG A;  3B76 A;  5JXB A;  3RL7 A;  1X45 A;  4G69 A;  3SFJ A;  4O06 A;  2WL7 A;  1V62 A;  2Z17 A;  3LNX A;  4K76 A;  2KJK A;  1UM7 A;  4Q2O A;  2Q9V A;  1MFL A;  2CS5 A;  4JOK A;  2LC6 A;  2QBW A;  2H2B A;  3ID3 A;  1LCY A;  2VWR A;  3CC0 A;  2AWW A;  4OEO A;  2VSV A;  1Z87 A;  3E17 A;  2RCZ A;  2QKT A;  2HE2 A;  4NXR A;  4UU5 A;  5G1E A;  3R69 A;  2KJP A;  1I92 A;  1VAE A;  2DLU A;  3CBX A;  1OBZ A;  4E3B A;  2M0T A;  1WHA A;  2W7R A;  4OEP A;  4YDP A;  2I6V A;  4JOF A;  2VSP A;  3QE1 A;  1RGR A;  1Q7X A;  2KA9 A;  1KY9 A;  4HOP B;  2QT5 A;  2E7K A;  3I4W A;  1WH1 A;  3GDS A;  5HFC A;  5E1Y A;  4AMH A;  1U3B A;  5EZ0 A;  2PDZ A;  3AXA A;  2LA8 A;  3BPU A;  3GGE A;  1QAU A;  5HF1 A;  2KYL A;  2OZF A;  2LOB A;  2R3Y A;  1UJV A;  4OAJ A;  1WI4 A;  4NMR A;  4LMM A;  2W4F A;  4JOE A;  2OCS A;  1FC6 A;  5HDY A;  2HGA A;  1M5Z A;  2IWQ A;  3ID4 A;  2EDV A;  2MHO A;  4K72 A;  3TMH A;  1UEP A;  4GVD A;  2YT7 A;  1N99 A;  1WFG A;  3O5N A;  1QAV B;  1UJD A;  1FC7 A;  1TP5 A;  4Q2Q A;  4EDJ A;  1N6D A;  3MH4 A;  1Y7N A;  4R2Z A;  1X5N A;  2KL1 A;  2G2L A;  2JOA A;  1G9O A;  3STJ A;  1QAV A;  4IC6 A;  4XHV A;  3GDU A;  3TSV A;  2V90 A;  5HF4 A;  2JIK A;  2M0U A;  2PNT A;  3NGH A;  2L97 A;  3NFL A;  1UJU A;  3GCO A;  2KOH A;  2KBS A;  3QJN A;  1K32 A;  1UM1 A;  1IU0 A;  2L4S A;  1IHJ A;  4NMS A;  4JL7 A;  4H11 A;  3MH7 A;  1IU2 A;  3SUZ A;  3PS4 A;  4MPA A;  4NMQ A;  3PDV A;  3HPK A;  2FCF A;  5E6P B;  4KFW A;  3QDO A;  4GVC A;  2KV8 A;  2I0I A;  4NMP A;  2EEJ A;  1WHD A;  2PZD A;  1P1E A;  2CSJ A;  1N7E A;  1MC7 A;  2Z9I A;  2I1N A;  2V1W A;  1NF3 C;  4E34 A;  3O46 A;  3OU0 A;  2L4T A;  3PV4 A;  1OBX A;  3DOR A;  4JOH A;  1RZX A;  3ZRT A;  1BE9 A;  3ID1 A;  2I0L A;  2VPH A;  1BFE A;  2DJT A;  2M0Z A;  5FHT A;  2JIL A;  4JOG A;  4Q2N A;  1N7T A;  1GQ4 A;  2H3M A;  3ID2 A;  2PKU A;  3VQF A;  3SOE A;  3WKM A;  1B8Q A;  2KJD A;  5GLJ A;  3PV2 A;  3QO6 A;  2FNE A;  2YUY A;  4JOJ A;  5G1D A;  2FE5 A;  2EJY A;  1U38 A;  2H2C A;  2M10 A;  3EGH C;  4NNM A;  5HED A;  5I7Z A;  1VA8 A;  3L4F D;  5DTH A;  5HFD A;  4NNL A;  2GZV A;  2EGK A;  4P0C A;  2D90 A;  3I18 A;  3FY5 A;  3KZD A;  1UHP A;  2EEI A;  2O2T A;  2JXO A;  5HFB A;  2EDP A;  5HEB A;  1Y8T A;  3RL8 A;  2ENO A;  4Z33 A;  2KOJ A;  2CSS A;  2AWX A;  5HET A;  2OQS A;  1VB7 A;  2K1Z A;  1R6J A;  2OPG A;  1PDR A;  4WYT A;  1W9E A;  4FGM A;  2KRG A;  2VRF A;  4REY A;  2G5M B;  1N6F A;  3PDZ A;  3GSL A;  1SOZ A;  1WIF A;  1OZI A;  4K75 A;  2AWU A;  2KPK A;  3QIK A;  5F67 A;  4WYU A;  3K1R A;  2KQF A;  3OTP A;  2ZPM A;  1TE0 A;  2DKR A;  2OSG A;  1V5L A;  3CBY A;  3WKL A;  3DJ3 A;  4P2A B;  2JIN A;  5E22 A;  2REY A;  1UFX A;  5HJ1 A;  1FCF A;  2H3L A;  3CBZ A;  2EAQ A;  1U37 A;  1WG6 A;  1ZUB A;  4GHN A;  5E21 A;  1UIT A;  4Q3H A;  3TSW A;  3LNY A;  5B6L A;  1X5R A;  2F0A A;  5HFF A;  3GCN A;  3KHF A;  1WFV A;  2YUB A;  1X8S A;  4RI0 A;  2OMJ A;  1UEZ A;  2D92 A;  2M0V A;  1I16 A;  2F5Y A;  2M3M A;  2X7Z A;  2DAZ A;  2Q3G A;  4NMT A;  3SHU A;  3DJ1 A;  4Z8J A;  1X5Q A;  2YTW A;  1WF7 A;  2QG1 A;  3JXT A;  1RGW A;  1W9Q A;  5FB8 C;  2DMZ A;  3CS0 A;  1QLC A;  2I4S A;  2KOM A;  3TSZ A;  2DM8 A;  1GQ5 A;  2JRE A;  5EYZ A;  2KAW A;  1TP3 A;  2DB5 A;  1UF1 A;  2BYG A;  2EGN A;  2PKT A;  3K82 A;  1N7F A;  1U39 A;  3QGL A;  3CYY A;  3CH8 A;  3SHW A;  1VCW A;  1ZOK A;  3QJM A;  3GJ9 A;  4Q6S A;  3GDV A;  1KEF A;  4JOP A;  1YBO A;  1V5Q A;  1OBY A;  1WJL A;  2EGO A;  4Q6H A;  2MX6 A;  2FN5 A;  2YT8 A;  1P1D A;  2QKV A;  2DLS A;  3KZE A;  3RLE A;  4K6Y A;  4NMO A;  1L6O A;  2EV8 A;  4L8N A;  5HFE A;  2D8I A;  1FC9 A;  1MFG A;  4HOP A;  1T2M A;  3DIW A;  2VZ5 A;  3MH6 A;  2JWE A;  1V1T A;  2DC2 A;  3EGG C;  1NTE A;  2IWO A;  1GM1 A;  4N6X A;  3HPM A;  4UU6 A;  2I04 A;  3R68 A;  2OS6 A;  2EHR A; 
#chains in the Genus database with same CATH topology
 2PA1 A;  3K50 A;  2EEH A;  4K78 A;  1V6B A;  2R4H A;  2P3W A;  3PV5 A;  2AIN A;  2QKU A;  5D13 A;  1WF8 A;  2UZC A;  2LUI A;  4PQW A;  2OGP A;  4NXP A;  5H3J A;  3NFK A;  5F3X A;  5HEY A;  2IWN A;  4JOR A;  1WI2 A;  3VQG A;  1Q3O A;  2EDZ A;  2LC7 A;  3I1E A;  1W9O A;  1XZ9 A;  2IWP A;  5GND A;  2HE4 A;  1VJ6 A;  4Q2P A;  1N6E A;  1X6D A;  2KG2 A;  1RY4 A;  1D5G A;  2K20 A;  4NMV A;  2EEG A;  4NXQ A;  1TQ3 A;  1UEQ A;  1Z86 A;  5E11 A;  1Q3P A;  3DJA A;  4E35 A;  4F8K A;  4YYX A;  2RRM A;  3HVQ C;  4KFV A;  5A2P A;  1KWA A;  1SOT A;  3R0H A;  1UEW A;  2ZPL A;  2KPL A;  2EXG A;  3B76 A;  5JXB A;  3RL7 A;  1X45 A;  4G69 A;  3SFJ A;  4O06 A;  2WL7 A;  1V62 A;  2Z17 A;  3LNX A;  4K76 A;  2KJK A;  1UM7 A;  4Q2O A;  2Q9V A;  1MFL A;  2CS5 A;  4JOK A;  2LC6 A;  2QBW A;  2H2B A;  3ID3 A;  1LCY A;  2VWR A;  3CC0 A;  2AWW A;  4OEO A;  2VSV A;  1Z87 A;  3E17 A;  2RCZ A;  2QKT A;  2HE2 A;  4NXR A;  4UU5 A;  5G1E A;  3R69 A;  2KJP A;  1I92 A;  1VAE A;  2DLU A;  3CBX A;  1OBZ A;  4E3B A;  2M0T A;  1WHA A;  2W7R A;  4OEP A;  4YDP A;  2I6V A;  4JOF A;  2VSP A;  3QE1 A;  1RGR A;  1Q7X A;  2KA9 A;  1KY9 A;  4HOP B;  2QT5 A;  2E7K A;  3I4W A;  1WH1 A;  3GDS A;  5HFC A;  5E1Y A;  4AMH A;  1U3B A;  5EZ0 A;  2PDZ A;  3AXA A;  2LA8 A;  3BPU A;  3GGE A;  1QAU A;  5HF1 A;  2KYL A;  2OZF A;  2LOB A;  2R3Y A;  1UJV A;  4OAJ A;  1WI4 A;  4NMR A;  4LMM A;  2W4F A;  4JOE A;  2OCS A;  1FC6 A;  5HDY A;  2HGA A;  1M5Z A;  2IWQ A;  3ID4 A;  2EDV A;  2MHO A;  4K72 A;  3TMH A;  1UEP A;  4GVD A;  2YT7 A;  1N99 A;  1WFG A;  3O5N A;  1QAV B;  1UJD A;  1FC7 A;  1TP5 A;  4Q2Q A;  4EDJ A;  1N6D A;  3MH4 A;  1Y7N A;  4R2Z A;  1X5N A;  2KL1 A;  3KDK A;  2G2L A;  2JOA A;  1G9O A;  3STJ A;  1QAV A;  4IC6 A;  4XHV A;  3GDU A;  3TSV A;  2V90 A;  5HF4 A;  2JIK A;  2M0U A;  2PNT A;  3NGH A;  2L97 A;  3NFL A;  1UJU A;  3GCO A;  2KOH A;  2KBS A;  3QJN A;  1K32 A;  1UM1 A;  1IU0 A;  2L4S A;  1IHJ A;  4NMS A;  4JL7 A;  4H11 A;  3MH7 A;  1IU2 A;  3SUZ A;  3PS4 A;  4MPA A;  4NMQ A;  3PDV A;  3HPK A;  2FCF A;  5E6P B;  4KFW A;  3QDO A;  4GVC A;  2KV8 A;  2I0I A;  4NMP A;  2EEJ A;  1WHD A;  2PZD A;  1P1E A;  2CSJ A;  1N7E A;  1MC7 A;  2Z9I A;  2I1N A;  2V1W A;  1NF3 C;  4E34 A;  3O46 A;  3OU0 A;  2L4T A;  3PV4 A;  1OBX A;  3DOR A;  4JOH A;  1RZX A;  3ZRT A;  1BE9 A;  3ID1 A;  3KDG A;  2GEF A;  2I0L A;  2VPH A;  1BFE A;  2DJT A;  2M0Z A;  5FHT A;  2JIL A;  4JOG A;  4Q2N A;  1N7T A;  3GAB A;  1GQ4 A;  2H3M A;  3ID2 A;  2PKU A;  4JJ0 A;  3VQF A;  3SOE A;  3WKM A;  1B8Q A;  2KJD A;  5GLJ A;  3PV2 A;  3QO6 A;  2FNE A;  2YUY A;  4JOJ A;  5G1D A;  2FE5 A;  2EJY A;  1U38 A;  2H2C A;  2M10 A;  3EGH C;  4NNM A;  5HED A;  5I7Z A;  1VA8 A;  3L4F D;  5DTH A;  5HFD A;  4NNL A;  2GZV A;  2EGK A;  4P0C A;  2D90 A;  3I18 A;  3FY5 A;  3KZD A;  1UHP A;  2EEI A;  2O2T A;  2JXO A;  5HFB A;  2EDP A;  5HEB A;  1Y8T A;  3RL8 A;  2ENO A;  4Z33 A;  2KOJ A;  2CSS A;  4FLN A;  2AWX A;  5HET A;  2OQS A;  1VB7 A;  2K1Z A;  5B42 A;  1R6J A;  2OPG A;  1PDR A;  4WYT A;  1W9E A;  4FGM A;  2KRG A;  2VRF A;  4REY A;  2G5M B;  1N6F A;  3PDZ A;  3GSL A;  1SOZ A;  1WIF A;  1OZI A;  4K75 A;  2AWU A;  2KPK A;  3QIK A;  5F67 A;  4WYU A;  3K1R A;  2KQF A;  3OTP A;  2ZPM A;  1TE0 A;  2DKR A;  2OSG A;  1V5L A;  3CBY A;  3WKL A;  3DJ3 A;  4P2A B;  2JIN A;  5E22 A;  2REY A;  1UFX A;  5HJ1 A;  1FCF A;  2H3L A;  3CBZ A;  2EAQ A;  1U37 A;  1WG6 A;  1ZUB A;  4GHN A;  5E21 A;  1UIT A;  4Q3H A;  3TSW A;  3LNY A;  5B6L A;  1X5R A;  2F0A A;  5HFF A;  3GCN A;  3KHF A;  1WFV A;  2YUB A;  1X8S A;  4RI0 A;  2OMJ A;  1UEZ A;  2D92 A;  2M0V A;  1I16 A;  2F5Y A;  2M3M A;  2X7Z A;  2DAZ A;  2Q3G A;  4NMT A;  3SHU A;  3DJ1 A;  4Z8J A;  1X5Q A;  2YTW A;  1WF7 A;  2QG1 A;  3JXT A;  1RGW A;  1W9Q A;  5FB8 C;  2DMZ A;  3CS0 A;  1QLC A;  2I4S A;  2KOM A;  3TSZ A;  2DM8 A;  1GQ5 A;  2JRE A;  5EYZ A;  2KAW A;  1TP3 A;  2DB5 A;  1UF1 A;  2BYG A;  2EGN A;  2PKT A;  3K82 A;  1N7F A;  5ILB A;  1U39 A;  3QGL A;  3CYY A;  3CH8 A;  3SHW A;  1VCW A;  1ZOK A;  3QJM A;  3GJ9 A;  1X9Z A;  4Q6S A;  3GDV A;  1KEF A;  4JOP A;  1YBO A;  1V5Q A;  1OBY A;  1WJL A;  2EGO A;  4Q6H A;  2MX6 A;  2FN5 A;  2JSN A;  2YT8 A;  1P1D A;  2QKV A;  2DLS A;  3KZE A;  3RLE A;  4K6Y A;  4NMO A;  3NCV A;  1L6O A;  2EV8 A;  4L8N A;  5HFE A;  2D8I A;  1FC9 A;  1MFG A;  4HOP A;  1T2M A;  4JJ3 A;  3DIW A;  2VZ5 A;  3MH6 A;  5IL9 A;  2JWE A;  1V1T A;  2DC2 A;  3EGG C;  1NTE A;  2IWO A;  1GM1 A;  4N6X A;  3HPM A;  4UU6 A;  2I04 A;  3R68 A;  2OS6 A;  2EHR A; 
#chains in the Genus database with same CATH homology
 2PA1 A;  3K50 A;  2EEH A;  4K78 A;  1V6B A;  2R4H A;  2P3W A;  3PV5 A;  2AIN A;  2QKU A;  5D13 A;  1WF8 A;  2UZC A;  2LUI A;  4PQW A;  2OGP A;  4NXP A;  5H3J A;  3NFK A;  5F3X A;  5HEY A;  2IWN A;  4JOR A;  1WI2 A;  3VQG A;  1Q3O A;  2EDZ A;  2LC7 A;  3I1E A;  1W9O A;  1XZ9 A;  2IWP A;  5GND A;  2HE4 A;  1VJ6 A;  4Q2P A;  1N6E A;  1X6D A;  2KG2 A;  1RY4 A;  1D5G A;  2K20 A;  4NMV A;  2EEG A;  4NXQ A;  1TQ3 A;  1UEQ A;  1Z86 A;  5E11 A;  1Q3P A;  3DJA A;  4E35 A;  4F8K A;  4YYX A;  2RRM A;  3HVQ C;  4KFV A;  5A2P A;  1KWA A;  1SOT A;  3R0H A;  1UEW A;  2ZPL A;  2KPL A;  2EXG A;  3B76 A;  5JXB A;  3RL7 A;  1X45 A;  4G69 A;  3SFJ A;  4O06 A;  2WL7 A;  1V62 A;  2Z17 A;  3LNX A;  4K76 A;  2KJK A;  1UM7 A;  4Q2O A;  2Q9V A;  1MFL A;  2CS5 A;  4JOK A;  2LC6 A;  2QBW A;  2H2B A;  3ID3 A;  1LCY A;  2VWR A;  3CC0 A;  2AWW A;  4OEO A;  2VSV A;  1Z87 A;  3E17 A;  2RCZ A;  2QKT A;  2HE2 A;  4NXR A;  4UU5 A;  5G1E A;  3R69 A;  2KJP A;  1I92 A;  1VAE A;  2DLU A;  3CBX A;  1OBZ A;  4E3B A;  2M0T A;  1WHA A;  2W7R A;  4OEP A;  4YDP A;  2I6V A;  4JOF A;  2VSP A;  3QE1 A;  1RGR A;  1Q7X A;  2KA9 A;  1KY9 A;  4HOP B;  2QT5 A;  2E7K A;  3I4W A;  1WH1 A;  3GDS A;  5HFC A;  5E1Y A;  4AMH A;  1U3B A;  5EZ0 A;  2PDZ A;  3AXA A;  2LA8 A;  3BPU A;  3GGE A;  1QAU A;  5HF1 A;  2KYL A;  2OZF A;  2LOB A;  2R3Y A;  1UJV A;  4OAJ A;  1WI4 A;  4NMR A;  4LMM A;  2W4F A;  4JOE A;  2OCS A;  1FC6 A;  5HDY A;  2HGA A;  1M5Z A;  2IWQ A;  3ID4 A;  2EDV A;  2MHO A;  4K72 A;  3TMH A;  1UEP A;  4GVD A;  2YT7 A;  1N99 A;  1WFG A;  3O5N A;  1QAV B;  1UJD A;  1FC7 A;  1TP5 A;  4Q2Q A;  4EDJ A;  1N6D A;  3MH4 A;  1Y7N A;  4R2Z A;  1X5N A;  2KL1 A;  3KDK A;  2G2L A;  2JOA A;  1G9O A;  3STJ A;  1QAV A;  4IC6 A;  4XHV A;  3GDU A;  3TSV A;  2V90 A;  5HF4 A;  2JIK A;  2M0U A;  2PNT A;  3NGH A;  2L97 A;  3NFL A;  1UJU A;  3GCO A;  2KOH A;  2KBS A;  3QJN A;  1K32 A;  1UM1 A;  1IU0 A;  2L4S A;  1IHJ A;  4NMS A;  4JL7 A;  4H11 A;  3MH7 A;  1IU2 A;  3SUZ A;  3PS4 A;  4MPA A;  4NMQ A;  3PDV A;  3HPK A;  2FCF A;  5E6P B;  4KFW A;  3QDO A;  4GVC A;  2KV8 A;  2I0I A;  4NMP A;  2EEJ A;  1WHD A;  2PZD A;  1P1E A;  2CSJ A;  1N7E A;  1MC7 A;  2Z9I A;  2I1N A;  2V1W A;  1NF3 C;  4E34 A;  3O46 A;  3OU0 A;  2L4T A;  3PV4 A;  1OBX A;  3DOR A;  4JOH A;  1RZX A;  3ZRT A;  1BE9 A;  3ID1 A;  3KDG A;  2GEF A;  2I0L A;  2VPH A;  1BFE A;  2DJT A;  2M0Z A;  5FHT A;  2JIL A;  4JOG A;  4Q2N A;  1N7T A;  3GAB A;  1GQ4 A;  2H3M A;  3ID2 A;  2PKU A;  4JJ0 A;  3VQF A;  3SOE A;  3WKM A;  1B8Q A;  2KJD A;  5GLJ A;  3PV2 A;  3QO6 A;  2FNE A;  2YUY A;  4JOJ A;  5G1D A;  2FE5 A;  2EJY A;  1U38 A;  2H2C A;  2M10 A;  3EGH C;  4NNM A;  5HED A;  5I7Z A;  1VA8 A;  3L4F D;  5DTH A;  5HFD A;  4NNL A;  2GZV A;  2EGK A;  4P0C A;  2D90 A;  3I18 A;  3FY5 A;  3KZD A;  1UHP A;  2EEI A;  2O2T A;  2JXO A;  5HFB A;  2EDP A;  5HEB A;  1Y8T A;  3RL8 A;  2ENO A;  4Z33 A;  2KOJ A;  2CSS A;  4FLN A;  2AWX A;  5HET A;  2OQS A;  1VB7 A;  2K1Z A;  5B42 A;  1R6J A;  2OPG A;  1PDR A;  4WYT A;  1W9E A;  4FGM A;  2KRG A;  2VRF A;  4REY A;  2G5M B;  1N6F A;  3PDZ A;  3GSL A;  1SOZ A;  1WIF A;  1OZI A;  4K75 A;  2AWU A;  2KPK A;  3QIK A;  5F67 A;  4WYU A;  3K1R A;  2KQF A;  3OTP A;  2ZPM A;  1TE0 A;  2DKR A;  2OSG A;  1V5L A;  3CBY A;  3WKL A;  3DJ3 A;  4P2A B;  2JIN A;  5E22 A;  2REY A;  1UFX A;  5HJ1 A;  1FCF A;  2H3L A;  3CBZ A;  2EAQ A;  1U37 A;  1WG6 A;  1ZUB A;  4GHN A;  5E21 A;  1UIT A;  4Q3H A;  3TSW A;  3LNY A;  5B6L A;  1X5R A;  2F0A A;  5HFF A;  3GCN A;  3KHF A;  1WFV A;  2YUB A;  1X8S A;  4RI0 A;  2OMJ A;  1UEZ A;  2D92 A;  2M0V A;  1I16 A;  2F5Y A;  2M3M A;  2X7Z A;  2DAZ A;  2Q3G A;  4NMT A;  3SHU A;  3DJ1 A;  4Z8J A;  1X5Q A;  2YTW A;  1WF7 A;  2QG1 A;  3JXT A;  1RGW A;  1W9Q A;  5FB8 C;  2DMZ A;  3CS0 A;  1QLC A;  2I4S A;  2KOM A;  3TSZ A;  2DM8 A;  1GQ5 A;  2JRE A;  5EYZ A;  2KAW A;  1TP3 A;  2DB5 A;  1UF1 A;  2BYG A;  2EGN A;  2PKT A;  3K82 A;  1N7F A;  5ILB A;  1U39 A;  3QGL A;  3CYY A;  3CH8 A;  3SHW A;  1VCW A;  1ZOK A;  3QJM A;  3GJ9 A;  1X9Z A;  4Q6S A;  3GDV A;  1KEF A;  4JOP A;  1YBO A;  1V5Q A;  1OBY A;  1WJL A;  2EGO A;  4Q6H A;  2MX6 A;  2FN5 A;  2JSN A;  2YT8 A;  1P1D A;  2QKV A;  2DLS A;  3KZE A;  3RLE A;  4K6Y A;  4NMO A;  3NCV A;  1L6O A;  2EV8 A;  4L8N A;  5HFE A;  2D8I A;  1FC9 A;  1MFG A;  4HOP A;  1T2M A;  4JJ3 A;  3DIW A;  2VZ5 A;  3MH6 A;  5IL9 A;  2JWE A;  1V1T A;  2DC2 A;  3EGG C;  1NTE A;  2IWO A;  1GM1 A;  4N6X A;  3HPM A;  4UU6 A;  2I04 A;  3R68 A;  2OS6 A;  2EHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...