1ZUBA

Solution structure of the rim1alpha pdz domain in complex with an elks1b c-terminal peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
109
structure length
109
Chain Sequence
b'HPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulating synaptic membrane exocytosis protein 1
publication title Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 13
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1zubA00
3R68A 2JILA 1RGRA 2KV8A 3QGLA 1QLCA 1UITA 3QIKA 4NNMA 1XZ9A 3GCNA 2O2TA 4AMHA 2JOAA 1TQ3A 2KYLA 4NMVA 1U38A 3BPUA 1WHDA 2WL7A 4WYUA 1W9EA 2REYA 3CBYA 5JXBA 1GQ5A 4YYXA 1NF3C 5HFBA 1OBYA 1Q3PA 2PNTA 3PV4A 3GCOA 3SHWA 1UEQA 1U37A 3AXAA 2P3WA 1N6DA 5DTHA 4JORA 2MX6A 4K78A 2I6VA 3RL8A 2D92A 1I16A 1V1TA 2W4FA 1I92A 2KOJA 2OPGA 1N7TA 5G1DA 4JOHA 1X5NA 4Q3HA 1WJLA 2AINA 1GM1A 2QBWA 1KWAA 2L97A 4K75A 2EDVA 2EHRA 2M0TA 3NFLA 2PKUA 3VQGA 2FCFA 2RRMA 2VWRA 2FNEA 4NMSA 3MH6A 4GHNA 3TSVA 1UHPA 3CBZA 1UJVA 4REYA 1WI2A 1OBXA 2F5YA 1WH1A 3EGGC 5HEYA 2D90A 2IWNA 3MH7A 5FHTA 4F8KA 2EGNA 4H11A 4FGMA 2IWOA 2YTWA 3PDVA 5HETA 1WF7A 2KQFA 3ID1A 5EZ0A 2OQSA 2IWPA 3PV5A 2JIKA 4GVDA 4YDPA 2KJDA 4P2AB 3QE1A 3MH4A 2PKTA 1N7FA 2KJKA 4OEOA 2DM8A 1QAUA 2M0UA 5D13A 3O46A 5FB8C 1BFEA 1V5QA 2EDPA 3R0HA 2EEGA 5EYZA 3E17A 3CC0A 1X8SA 2H3MA 3WKMA 2L4SA 4P0CA 3ZRTA 2HE4A 1RY4A 4UU6A 2CSJA 5HF4A 4R2ZA 2DB5A 2Z17A 2EEJA 2KPLA 3JXTA 3QO6A 2X7ZA 1YBOA 2RCZA 2JINA 2DKRA 2LA8A 3NFKA 1Z87A 2QT5A 2YUYA 2OSGA 1VAEA 3DJ1A 1IU2A 3GSLA 4JOGA 1WG6A 2KJPA 2L4TA 2KA9A 4OEPA 1Q3OA 3SFJA 3B76A 1U39A 2LC7A 3PS4A 4UU5A 1FC6A 2G5MB 3SUZA 1N99A 1WI4A 1VB7A 3O5NA 5HEDA 2KRGA 4KFWA 1W9OA 2KL1A 3K82A 1U3BA 1OBZA 1WF8A 2H2BA 1QAVA 5E21A 5E11A 1BE9A 4NMTA 3LNYA 1N6FA 1X6DA 1MFGA 3PV2A 3VQFA 2JREA 2OMJA 3CH8A 2EGOA 2YT7A 2AWXA 1WIFA 3RL7A 2EDZA 2EJYA 2Q9VA 1R6JA 2DMZA 2DLUA 1M5ZA 3DJAA 3K1RA 2CSSA 3DJ3A 4Q2NA 5HFDA 3CYYA 3QJNA 3CBXA 1ZOKA 4O06A 3OU0A 1W9QA 5HDYA 2KOMA 2FE5A 4Q2PA 2HE2A 1NTEA 2UZCA 5HF1A 2EAQA 2R3YA 4Q6SA 2QKVA 3GDSA 4E34A 1UEPA 4E3BA 3DORA 1IU0A 4Q6HA 1D5GA 3ID2A 1TP3A 1Q7XA 2PA1A 5E6PB 2ENOA 1UM7A 1WHAA 3NGHA 2YUBA 5HFCA 1V6BA 2GZVA 1FC7A 4K76A 4PQWA 2JWEA 4NMRA 3FY5A 4NMOA 2M3MA 4XHVA 1L6OA 4E35A 2I0IA 1TP5A 5E1YA 1QAVB 4EDJA 2I0LA 4Q2QA 1MC7A 1VJ6A 3K50A 4NXRA 1PDRA 3KZDA 2DJTA 5HFEA 2PZDA 4KFVA 1Y8TA 1V5LA 3GDVA 4K6YA 5A2PA 1UJDA 4JL7A 4IC6A 5HEBA 2DLSA 1UF1A 2VPHA 4JOPA 1VA8A 2EXGA 5HJ1A 1N6EA 1KY9A 2EEIA 2KPKA 3GDUA 5GNDA 1GQ4A 2PDZA 1V62A 3QDOA 5I7ZA 4LMMA 2LOBA 4RI0A 2KOHA 2OS6A 2KG2A 4NXPA 5HFFA 2DAZA 3KZEA 4HOPA 1Z86A 2AWUA 1IHJA 2AWWA 2IWQA 3SHUA 2JXOA 2LC6A 2R4HA 2V90A 2VZ5A 3KHFA 2I4SA 2OCSA 2ZPLA 1X5RA 4Z33A 5GLJA 2FN5A 1SOTA 2EEHA 1UEWA 2KAWA 2KBSA 3WKLA 2K1ZA 4NNLA 3I4WA 3R69A 1X45A 1K32A 3DIWA 1RGWA 3CS0A 4GVCA 1UFXA 2H3LA 3ID4A 1B8QA 1OZIA 1FCFA 1X5QA 4JOEA 1TE0A 2K20A 2LUIA 2W7RA 1UM1A 3SOEA 3HVQC 1T2MA 5B6LA 2VRFA 2M10A 3I18A 5G1EA 2OZFA 3HPKA 2HGAA 4HOPB 3GGEA 4Q2OA 4NXQA 2F0AA 1WFGA 1P1EA 2MHOA 2QG1A 3OTPA 1G9OA 2EGKA 2VSVA 3I1EA 2I1NA 4K72A 4G69A 1ZUBA 3HPMA 2VSPA 2E7KA 3TSWA 4WYTA 1LCYA 1WFVA 1KEFA 1N7EA 4OAJA 3TSZA 4Z8JA 2M0ZA 2I04A 4N6XA 4JOKA 1SOZA 3RLEA 3L4FD 2YT8A 1RZXA 1UJUA 5F67A 2M0VA 2G2LA 1MFLA 4JOJA 1VCWA 3GJ9A 3QJMA 5H3JA 2OGPA 2V1WA 3ID3A 5F3XA 4NMQA 3LNXA 2QKUA 2Q3GA 3PDZA 2DC2A 3EGHC 2EV8A 5E22A 1FC9A 1UEZA 2H2CA 2BYGA 4MPAA 2D8IA 2ZPMA 2CS5A 4NMPA 1Y7NA 3STJA 4JOFA 1P1DA 2Z9IA 3TMHA 2QKTA 4L8NA
chains in the Genus database with same CATH superfamily
3R68A 2JILA 1RGRA 2KV8A 3QGLA 1QLCA 1UITA 3QIKA 4NNMA 1XZ9A 3GCNA 2O2TA 4AMHA 2JOAA 1TQ3A 2KYLA 4NMVA 1U38A 3BPUA 1WHDA 2WL7A 4WYUA 1W9EA 2REYA 3CBYA 5JXBA 1GQ5A 4YYXA 1NF3C 5HFBA 1OBYA 1Q3PA 2PNTA 3PV4A 3GCOA 3SHWA 1UEQA 1U37A 3AXAA 2P3WA 1N6DA 5DTHA 4JORA 2MX6A 4K78A 2I6VA 3RL8A 2D92A 1I16A 1V1TA 2W4FA 1I92A 2KOJA 2OPGA 1N7TA 5G1DA 4JOHA 1X5NA 4Q3HA 1WJLA 2AINA 1GM1A 2QBWA 1KWAA 2L97A 4K75A 2EDVA 2EHRA 2M0TA 3NFLA 2PKUA 3VQGA 2FCFA 2RRMA 2VWRA 2FNEA 4NMSA 3MH6A 4GHNA 3TSVA 1UHPA 3CBZA 1UJVA 4REYA 1WI2A 1OBXA 2F5YA 1WH1A 3EGGC 5HEYA 2D90A 2IWNA 4FLNA 3MH7A 5FHTA 4F8KA 2EGNA 5B42A 4H11A 4FGMA 2IWOA 2YTWA 3PDVA 5HETA 1WF7A 2KQFA 3ID1A 3NCVA 5EZ0A 2OQSA 2IWPA 3PV5A 2JIKA 4GVDA 4YDPA 2KJDA 4P2AB 3QE1A 3MH4A 2PKTA 4JJ0A 1N7FA 2KJKA 4OEOA 2DM8A 1QAUA 2M0UA 5D13A 3O46A 5FB8C 1BFEA 1V5QA 2EDPA 3R0HA 2EEGA 4JJ3A 5EYZA 3E17A 3CC0A 1X8SA 2H3MA 3WKMA 2L4SA 4P0CA 3ZRTA 2HE4A 1RY4A 4UU6A 2CSJA 5HF4A 4R2ZA 2DB5A 2Z17A 2EEJA 2KPLA 3JXTA 3QO6A 2X7ZA 1YBOA 2RCZA 3KDKA 2JINA 2DKRA 2LA8A 3NFKA 1Z87A 2QT5A 2YUYA 2OSGA 1VAEA 3DJ1A 1IU2A 3GSLA 4JOGA 1WG6A 2KJPA 2L4TA 2KA9A 4OEPA 1Q3OA 3SFJA 3B76A 1U39A 2LC7A 3PS4A 4UU5A 1FC6A 2G5MB 3SUZA 1N99A 1WI4A 1VB7A 3O5NA 5HEDA 2KRGA 4KFWA 1W9OA 2KL1A 3K82A 1U3BA 1OBZA 1WF8A 2H2BA 5ILBA 1QAVA 5E21A 5E11A 1BE9A 4NMTA 3LNYA 1N6FA 1X6DA 1MFGA 3PV2A 3VQFA 2JREA 2OMJA 3CH8A 2EGOA 2YT7A 2AWXA 1WIFA 3RL7A 2EDZA 2EJYA 2Q9VA 1X9ZA 1R6JA 2DMZA 2DLUA 1M5ZA 3DJAA 3K1RA 2CSSA 3DJ3A 4Q2NA 5HFDA 3CYYA 3QJNA 3CBXA 1ZOKA 4O06A 3OU0A 1W9QA 5HDYA 2KOMA 2FE5A 4Q2PA 2HE2A 1NTEA 2UZCA 5HF1A 2EAQA 2R3YA 4Q6SA 2QKVA 3GDSA 4E34A 1UEPA 4E3BA 3DORA 1IU0A 3KDGA 4Q6HA 1D5GA 3ID2A 1TP3A 1Q7XA 2PA1A 5E6PB 2ENOA 1UM7A 1WHAA 3NGHA 2YUBA 5HFCA 1V6BA 2GZVA 1FC7A 4K76A 4PQWA 2JWEA 4NMRA 3FY5A 4NMOA 2M3MA 4XHVA 1L6OA 4E35A 2I0IA 2JSNA 1TP5A 5E1YA 1QAVB 4EDJA 2I0LA 4Q2QA 1MC7A 1VJ6A 3K50A 4NXRA 1PDRA 3KZDA 2DJTA 5HFEA 2PZDA 4KFVA 1Y8TA 1V5LA 3GDVA 4K6YA 5A2PA 1UJDA 4JL7A 4IC6A 5HEBA 2DLSA 1UF1A 2VPHA 4JOPA 1VA8A 2EXGA 5HJ1A 1N6EA 1KY9A 2EEIA 2KPKA 3GDUA 5GNDA 1GQ4A 2PDZA 1V62A 3QDOA 5I7ZA 4LMMA 2LOBA 4RI0A 2KOHA 2OS6A 2KG2A 4NXPA 5HFFA 2DAZA 3KZEA 4HOPA 5IL9A 1Z86A 2AWUA 1IHJA 2AWWA 2IWQA 3SHUA 2JXOA 2LC6A 2R4HA 2V90A 2VZ5A 3KHFA 2I4SA 2OCSA 2ZPLA 1X5RA 4Z33A 5GLJA 2FN5A 1SOTA 2EEHA 1UEWA 2KAWA 2KBSA 3WKLA 2K1ZA 4NNLA 3I4WA 3R69A 1X45A 1K32A 3DIWA 1RGWA 3CS0A 4GVCA 1UFXA 2H3LA 3ID4A 1B8QA 1OZIA 1FCFA 1X5QA 4JOEA 1TE0A 2K20A 2LUIA 2W7RA 1UM1A 3SOEA 3HVQC 1T2MA 5B6LA 2VRFA 2M10A 3I18A 5G1EA 2OZFA 3HPKA 2HGAA 4HOPB 3GGEA 4Q2OA 4NXQA 2F0AA 1WFGA 1P1EA 2MHOA 2QG1A 3OTPA 1G9OA 2EGKA 2VSVA 3I1EA 2I1NA 4K72A 4G69A 1ZUBA 3HPMA 2VSPA 2E7KA 3TSWA 4WYTA 1LCYA 1WFVA 1KEFA 1N7EA 4OAJA 3TSZA 4Z8JA 2M0ZA 2I04A 4N6XA 4JOKA 1SOZA 3RLEA 3L4FD 2YT8A 1RZXA 1UJUA 5F67A 2M0VA 2G2LA 1MFLA 4JOJA 1VCWA 3GJ9A 3QJMA 5H3JA 2OGPA 2V1WA 3ID3A 5F3XA 4NMQA 3LNXA 2QKUA 2Q3GA 3PDZA 2DC2A 3EGHC 2EV8A 2GEFA 5E22A 1FC9A 1UEZA 2H2CA 2BYGA 4MPAA 3GABA 2D8IA 2ZPMA 2CS5A 4NMPA 1Y7NA 3STJA 4JOFA 1P1DA 2Z9IA 3TMHA 2QKTA 4L8NA
chains in the Genus database with same CATH topology
3R68A 2JILA 1RGRA 2KV8A 3QGLA 1QLCA 1UITA 3QIKA 4NNMA 1XZ9A 3GCNA 2O2TA 4AMHA 2JOAA 1TQ3A 2KYLA 4NMVA 1U38A 3BPUA 1WHDA 2WL7A 4WYUA 1W9EA 2REYA 3CBYA 5JXBA 1GQ5A 4YYXA 1NF3C 5HFBA 1OBYA 1Q3PA 2PNTA 3PV4A 3GCOA 3SHWA 1UEQA 1U37A 3AXAA 2P3WA 1N6DA 5DTHA 4JORA 2MX6A 4K78A 2I6VA 3RL8A 2D92A 1I16A 1V1TA 2W4FA 1I92A 2KOJA 2OPGA 1N7TA 5G1DA 4JOHA 1X5NA 4Q3HA 1WJLA 2AINA 1GM1A 2QBWA 1KWAA 2L97A 4K75A 2EDVA 2EHRA 2M0TA 3NFLA 2PKUA 3VQGA 2FCFA 2RRMA 2VWRA 2FNEA 4NMSA 3MH6A 4GHNA 3TSVA 1UHPA 3CBZA 1UJVA 4REYA 1WI2A 1OBXA 2F5YA 1WH1A 3EGGC 5HEYA 2D90A 2IWNA 4FLNA 3MH7A 5FHTA 4F8KA 2EGNA 5B42A 4H11A 4FGMA 2IWOA 2YTWA 3PDVA 5HETA 1WF7A 2KQFA 3ID1A 3NCVA 5EZ0A 2OQSA 2IWPA 3PV5A 2JIKA 4GVDA 4YDPA 2KJDA 4P2AB 3QE1A 3MH4A 2PKTA 4JJ0A 1N7FA 2KJKA 4OEOA 2DM8A 1QAUA 2M0UA 5D13A 3O46A 5FB8C 1BFEA 1V5QA 2EDPA 3R0HA 2EEGA 4JJ3A 5EYZA 3E17A 3CC0A 1X8SA 2H3MA 3WKMA 2L4SA 4P0CA 3ZRTA 2HE4A 1RY4A 4UU6A 2CSJA 5HF4A 4R2ZA 2DB5A 2Z17A 2EEJA 2KPLA 3JXTA 3QO6A 2X7ZA 1YBOA 2RCZA 3KDKA 2JINA 2DKRA 2LA8A 3NFKA 1Z87A 2QT5A 2YUYA 2OSGA 1VAEA 3DJ1A 1IU2A 3GSLA 4JOGA 1WG6A 2KJPA 2L4TA 2KA9A 4OEPA 1Q3OA 3SFJA 3B76A 1U39A 2LC7A 3PS4A 4UU5A 1FC6A 2G5MB 3SUZA 1N99A 1WI4A 1VB7A 3O5NA 5HEDA 2KRGA 4KFWA 1W9OA 2KL1A 3K82A 1U3BA 1OBZA 1WF8A 2H2BA 5ILBA 1QAVA 5E21A 5E11A 1BE9A 4NMTA 3LNYA 1N6FA 1X6DA 1MFGA 3PV2A 3VQFA 2JREA 2OMJA 3CH8A 2EGOA 2YT7A 2AWXA 1WIFA 3RL7A 2EDZA 2EJYA 2Q9VA 1X9ZA 1R6JA 2DMZA 2DLUA 1M5ZA 3DJAA 3K1RA 2CSSA 3DJ3A 4Q2NA 5HFDA 3CYYA 3QJNA 3CBXA 1ZOKA 4O06A 3OU0A 1W9QA 5HDYA 2KOMA 2FE5A 4Q2PA 2HE2A 1NTEA 2UZCA 5HF1A 2EAQA 2R3YA 4Q6SA 2QKVA 3GDSA 4E34A 1UEPA 4E3BA 3DORA 1IU0A 3KDGA 4Q6HA 1D5GA 3ID2A 1TP3A 1Q7XA 2PA1A 5E6PB 2ENOA 1UM7A 1WHAA 3NGHA 2YUBA 5HFCA 1V6BA 2GZVA 1FC7A 4K76A 4PQWA 2JWEA 4NMRA 3FY5A 4NMOA 2M3MA 4XHVA 1L6OA 4E35A 2I0IA 2JSNA 1TP5A 5E1YA 1QAVB 4EDJA 2I0LA 4Q2QA 1MC7A 1VJ6A 3K50A 4NXRA 1PDRA 3KZDA 2DJTA 5HFEA 2PZDA 4KFVA 1Y8TA 1V5LA 3GDVA 4K6YA 5A2PA 1UJDA 4JL7A 4IC6A 5HEBA 2DLSA 1UF1A 2VPHA 4JOPA 1VA8A 2EXGA 5HJ1A 1N6EA 1KY9A 2EEIA 2KPKA 3GDUA 5GNDA 1GQ4A 2PDZA 1V62A 3QDOA 5I7ZA 4LMMA 2LOBA 4RI0A 2KOHA 2OS6A 2KG2A 4NXPA 5HFFA 2DAZA 3KZEA 4HOPA 5IL9A 1Z86A 2AWUA 1IHJA 2AWWA 2IWQA 3SHUA 2JXOA 2LC6A 2R4HA 2V90A 2VZ5A 3KHFA 2I4SA 2OCSA 2ZPLA 1X5RA 4Z33A 5GLJA 2FN5A 1SOTA 2EEHA 1UEWA 2KAWA 2KBSA 3WKLA 2K1ZA 4NNLA 3I4WA 3R69A 1X45A 1K32A 3DIWA 1RGWA 3CS0A 4GVCA 1UFXA 2H3LA 3ID4A 1B8QA 1OZIA 1FCFA 1X5QA 4JOEA 1TE0A 2K20A 2LUIA 2W7RA 1UM1A 3SOEA 3HVQC 1T2MA 5B6LA 2VRFA 2M10A 3I18A 5G1EA 2OZFA 3HPKA 2HGAA 4HOPB 3GGEA 4Q2OA 4NXQA 2F0AA 1WFGA 1P1EA 2MHOA 2QG1A 3OTPA 1G9OA 2EGKA 2VSVA 3I1EA 2I1NA 4K72A 4G69A 1ZUBA 3HPMA 2VSPA 2E7KA 3TSWA 4WYTA 1LCYA 1WFVA 1KEFA 1N7EA 4OAJA 3TSZA 4Z8JA 2M0ZA 2I04A 4N6XA 4JOKA 1SOZA 3RLEA 3L4FD 2YT8A 1RZXA 1UJUA 5F67A 2M0VA 2G2LA 1MFLA 4JOJA 1VCWA 3GJ9A 3QJMA 5H3JA 2OGPA 2V1WA 3ID3A 5F3XA 4NMQA 3LNXA 2QKUA 2Q3GA 3PDZA 2DC2A 3EGHC 2EV8A 2GEFA 5E22A 1FC9A 1UEZA 2H2CA 2BYGA 4MPAA 3GABA 2D8IA 2ZPMA 2CS5A 4NMPA 1Y7NA 3STJA 4JOFA 1P1DA 2Z9IA 3TMHA 2QKTA 4L8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R68 A;  2JIL A;  1RGR A;  2KV8 A;  3QGL A;  1QLC A;  1UIT A;  3QIK A;  4NNM A;  1XZ9 A;  3GCN A;  2O2T A;  4AMH A;  2JOA A;  1TQ3 A;  2KYL A;  4NMV A;  1U38 A;  3BPU A;  1WHD A;  2WL7 A;  4WYU A;  1W9E A;  2REY A;  3CBY A;  5JXB A;  1GQ5 A;  4YYX A;  1NF3 C;  5HFB A;  1OBY A;  1Q3P A;  2PNT A;  3PV4 A;  3GCO A;  3SHW A;  1UEQ A;  1U37 A;  3AXA A;  2P3W A;  1N6D A;  5DTH A;  4JOR A;  2MX6 A;  4K78 A;  2I6V A;  3RL8 A;  2D92 A;  1I16 A;  1V1T A;  2W4F A;  1I92 A;  2KOJ A;  2OPG A;  1N7T A;  5G1D A;  4JOH A;  1X5N A;  4Q3H A;  1WJL A;  2AIN A;  1GM1 A;  2QBW A;  1KWA A;  2L97 A;  4K75 A;  2EDV A;  2EHR A;  2M0T A;  3NFL A;  2PKU A;  3VQG A;  2FCF A;  2RRM A;  2VWR A;  2FNE A;  4NMS A;  3MH6 A;  4GHN A;  3TSV A;  1UHP A;  3CBZ A;  1UJV A;  4REY A;  1WI2 A;  1OBX A;  2F5Y A;  1WH1 A;  3EGG C;  5HEY A;  2D90 A;  2IWN A;  3MH7 A;  5FHT A;  4F8K A;  2EGN A;  4H11 A;  4FGM A;  2IWO A;  2YTW A;  3PDV A;  5HET A;  1WF7 A;  2KQF A;  3ID1 A;  5EZ0 A;  2OQS A;  2IWP A;  3PV5 A;  2JIK A;  4GVD A;  4YDP A;  2KJD A;  4P2A B;  3QE1 A;  3MH4 A;  2PKT A;  1N7F A;  2KJK A;  4OEO A;  2DM8 A;  1QAU A;  2M0U A;  5D13 A;  3O46 A;  5FB8 C;  1BFE A;  1V5Q A;  2EDP A;  3R0H A;  2EEG A;  5EYZ A;  3E17 A;  3CC0 A;  1X8S A;  2H3M A;  3WKM A;  2L4S A;  4P0C A;  3ZRT A;  2HE4 A;  1RY4 A;  4UU6 A;  2CSJ A;  5HF4 A;  4R2Z A;  2DB5 A;  2Z17 A;  2EEJ A;  2KPL A;  3JXT A;  3QO6 A;  2X7Z A;  1YBO A;  2RCZ A;  2JIN A;  2DKR A;  2LA8 A;  3NFK A;  1Z87 A;  2QT5 A;  2YUY A;  2OSG A;  1VAE A;  3DJ1 A;  1IU2 A;  3GSL A;  4JOG A;  1WG6 A;  2KJP A;  2L4T A;  2KA9 A;  4OEP A;  1Q3O A;  3SFJ A;  3B76 A;  1U39 A;  2LC7 A;  3PS4 A;  4UU5 A;  1FC6 A;  2G5M B;  3SUZ A;  1N99 A;  1WI4 A;  1VB7 A;  3O5N A;  5HED A;  2KRG A;  4KFW A;  1W9O A;  2KL1 A;  3K82 A;  1U3B A;  1OBZ A;  1WF8 A;  2H2B A;  1QAV A;  5E21 A;  5E11 A;  1BE9 A;  4NMT A;  3LNY A;  1N6F A;  1X6D A;  1MFG A;  3PV2 A;  3VQF A;  2JRE A;  2OMJ A;  3CH8 A;  2EGO A;  2YT7 A;  2AWX A;  1WIF A;  3RL7 A;  2EDZ A;  2EJY A;  2Q9V A;  1R6J A;  2DMZ A;  2DLU A;  1M5Z A;  3DJA A;  3K1R A;  2CSS A;  3DJ3 A;  4Q2N A;  5HFD A;  3CYY A;  3QJN A;  3CBX A;  1ZOK A;  4O06 A;  3OU0 A;  1W9Q A;  5HDY A;  2KOM A;  2FE5 A;  4Q2P A;  2HE2 A;  1NTE A;  2UZC A;  5HF1 A;  2EAQ A;  2R3Y A;  4Q6S A;  2QKV A;  3GDS A;  4E34 A;  1UEP A;  4E3B A;  3DOR A;  1IU0 A;  4Q6H A;  1D5G A;  3ID2 A;  1TP3 A;  1Q7X A;  2PA1 A;  5E6P B;  2ENO A;  1UM7 A;  1WHA A;  3NGH A;  2YUB A;  5HFC A;  1V6B A;  2GZV A;  1FC7 A;  4K76 A;  4PQW A;  2JWE A;  4NMR A;  3FY5 A;  4NMO A;  2M3M A;  4XHV A;  1L6O A;  4E35 A;  2I0I A;  1TP5 A;  5E1Y A;  1QAV B;  4EDJ A;  2I0L A;  4Q2Q A;  1MC7 A;  1VJ6 A;  3K50 A;  4NXR A;  1PDR A;  3KZD A;  2DJT A;  5HFE A;  2PZD A;  4KFV A;  1Y8T A;  1V5L A;  3GDV A;  4K6Y A;  5A2P A;  1UJD A;  4JL7 A;  4IC6 A;  5HEB A;  2DLS A;  1UF1 A;  2VPH A;  4JOP A;  1VA8 A;  2EXG A;  5HJ1 A;  1N6E A;  1KY9 A;  2EEI A;  2KPK A;  3GDU A;  5GND A;  1GQ4 A;  2PDZ A;  1V62 A;  3QDO A;  5I7Z A;  4LMM A;  2LOB A;  4RI0 A;  2KOH A;  2OS6 A;  2KG2 A;  4NXP A;  5HFF A;  2DAZ A;  3KZE A;  4HOP A;  1Z86 A;  2AWU A;  1IHJ A;  2AWW A;  2IWQ A;  3SHU A;  2JXO A;  2LC6 A;  2R4H A;  2V90 A;  2VZ5 A;  3KHF A;  2I4S A;  2OCS A;  2ZPL A;  1X5R A;  4Z33 A;  5GLJ A;  2FN5 A;  1SOT A;  2EEH A;  1UEW A;  2KAW A;  2KBS A;  3WKL A;  2K1Z A;  4NNL A;  3I4W A;  3R69 A;  1X45 A;  1K32 A;  3DIW A;  1RGW A;  3CS0 A;  4GVC A;  1UFX A;  2H3L A;  3ID4 A;  1B8Q A;  1OZI A;  1FCF A;  1X5Q A;  4JOE A;  1TE0 A;  2K20 A;  2LUI A;  2W7R A;  1UM1 A;  3SOE A;  3HVQ C;  1T2M A;  5B6L A;  2VRF A;  2M10 A;  3I18 A;  5G1E A;  2OZF A;  3HPK A;  2HGA A;  4HOP B;  3GGE A;  4Q2O A;  4NXQ A;  2F0A A;  1WFG A;  1P1E A;  2MHO A;  2QG1 A;  3OTP A;  1G9O A;  2EGK A;  2VSV A;  3I1E A;  2I1N A;  4K72 A;  4G69 A;  1ZUB A;  3HPM A;  2VSP A;  2E7K A;  3TSW A;  4WYT A;  1LCY A;  1WFV A;  1KEF A;  1N7E A;  4OAJ A;  3TSZ A;  4Z8J A;  2M0Z A;  2I04 A;  4N6X A;  4JOK A;  1SOZ A;  3RLE A;  3L4F D;  2YT8 A;  1RZX A;  1UJU A;  5F67 A;  2M0V A;  2G2L A;  1MFL A;  4JOJ A;  1VCW A;  3GJ9 A;  3QJM A;  5H3J A;  2OGP A;  2V1W A;  3ID3 A;  5F3X A;  4NMQ A;  3LNX A;  2QKU A;  2Q3G A;  3PDZ A;  2DC2 A;  3EGH C;  2EV8 A;  5E22 A;  1FC9 A;  1UEZ A;  2H2C A;  2BYG A;  4MPA A;  2D8I A;  2ZPM A;  2CS5 A;  4NMP A;  1Y7N A;  3STJ A;  4JOF A;  1P1D A;  2Z9I A;  3TMH A;  2QKT A;  4L8N A; 
#chains in the Genus database with same CATH topology
 3R68 A;  2JIL A;  1RGR A;  2KV8 A;  3QGL A;  1QLC A;  1UIT A;  3QIK A;  4NNM A;  1XZ9 A;  3GCN A;  2O2T A;  4AMH A;  2JOA A;  1TQ3 A;  2KYL A;  4NMV A;  1U38 A;  3BPU A;  1WHD A;  2WL7 A;  4WYU A;  1W9E A;  2REY A;  3CBY A;  5JXB A;  1GQ5 A;  4YYX A;  1NF3 C;  5HFB A;  1OBY A;  1Q3P A;  2PNT A;  3PV4 A;  3GCO A;  3SHW A;  1UEQ A;  1U37 A;  3AXA A;  2P3W A;  1N6D A;  5DTH A;  4JOR A;  2MX6 A;  4K78 A;  2I6V A;  3RL8 A;  2D92 A;  1I16 A;  1V1T A;  2W4F A;  1I92 A;  2KOJ A;  2OPG A;  1N7T A;  5G1D A;  4JOH A;  1X5N A;  4Q3H A;  1WJL A;  2AIN A;  1GM1 A;  2QBW A;  1KWA A;  2L97 A;  4K75 A;  2EDV A;  2EHR A;  2M0T A;  3NFL A;  2PKU A;  3VQG A;  2FCF A;  2RRM A;  2VWR A;  2FNE A;  4NMS A;  3MH6 A;  4GHN A;  3TSV A;  1UHP A;  3CBZ A;  1UJV A;  4REY A;  1WI2 A;  1OBX A;  2F5Y A;  1WH1 A;  3EGG C;  5HEY A;  2D90 A;  2IWN A;  4FLN A;  3MH7 A;  5FHT A;  4F8K A;  2EGN A;  5B42 A;  4H11 A;  4FGM A;  2IWO A;  2YTW A;  3PDV A;  5HET A;  1WF7 A;  2KQF A;  3ID1 A;  3NCV A;  5EZ0 A;  2OQS A;  2IWP A;  3PV5 A;  2JIK A;  4GVD A;  4YDP A;  2KJD A;  4P2A B;  3QE1 A;  3MH4 A;  2PKT A;  4JJ0 A;  1N7F A;  2KJK A;  4OEO A;  2DM8 A;  1QAU A;  2M0U A;  5D13 A;  3O46 A;  5FB8 C;  1BFE A;  1V5Q A;  2EDP A;  3R0H A;  2EEG A;  4JJ3 A;  5EYZ A;  3E17 A;  3CC0 A;  1X8S A;  2H3M A;  3WKM A;  2L4S A;  4P0C A;  3ZRT A;  2HE4 A;  1RY4 A;  4UU6 A;  2CSJ A;  5HF4 A;  4R2Z A;  2DB5 A;  2Z17 A;  2EEJ A;  2KPL A;  3JXT A;  3QO6 A;  2X7Z A;  1YBO A;  2RCZ A;  3KDK A;  2JIN A;  2DKR A;  2LA8 A;  3NFK A;  1Z87 A;  2QT5 A;  2YUY A;  2OSG A;  1VAE A;  3DJ1 A;  1IU2 A;  3GSL A;  4JOG A;  1WG6 A;  2KJP A;  2L4T A;  2KA9 A;  4OEP A;  1Q3O A;  3SFJ A;  3B76 A;  1U39 A;  2LC7 A;  3PS4 A;  4UU5 A;  1FC6 A;  2G5M B;  3SUZ A;  1N99 A;  1WI4 A;  1VB7 A;  3O5N A;  5HED A;  2KRG A;  4KFW A;  1W9O A;  2KL1 A;  3K82 A;  1U3B A;  1OBZ A;  1WF8 A;  2H2B A;  5ILB A;  1QAV A;  5E21 A;  5E11 A;  1BE9 A;  4NMT A;  3LNY A;  1N6F A;  1X6D A;  1MFG A;  3PV2 A;  3VQF A;  2JRE A;  2OMJ A;  3CH8 A;  2EGO A;  2YT7 A;  2AWX A;  1WIF A;  3RL7 A;  2EDZ A;  2EJY A;  2Q9V A;  1X9Z A;  1R6J A;  2DMZ A;  2DLU A;  1M5Z A;  3DJA A;  3K1R A;  2CSS A;  3DJ3 A;  4Q2N A;  5HFD A;  3CYY A;  3QJN A;  3CBX A;  1ZOK A;  4O06 A;  3OU0 A;  1W9Q A;  5HDY A;  2KOM A;  2FE5 A;  4Q2P A;  2HE2 A;  1NTE A;  2UZC A;  5HF1 A;  2EAQ A;  2R3Y A;  4Q6S A;  2QKV A;  3GDS A;  4E34 A;  1UEP A;  4E3B A;  3DOR A;  1IU0 A;  3KDG A;  4Q6H A;  1D5G A;  3ID2 A;  1TP3 A;  1Q7X A;  2PA1 A;  5E6P B;  2ENO A;  1UM7 A;  1WHA A;  3NGH A;  2YUB A;  5HFC A;  1V6B A;  2GZV A;  1FC7 A;  4K76 A;  4PQW A;  2JWE A;  4NMR A;  3FY5 A;  4NMO A;  2M3M A;  4XHV A;  1L6O A;  4E35 A;  2I0I A;  2JSN A;  1TP5 A;  5E1Y A;  1QAV B;  4EDJ A;  2I0L A;  4Q2Q A;  1MC7 A;  1VJ6 A;  3K50 A;  4NXR A;  1PDR A;  3KZD A;  2DJT A;  5HFE A;  2PZD A;  4KFV A;  1Y8T A;  1V5L A;  3GDV A;  4K6Y A;  5A2P A;  1UJD A;  4JL7 A;  4IC6 A;  5HEB A;  2DLS A;  1UF1 A;  2VPH A;  4JOP A;  1VA8 A;  2EXG A;  5HJ1 A;  1N6E A;  1KY9 A;  2EEI A;  2KPK A;  3GDU A;  5GND A;  1GQ4 A;  2PDZ A;  1V62 A;  3QDO A;  5I7Z A;  4LMM A;  2LOB A;  4RI0 A;  2KOH A;  2OS6 A;  2KG2 A;  4NXP A;  5HFF A;  2DAZ A;  3KZE A;  4HOP A;  5IL9 A;  1Z86 A;  2AWU A;  1IHJ A;  2AWW A;  2IWQ A;  3SHU A;  2JXO A;  2LC6 A;  2R4H A;  2V90 A;  2VZ5 A;  3KHF A;  2I4S A;  2OCS A;  2ZPL A;  1X5R A;  4Z33 A;  5GLJ A;  2FN5 A;  1SOT A;  2EEH A;  1UEW A;  2KAW A;  2KBS A;  3WKL A;  2K1Z A;  4NNL A;  3I4W A;  3R69 A;  1X45 A;  1K32 A;  3DIW A;  1RGW A;  3CS0 A;  4GVC A;  1UFX A;  2H3L A;  3ID4 A;  1B8Q A;  1OZI A;  1FCF A;  1X5Q A;  4JOE A;  1TE0 A;  2K20 A;  2LUI A;  2W7R A;  1UM1 A;  3SOE A;  3HVQ C;  1T2M A;  5B6L A;  2VRF A;  2M10 A;  3I18 A;  5G1E A;  2OZF A;  3HPK A;  2HGA A;  4HOP B;  3GGE A;  4Q2O A;  4NXQ A;  2F0A A;  1WFG A;  1P1E A;  2MHO A;  2QG1 A;  3OTP A;  1G9O A;  2EGK A;  2VSV A;  3I1E A;  2I1N A;  4K72 A;  4G69 A;  1ZUB A;  3HPM A;  2VSP A;  2E7K A;  3TSW A;  4WYT A;  1LCY A;  1WFV A;  1KEF A;  1N7E A;  4OAJ A;  3TSZ A;  4Z8J A;  2M0Z A;  2I04 A;  4N6X A;  4JOK A;  1SOZ A;  3RLE A;  3L4F D;  2YT8 A;  1RZX A;  1UJU A;  5F67 A;  2M0V A;  2G2L A;  1MFL A;  4JOJ A;  1VCW A;  3GJ9 A;  3QJM A;  5H3J A;  2OGP A;  2V1W A;  3ID3 A;  5F3X A;  4NMQ A;  3LNX A;  2QKU A;  2Q3G A;  3PDZ A;  2DC2 A;  3EGH C;  2EV8 A;  2GEF A;  5E22 A;  1FC9 A;  1UEZ A;  2H2C A;  2BYG A;  4MPA A;  3GAB A;  2D8I A;  2ZPM A;  2CS5 A;  4NMP A;  1Y7N A;  3STJ A;  4JOF A;  1P1D A;  2Z9I A;  3TMH A;  2QKT A;  4L8N A; 
#chains in the Genus database with same CATH homology
 3R68 A;  2JIL A;  1RGR A;  2KV8 A;  3QGL A;  1QLC A;  1UIT A;  3QIK A;  4NNM A;  1XZ9 A;  3GCN A;  2O2T A;  4AMH A;  2JOA A;  1TQ3 A;  2KYL A;  4NMV A;  1U38 A;  3BPU A;  1WHD A;  2WL7 A;  4WYU A;  1W9E A;  2REY A;  3CBY A;  5JXB A;  1GQ5 A;  4YYX A;  1NF3 C;  5HFB A;  1OBY A;  1Q3P A;  2PNT A;  3PV4 A;  3GCO A;  3SHW A;  1UEQ A;  1U37 A;  3AXA A;  2P3W A;  1N6D A;  5DTH A;  4JOR A;  2MX6 A;  4K78 A;  2I6V A;  3RL8 A;  2D92 A;  1I16 A;  1V1T A;  2W4F A;  1I92 A;  2KOJ A;  2OPG A;  1N7T A;  5G1D A;  4JOH A;  1X5N A;  4Q3H A;  1WJL A;  2AIN A;  1GM1 A;  2QBW A;  1KWA A;  2L97 A;  4K75 A;  2EDV A;  2EHR A;  2M0T A;  3NFL A;  2PKU A;  3VQG A;  2FCF A;  2RRM A;  2VWR A;  2FNE A;  4NMS A;  3MH6 A;  4GHN A;  3TSV A;  1UHP A;  3CBZ A;  1UJV A;  4REY A;  1WI2 A;  1OBX A;  2F5Y A;  1WH1 A;  3EGG C;  5HEY A;  2D90 A;  2IWN A;  4FLN A;  3MH7 A;  5FHT A;  4F8K A;  2EGN A;  5B42 A;  4H11 A;  4FGM A;  2IWO A;  2YTW A;  3PDV A;  5HET A;  1WF7 A;  2KQF A;  3ID1 A;  3NCV A;  5EZ0 A;  2OQS A;  2IWP A;  3PV5 A;  2JIK A;  4GVD A;  4YDP A;  2KJD A;  4P2A B;  3QE1 A;  3MH4 A;  2PKT A;  4JJ0 A;  1N7F A;  2KJK A;  4OEO A;  2DM8 A;  1QAU A;  2M0U A;  5D13 A;  3O46 A;  5FB8 C;  1BFE A;  1V5Q A;  2EDP A;  3R0H A;  2EEG A;  4JJ3 A;  5EYZ A;  3E17 A;  3CC0 A;  1X8S A;  2H3M A;  3WKM A;  2L4S A;  4P0C A;  3ZRT A;  2HE4 A;  1RY4 A;  4UU6 A;  2CSJ A;  5HF4 A;  4R2Z A;  2DB5 A;  2Z17 A;  2EEJ A;  2KPL A;  3JXT A;  3QO6 A;  2X7Z A;  1YBO A;  2RCZ A;  3KDK A;  2JIN A;  2DKR A;  2LA8 A;  3NFK A;  1Z87 A;  2QT5 A;  2YUY A;  2OSG A;  1VAE A;  3DJ1 A;  1IU2 A;  3GSL A;  4JOG A;  1WG6 A;  2KJP A;  2L4T A;  2KA9 A;  4OEP A;  1Q3O A;  3SFJ A;  3B76 A;  1U39 A;  2LC7 A;  3PS4 A;  4UU5 A;  1FC6 A;  2G5M B;  3SUZ A;  1N99 A;  1WI4 A;  1VB7 A;  3O5N A;  5HED A;  2KRG A;  4KFW A;  1W9O A;  2KL1 A;  3K82 A;  1U3B A;  1OBZ A;  1WF8 A;  2H2B A;  5ILB A;  1QAV A;  5E21 A;  5E11 A;  1BE9 A;  4NMT A;  3LNY A;  1N6F A;  1X6D A;  1MFG A;  3PV2 A;  3VQF A;  2JRE A;  2OMJ A;  3CH8 A;  2EGO A;  2YT7 A;  2AWX A;  1WIF A;  3RL7 A;  2EDZ A;  2EJY A;  2Q9V A;  1X9Z A;  1R6J A;  2DMZ A;  2DLU A;  1M5Z A;  3DJA A;  3K1R A;  2CSS A;  3DJ3 A;  4Q2N A;  5HFD A;  3CYY A;  3QJN A;  3CBX A;  1ZOK A;  4O06 A;  3OU0 A;  1W9Q A;  5HDY A;  2KOM A;  2FE5 A;  4Q2P A;  2HE2 A;  1NTE A;  2UZC A;  5HF1 A;  2EAQ A;  2R3Y A;  4Q6S A;  2QKV A;  3GDS A;  4E34 A;  1UEP A;  4E3B A;  3DOR A;  1IU0 A;  3KDG A;  4Q6H A;  1D5G A;  3ID2 A;  1TP3 A;  1Q7X A;  2PA1 A;  5E6P B;  2ENO A;  1UM7 A;  1WHA A;  3NGH A;  2YUB A;  5HFC A;  1V6B A;  2GZV A;  1FC7 A;  4K76 A;  4PQW A;  2JWE A;  4NMR A;  3FY5 A;  4NMO A;  2M3M A;  4XHV A;  1L6O A;  4E35 A;  2I0I A;  2JSN A;  1TP5 A;  5E1Y A;  1QAV B;  4EDJ A;  2I0L A;  4Q2Q A;  1MC7 A;  1VJ6 A;  3K50 A;  4NXR A;  1PDR A;  3KZD A;  2DJT A;  5HFE A;  2PZD A;  4KFV A;  1Y8T A;  1V5L A;  3GDV A;  4K6Y A;  5A2P A;  1UJD A;  4JL7 A;  4IC6 A;  5HEB A;  2DLS A;  1UF1 A;  2VPH A;  4JOP A;  1VA8 A;  2EXG A;  5HJ1 A;  1N6E A;  1KY9 A;  2EEI A;  2KPK A;  3GDU A;  5GND A;  1GQ4 A;  2PDZ A;  1V62 A;  3QDO A;  5I7Z A;  4LMM A;  2LOB A;  4RI0 A;  2KOH A;  2OS6 A;  2KG2 A;  4NXP A;  5HFF A;  2DAZ A;  3KZE A;  4HOP A;  5IL9 A;  1Z86 A;  2AWU A;  1IHJ A;  2AWW A;  2IWQ A;  3SHU A;  2JXO A;  2LC6 A;  2R4H A;  2V90 A;  2VZ5 A;  3KHF A;  2I4S A;  2OCS A;  2ZPL A;  1X5R A;  4Z33 A;  5GLJ A;  2FN5 A;  1SOT A;  2EEH A;  1UEW A;  2KAW A;  2KBS A;  3WKL A;  2K1Z A;  4NNL A;  3I4W A;  3R69 A;  1X45 A;  1K32 A;  3DIW A;  1RGW A;  3CS0 A;  4GVC A;  1UFX A;  2H3L A;  3ID4 A;  1B8Q A;  1OZI A;  1FCF A;  1X5Q A;  4JOE A;  1TE0 A;  2K20 A;  2LUI A;  2W7R A;  1UM1 A;  3SOE A;  3HVQ C;  1T2M A;  5B6L A;  2VRF A;  2M10 A;  3I18 A;  5G1E A;  2OZF A;  3HPK A;  2HGA A;  4HOP B;  3GGE A;  4Q2O A;  4NXQ A;  2F0A A;  1WFG A;  1P1E A;  2MHO A;  2QG1 A;  3OTP A;  1G9O A;  2EGK A;  2VSV A;  3I1E A;  2I1N A;  4K72 A;  4G69 A;  1ZUB A;  3HPM A;  2VSP A;  2E7K A;  3TSW A;  4WYT A;  1LCY A;  1WFV A;  1KEF A;  1N7E A;  4OAJ A;  3TSZ A;  4Z8J A;  2M0Z A;  2I04 A;  4N6X A;  4JOK A;  1SOZ A;  3RLE A;  3L4F D;  2YT8 A;  1RZX A;  1UJU A;  5F67 A;  2M0V A;  2G2L A;  1MFL A;  4JOJ A;  1VCW A;  3GJ9 A;  3QJM A;  5H3J A;  2OGP A;  2V1W A;  3ID3 A;  5F3X A;  4NMQ A;  3LNX A;  2QKU A;  2Q3G A;  3PDZ A;  2DC2 A;  3EGH C;  2EV8 A;  2GEF A;  5E22 A;  1FC9 A;  1UEZ A;  2H2C A;  2BYG A;  4MPA A;  3GAB A;  2D8I A;  2ZPM A;  2CS5 A;  4NMP A;  1Y7N A;  3STJ A;  4JOF A;  1P1D A;  2Z9I A;  3TMH A;  2QKT A;  4L8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...