1ZUBA

Solution structure of the rim1alpha pdz domain in complex with an elks1b c-terminal peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
109
structure length
109
Chain Sequence
HPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulating synaptic membrane exocytosis protein 1
publication title Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 13
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1zubA00
1UFXA 1VCWA 1MC7A 1KEFA 2H2CA 1TP5A 3PV5A 3CBYA 3NFLA 3LNYA 2D90A 1YBOA 1G9OA 4AMHA 1I16A 2WL7A 3DIWA 2M0VA 4K75A 2DM8A 1P1EA 2EEHA 2M0TA 2EGNA 3JXTA 5EYZA 2DC2A 2JREA 3O5NA 2VZ5A 2DLUA 2Z9IA 2RCZA 4JL7A 2AINA 2KRGA 2QG1A 2JIKA 1WI4A 5HDYA 5HEBA 2KPLA 3NGHA 1UF1A 1UJUA 2AWXA 3EGHC 4PQWA 1K32A 1B8QA 2UZCA 3QJNA 4JOEA 3NFKA 5DTHA 2IWOA 1V5LA 5A2PA 4N6XA 1WI2A 3MH4A 3BPUA 2EDPA 4UU6A 2VSVA 4Z33A 2FCFA 1Y7NA 1Q3PA 2DKRA 2REYA 3CYYA 4H11A 4L8NA 3RL8A 5E22A 2FNEA 5H3JA 2Z17A 2L4SA 2LUIA 2M3MA 2EXGA 2KJDA 1X8SA 2KYLA 2KA9A 1WHAA 1Q3OA 4Q2QA 2DMZA 2KQFA 5HFDA 5HF4A 2I1NA 2I0IA 2YUYA 3TSWA 1VJ6A 3R0HA 3SHWA 4WYTA 2IWQA 1QAUA 5HFBA 3K50A 4GHNA 3GGEA 4NMRA 2EGKA 2GZVA 3CC0A 1N6EA 1N99A 1MFGA 1FC9A 1OZIA 1N6DA 5HETA 2P3WA 5HEDA 1X6DA 3DORA 1WHDA 3K1RA 1RZXA 2IWPA 1NF3C 2I6VA 3E17A 3PV2A 3PS4A 2H3LA 2EDZA 4E3BA 2L4TA 3GDVA 1SOTA 3LNXA 5G1EA 1D5GA 1UEQA 5FHTA 2OGPA 4P0CA 1Z87A 4Q6SA 2IWNA 1XZ9A 4IC6A 2R3YA 2EJYA 4GVCA 2KAWA 2Q9VA 3PV4A 3HPMA 4HOPB 3TSVA 2OQSA 4Q3HA 1IU0A 1WG6A 4NXQA 2YT7A 2G2LA 4Q2NA 1TP3A 3DJ3A 1MFLA 2V1WA 1GM1A 4E34A 3VQFA 3GDSA 2OMJA 3WKLA 2I4SA 4JORA 3DJAA 4NMQA 2R4HA 4JOFA 1UEPA 1V62A 2OPGA 3B76A 1WF7A 1V1TA 1SOZA 2CSSA 2YTWA 2ZPMA 4OAJA 2DB5A 1IHJA 2LC7A 3ID1A 2JOAA 2QKTA 4NMSA 1WJLA 2ENOA 4WYUA 4Q2PA 1WFGA 2OS6A 3CH8A 3SUZA 1X5QA 3FY5A 1QAVB 1KY9A 2EAQA 3WKMA 2F0AA 2Q3GA 2QT5A 3MH6A 1FC6A 1VA8A 2KG2A 2PKUA 2D92A 3OU0A 4K6YA 4JOHA 4UU5A 1U39A 4JOPA 2EDVA 5G1DA 2JINA 4E35A 1OBYA 4YYXA 1TQ3A 1U37A 5F3XA 2F5YA 2PZDA 5E21A 1WH1A 4JOGA 2JWEA 4LMMA 2M0UA 5HJ1A 4NMVA 5I7ZA 3CS0A 2DAZA 2ZPLA 3OTPA 5F67A 1N7EA 3SOEA 2L97A 2LA8A 3EGGC 1X45A 2W4FA 3DJ1A 1QLCA 2BYGA 3MH7A 2LC6A 4R2ZA 1T2MA 3TSZA 2HE2A 3HVQC 2LOBA 4JOJA 2JILA 4MPAA 1V5QA 1I92A 1N7FA 2MX6A 1GQ5A 1R6JA 2VPHA 2VSPA 1WIFA 3GCNA 3QDOA 2DJTA 1UM7A 3QO6A 3GSLA 5GNDA 2PKTA 1WF8A 4K72A 1VB7A 5FB8C 2EEIA 2JXOA 2QBWA 2HGAA 5EZ0A 5HF1A 3KZDA 2PNTA 2D8IA 1UITA 2K1ZA 1M5ZA 1BE9A 3R68A 1VAEA 3QJMA 4NNMA 2M0ZA 2FN5A 5B6LA 4Q2OA 3QE1A 2EEJA 1P1DA 1W9EA 2I04A 3RL7A 4HOPA 4JOKA 2V90A 4Z8JA 2FE5A 2X7ZA 2EGOA 1V6BA 1N6FA 1U3BA 4K78A 4NNLA 3I1EA 3CBXA 3STJA 3K82A 5HEYA 1RGWA 4O06A 4YDPA 2W7RA 2QKUA 2OCSA 2CS5A 3PDVA 2KBSA 3GDUA 1U38A 4NMOA 2QKVA 3QIKA 3RLEA 5E6PB 4K76A 1X5NA 2KJPA 3I4WA 4RI0A 3GJ9A 2EHRA 2EEGA 3R69A 2AWWA 3HPKA 1W9QA 2KV8A 5HFCA 1ZUBA 1OBZA 1UEZA 4F8KA 2I0LA 2KJKA 5GLJA 1PDRA 3VQGA 3TMHA 3L4FD 4REYA 4GVDA 2KOJA 5HFFA 1RGRA 1QAVA 3KHFA 3SHUA 1Q7XA 5JXBA 3GCOA 2DLSA 1UJDA 1NTEA 2PA1A 2VRFA 3ID4A 2YUBA 1N7TA 1UEWA 1BFEA 3SFJA 2EV8A 1RY4A 2VWRA 2AWUA 3ZRTA 1GQ4A 3AXAA 1X5RA 4EDJA 4KFWA 4NXPA 2K20A 1LCYA 1FCFA 3PDZA 4NMPA 3O46A 2H3MA 1L6OA 4KFVA 2OZFA 2E7KA 1ZOKA 1Y8TA 4OEPA 2RRMA 5D13A 1UHPA 1WFVA 4XHVA 2HE4A 1TE0A 2MHOA 2OSGA 5E11A 1KWAA 3ID3A 2CSJA 3KZEA 4Q6HA 2PDZA 5HFEA 2YT8A 1IU2A 1UM1A 4G69A 3CBZA 4OEOA 2G5MB 3QGLA 2KOHA 4NXRA 1UJVA 2M10A 2KOMA 2KPKA 2H2BA 5E1YA 1OBXA 4FGMA 1FC7A 3ID2A 1Z86A 2KL1A 2O2TA 4NMTA 3I18A 4P2AB 1W9OA
chains in the Genus database with same CATH superfamily
1UFXA 1VCWA 1MC7A 1KEFA 2H2CA 1TP5A 3PV5A 3CBYA 3NFLA 3LNYA 2D90A 5IL9A 1YBOA 1G9OA 3KDKA 4AMHA 1I16A 2WL7A 3DIWA 2M0VA 4K75A 2DM8A 1P1EA 2EEHA 2M0TA 2EGNA 3JXTA 5EYZA 2DC2A 2JREA 3O5NA 2VZ5A 2DLUA 2Z9IA 2RCZA 4JL7A 2AINA 2KRGA 2QG1A 2JIKA 1WI4A 5HDYA 5HEBA 2KPLA 3NGHA 1UF1A 1UJUA 2AWXA 3EGHC 4PQWA 1K32A 1B8QA 2UZCA 3QJNA 4JOEA 3NFKA 5DTHA 5ILBA 2IWOA 1V5LA 5A2PA 4N6XA 1WI2A 3MH4A 3BPUA 2EDPA 4UU6A 2VSVA 4Z33A 2FCFA 1Y7NA 1Q3PA 2DKRA 2REYA 3CYYA 4H11A 4L8NA 3RL8A 5E22A 2FNEA 5H3JA 2Z17A 2L4SA 2LUIA 2M3MA 2EXGA 2KJDA 1X8SA 2KYLA 2KA9A 1WHAA 1Q3OA 4Q2QA 2DMZA 2KQFA 5HFDA 5HF4A 2I1NA 2I0IA 2YUYA 3TSWA 1VJ6A 3R0HA 3SHWA 4WYTA 2IWQA 1QAUA 5HFBA 3K50A 4GHNA 3GGEA 4NMRA 2EGKA 2GZVA 3CC0A 1N6EA 1N99A 1MFGA 1FC9A 1OZIA 1N6DA 5HETA 2P3WA 5HEDA 1X6DA 3DORA 1WHDA 3K1RA 1RZXA 2IWPA 1NF3C 2I6VA 3E17A 3PV2A 3PS4A 2H3LA 2EDZA 4E3BA 2L4TA 3GDVA 1SOTA 3LNXA 5G1EA 1D5GA 1UEQA 4JJ3A 5FHTA 2OGPA 4P0CA 1Z87A 4Q6SA 2IWNA 1XZ9A 4IC6A 2R3YA 2EJYA 4GVCA 2KAWA 2Q9VA 3PV4A 3HPMA 4HOPB 3TSVA 2OQSA 4Q3HA 1IU0A 1WG6A 4NXQA 2YT7A 2G2LA 4Q2NA 1TP3A 3DJ3A 1MFLA 2V1WA 1GM1A 4E34A 3VQFA 3GDSA 2OMJA 3WKLA 2I4SA 4JORA 3DJAA 4NMQA 2R4HA 4JOFA 1UEPA 1V62A 2OPGA 3B76A 1WF7A 1V1TA 1SOZA 2CSSA 2YTWA 2ZPMA 4OAJA 2DB5A 1IHJA 2LC7A 3ID1A 2JOAA 2QKTA 4NMSA 1WJLA 2ENOA 4WYUA 2JSNA 4Q2PA 1WFGA 2OS6A 3CH8A 3SUZA 1X5QA 3FY5A 1QAVB 1KY9A 2EAQA 2GEFA 3WKMA 2F0AA 2Q3GA 2QT5A 3MH6A 1FC6A 1VA8A 2KG2A 2PKUA 2D92A 3OU0A 4FLNA 4JOHA 4K6YA 4UU5A 1U39A 4JOPA 2EDVA 5G1DA 2JINA 4E35A 1OBYA 4YYXA 1TQ3A 1U37A 5F3XA 2F5YA 2PZDA 5E21A 1WH1A 4JOGA 2JWEA 4LMMA 2M0UA 5HJ1A 4NMVA 5I7ZA 3CS0A 2DAZA 2ZPLA 3OTPA 5F67A 1N7EA 3SOEA 2L97A 2LA8A 3EGGC 1X45A 2W4FA 3DJ1A 1QLCA 2BYGA 3MH7A 2LC6A 4R2ZA 1T2MA 3TSZA 2HE2A 3HVQC 2LOBA 4JOJA 2JILA 4MPAA 1V5QA 1I92A 1N7FA 2MX6A 1GQ5A 1R6JA 2VPHA 2VSPA 1WIFA 3GCNA 3QDOA 2DJTA 1UM7A 3QO6A 3GSLA 5GNDA 2PKTA 1WF8A 4K72A 1VB7A 5FB8C 2EEIA 2JXOA 2QBWA 2HGAA 5EZ0A 5HF1A 3KZDA 2PNTA 2D8IA 1UITA 2K1ZA 3NCVA 1M5ZA 5B42A 1BE9A 3R68A 1VAEA 3QJMA 4NNMA 2M0ZA 2FN5A 3GABA 5B6LA 4Q2OA 3QE1A 2EEJA 1P1DA 1W9EA 2I04A 3RL7A 4HOPA 4JOKA 2V90A 4Z8JA 2FE5A 2X7ZA 2EGOA 1V6BA 1N6FA 1U3BA 4K78A 4NNLA 3I1EA 3CBXA 3STJA 3K82A 5HEYA 1RGWA 4O06A 4YDPA 2W7RA 2QKUA 2OCSA 4JJ0A 2CS5A 3PDVA 2KBSA 3GDUA 1U38A 4NMOA 2QKVA 3QIKA 3RLEA 5E6PB 4K76A 1X5NA 2KJPA 3I4WA 4RI0A 3GJ9A 2EHRA 2EEGA 3R69A 2AWWA 3HPKA 1W9QA 2KV8A 5HFCA 1ZUBA 1OBZA 1UEZA 4F8KA 2I0LA 2KJKA 5GLJA 1PDRA 3VQGA 3TMHA 3L4FD 4REYA 4GVDA 2KOJA 5HFFA 1RGRA 1QAVA 3KHFA 3SHUA 1Q7XA 5JXBA 3GCOA 2DLSA 1UJDA 1NTEA 2PA1A 2VRFA 3ID4A 2YUBA 1N7TA 1UEWA 1BFEA 3SFJA 2EV8A 1RY4A 2VWRA 2AWUA 3ZRTA 1GQ4A 3AXAA 1X5RA 4EDJA 4KFWA 4NXPA 2K20A 1LCYA 1FCFA 3PDZA 4NMPA 3O46A 2H3MA 1L6OA 4KFVA 2OZFA 2E7KA 1ZOKA 1Y8TA 4OEPA 2RRMA 5D13A 1UHPA 1WFVA 4XHVA 2HE4A 1TE0A 2MHOA 2OSGA 5E11A 1KWAA 3ID3A 3KDGA 2CSJA 3KZEA 4Q6HA 2PDZA 5HFEA 2YT8A 1IU2A 1X9ZA 1UM1A 4G69A 3CBZA 4OEOA 2G5MB 3QGLA 2KOHA 4NXRA 1UJVA 2M10A 2KOMA 2KPKA 2H2BA 5E1YA 1OBXA 4FGMA 1FC7A 3ID2A 1Z86A 2KL1A 2O2TA 4NMTA 3I18A 4P2AB 1W9OA
chains in the Genus database with same CATH topology
1UFXA 1VCWA 1MC7A 1KEFA 2H2CA 1TP5A 3PV5A 3CBYA 3NFLA 3LNYA 2D90A 5IL9A 1YBOA 1G9OA 3KDKA 4AMHA 1I16A 2WL7A 3DIWA 2M0VA 4K75A 2DM8A 1P1EA 2EEHA 2M0TA 2EGNA 3JXTA 5EYZA 2DC2A 2JREA 3O5NA 2VZ5A 2DLUA 2Z9IA 2RCZA 4JL7A 2AINA 2KRGA 2QG1A 2JIKA 1WI4A 5HDYA 5HEBA 2KPLA 3NGHA 1UF1A 1UJUA 2AWXA 3EGHC 4PQWA 1K32A 1B8QA 2UZCA 3QJNA 4JOEA 3NFKA 5DTHA 5ILBA 2IWOA 1V5LA 5A2PA 4N6XA 1WI2A 3MH4A 3BPUA 2EDPA 4UU6A 2VSVA 4Z33A 2FCFA 1Y7NA 1Q3PA 2DKRA 2REYA 3CYYA 4H11A 4L8NA 3RL8A 5E22A 2FNEA 5H3JA 2Z17A 2L4SA 2LUIA 2M3MA 2EXGA 2KJDA 1X8SA 2KYLA 2KA9A 1WHAA 1Q3OA 4Q2QA 2DMZA 2KQFA 5HFDA 5HF4A 2I1NA 2I0IA 2YUYA 3TSWA 1VJ6A 3R0HA 3SHWA 4WYTA 2IWQA 1QAUA 5HFBA 3K50A 4GHNA 3GGEA 4NMRA 2EGKA 2GZVA 3CC0A 1N6EA 1N99A 1MFGA 1FC9A 1OZIA 1N6DA 5HETA 2P3WA 5HEDA 1X6DA 3DORA 1WHDA 3K1RA 1RZXA 2IWPA 1NF3C 2I6VA 3E17A 3PV2A 3PS4A 2H3LA 2EDZA 4E3BA 2L4TA 3GDVA 1SOTA 3LNXA 5G1EA 1D5GA 1UEQA 4JJ3A 5FHTA 2OGPA 4P0CA 1Z87A 4Q6SA 2IWNA 1XZ9A 4IC6A 2R3YA 2EJYA 4GVCA 2KAWA 2Q9VA 3PV4A 3HPMA 4HOPB 3TSVA 2OQSA 4Q3HA 1IU0A 1WG6A 4NXQA 2YT7A 2G2LA 4Q2NA 1TP3A 3DJ3A 1MFLA 2V1WA 1GM1A 4E34A 3VQFA 3GDSA 2OMJA 3WKLA 2I4SA 4JORA 3DJAA 4NMQA 2R4HA 4JOFA 1UEPA 1V62A 2OPGA 3B76A 1WF7A 1V1TA 1SOZA 2CSSA 2YTWA 2ZPMA 4OAJA 2DB5A 1IHJA 2LC7A 3ID1A 2JOAA 2QKTA 4NMSA 1WJLA 2ENOA 4WYUA 2JSNA 4Q2PA 1WFGA 2OS6A 3CH8A 3SUZA 1X5QA 3FY5A 1QAVB 1KY9A 2EAQA 2GEFA 3WKMA 2F0AA 2Q3GA 2QT5A 3MH6A 1FC6A 1VA8A 2KG2A 2PKUA 2D92A 3OU0A 4FLNA 4JOHA 4K6YA 4UU5A 1U39A 4JOPA 2EDVA 5G1DA 2JINA 4E35A 1OBYA 4YYXA 1TQ3A 1U37A 5F3XA 2F5YA 2PZDA 5E21A 1WH1A 4JOGA 2JWEA 4LMMA 2M0UA 5HJ1A 4NMVA 5I7ZA 3CS0A 2DAZA 2ZPLA 3OTPA 5F67A 1N7EA 3SOEA 2L97A 2LA8A 3EGGC 1X45A 2W4FA 3DJ1A 1QLCA 2BYGA 3MH7A 2LC6A 4R2ZA 1T2MA 3TSZA 2HE2A 3HVQC 2LOBA 4JOJA 2JILA 4MPAA 1V5QA 1I92A 1N7FA 2MX6A 1GQ5A 1R6JA 2VPHA 2VSPA 1WIFA 3GCNA 3QDOA 2DJTA 1UM7A 3QO6A 3GSLA 5GNDA 2PKTA 1WF8A 4K72A 1VB7A 5FB8C 2EEIA 2JXOA 2QBWA 2HGAA 5EZ0A 5HF1A 3KZDA 2PNTA 2D8IA 1UITA 2K1ZA 3NCVA 1M5ZA 5B42A 1BE9A 3R68A 1VAEA 3QJMA 4NNMA 2M0ZA 2FN5A 3GABA 5B6LA 4Q2OA 3QE1A 2EEJA 1P1DA 1W9EA 2I04A 3RL7A 4HOPA 4JOKA 2V90A 4Z8JA 2FE5A 2X7ZA 2EGOA 1V6BA 1N6FA 1U3BA 4K78A 4NNLA 3I1EA 3CBXA 3STJA 3K82A 5HEYA 1RGWA 4O06A 4YDPA 2W7RA 2QKUA 2OCSA 4JJ0A 2CS5A 3PDVA 2KBSA 3GDUA 1U38A 4NMOA 2QKVA 3QIKA 3RLEA 5E6PB 4K76A 1X5NA 2KJPA 3I4WA 4RI0A 3GJ9A 2EHRA 2EEGA 3R69A 2AWWA 3HPKA 1W9QA 2KV8A 5HFCA 1ZUBA 1OBZA 1UEZA 4F8KA 2I0LA 2KJKA 5GLJA 1PDRA 3VQGA 3TMHA 3L4FD 4REYA 4GVDA 2KOJA 5HFFA 1RGRA 1QAVA 3KHFA 3SHUA 1Q7XA 5JXBA 3GCOA 2DLSA 1UJDA 1NTEA 2PA1A 2VRFA 3ID4A 2YUBA 1N7TA 1UEWA 1BFEA 3SFJA 2EV8A 1RY4A 2VWRA 2AWUA 3ZRTA 1GQ4A 3AXAA 1X5RA 4EDJA 4KFWA 4NXPA 2K20A 1LCYA 1FCFA 3PDZA 4NMPA 3O46A 2H3MA 1L6OA 4KFVA 2OZFA 2E7KA 1ZOKA 1Y8TA 4OEPA 2RRMA 5D13A 1UHPA 1WFVA 4XHVA 2HE4A 1TE0A 2MHOA 2OSGA 5E11A 1KWAA 3ID3A 3KDGA 2CSJA 3KZEA 4Q6HA 2PDZA 5HFEA 2YT8A 1IU2A 1X9ZA 1UM1A 4G69A 3CBZA 4OEOA 2G5MB 3QGLA 2KOHA 4NXRA 1UJVA 2M10A 2KOMA 2KPKA 2H2BA 5E1YA 1OBXA 4FGMA 1FC7A 3ID2A 1Z86A 2KL1A 2O2TA 4NMTA 3I18A 4P2AB 1W9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFX A;  1VCW A;  1MC7 A;  1KEF A;  2H2C A;  1TP5 A;  3PV5 A;  3CBY A;  3NFL A;  3LNY A;  2D90 A;  1YBO A;  1G9O A;  4AMH A;  1I16 A;  2WL7 A;  3DIW A;  2M0V A;  4K75 A;  2DM8 A;  1P1E A;  2EEH A;  2M0T A;  2EGN A;  3JXT A;  5EYZ A;  2DC2 A;  2JRE A;  3O5N A;  2VZ5 A;  2DLU A;  2Z9I A;  2RCZ A;  4JL7 A;  2AIN A;  2KRG A;  2QG1 A;  2JIK A;  1WI4 A;  5HDY A;  5HEB A;  2KPL A;  3NGH A;  1UF1 A;  1UJU A;  2AWX A;  3EGH C;  4PQW A;  1K32 A;  1B8Q A;  2UZC A;  3QJN A;  4JOE A;  3NFK A;  5DTH A;  2IWO A;  1V5L A;  5A2P A;  4N6X A;  1WI2 A;  3MH4 A;  3BPU A;  2EDP A;  4UU6 A;  2VSV A;  4Z33 A;  2FCF A;  1Y7N A;  1Q3P A;  2DKR A;  2REY A;  3CYY A;  4H11 A;  4L8N A;  3RL8 A;  5E22 A;  2FNE A;  5H3J A;  2Z17 A;  2L4S A;  2LUI A;  2M3M A;  2EXG A;  2KJD A;  1X8S A;  2KYL A;  2KA9 A;  1WHA A;  1Q3O A;  4Q2Q A;  2DMZ A;  2KQF A;  5HFD A;  5HF4 A;  2I1N A;  2I0I A;  2YUY A;  3TSW A;  1VJ6 A;  3R0H A;  3SHW A;  4WYT A;  2IWQ A;  1QAU A;  5HFB A;  3K50 A;  4GHN A;  3GGE A;  4NMR A;  2EGK A;  2GZV A;  3CC0 A;  1N6E A;  1N99 A;  1MFG A;  1FC9 A;  1OZI A;  1N6D A;  5HET A;  2P3W A;  5HED A;  1X6D A;  3DOR A;  1WHD A;  3K1R A;  1RZX A;  2IWP A;  1NF3 C;  2I6V A;  3E17 A;  3PV2 A;  3PS4 A;  2H3L A;  2EDZ A;  4E3B A;  2L4T A;  3GDV A;  1SOT A;  3LNX A;  5G1E A;  1D5G A;  1UEQ A;  5FHT A;  2OGP A;  4P0C A;  1Z87 A;  4Q6S A;  2IWN A;  1XZ9 A;  4IC6 A;  2R3Y A;  2EJY A;  4GVC A;  2KAW A;  2Q9V A;  3PV4 A;  3HPM A;  4HOP B;  3TSV A;  2OQS A;  4Q3H A;  1IU0 A;  1WG6 A;  4NXQ A;  2YT7 A;  2G2L A;  4Q2N A;  1TP3 A;  3DJ3 A;  1MFL A;  2V1W A;  1GM1 A;  4E34 A;  3VQF A;  3GDS A;  2OMJ A;  3WKL A;  2I4S A;  4JOR A;  3DJA A;  4NMQ A;  2R4H A;  4JOF A;  1UEP A;  1V62 A;  2OPG A;  3B76 A;  1WF7 A;  1V1T A;  1SOZ A;  2CSS A;  2YTW A;  2ZPM A;  4OAJ A;  2DB5 A;  1IHJ A;  2LC7 A;  3ID1 A;  2JOA A;  2QKT A;  4NMS A;  1WJL A;  2ENO A;  4WYU A;  4Q2P A;  1WFG A;  2OS6 A;  3CH8 A;  3SUZ A;  1X5Q A;  3FY5 A;  1QAV B;  1KY9 A;  2EAQ A;  3WKM A;  2F0A A;  2Q3G A;  2QT5 A;  3MH6 A;  1FC6 A;  1VA8 A;  2KG2 A;  2PKU A;  2D92 A;  3OU0 A;  4K6Y A;  4JOH A;  4UU5 A;  1U39 A;  4JOP A;  2EDV A;  5G1D A;  2JIN A;  4E35 A;  1OBY A;  4YYX A;  1TQ3 A;  1U37 A;  5F3X A;  2F5Y A;  2PZD A;  5E21 A;  1WH1 A;  4JOG A;  2JWE A;  4LMM A;  2M0U A;  5HJ1 A;  4NMV A;  5I7Z A;  3CS0 A;  2DAZ A;  2ZPL A;  3OTP A;  5F67 A;  1N7E A;  3SOE A;  2L97 A;  2LA8 A;  3EGG C;  1X45 A;  2W4F A;  3DJ1 A;  1QLC A;  2BYG A;  3MH7 A;  2LC6 A;  4R2Z A;  1T2M A;  3TSZ A;  2HE2 A;  3HVQ C;  2LOB A;  4JOJ A;  2JIL A;  4MPA A;  1V5Q A;  1I92 A;  1N7F A;  2MX6 A;  1GQ5 A;  1R6J A;  2VPH A;  2VSP A;  1WIF A;  3GCN A;  3QDO A;  2DJT A;  1UM7 A;  3QO6 A;  3GSL A;  5GND A;  2PKT A;  1WF8 A;  4K72 A;  1VB7 A;  5FB8 C;  2EEI A;  2JXO A;  2QBW A;  2HGA A;  5EZ0 A;  5HF1 A;  3KZD A;  2PNT A;  2D8I A;  1UIT A;  2K1Z A;  1M5Z A;  1BE9 A;  3R68 A;  1VAE A;  3QJM A;  4NNM A;  2M0Z A;  2FN5 A;  5B6L A;  4Q2O A;  3QE1 A;  2EEJ A;  1P1D A;  1W9E A;  2I04 A;  3RL7 A;  4HOP A;  4JOK A;  2V90 A;  4Z8J A;  2FE5 A;  2X7Z A;  2EGO A;  1V6B A;  1N6F A;  1U3B A;  4K78 A;  4NNL A;  3I1E A;  3CBX A;  3STJ A;  3K82 A;  5HEY A;  1RGW A;  4O06 A;  4YDP A;  2W7R A;  2QKU A;  2OCS A;  2CS5 A;  3PDV A;  2KBS A;  3GDU A;  1U38 A;  4NMO A;  2QKV A;  3QIK A;  3RLE A;  5E6P B;  4K76 A;  1X5N A;  2KJP A;  3I4W A;  4RI0 A;  3GJ9 A;  2EHR A;  2EEG A;  3R69 A;  2AWW A;  3HPK A;  1W9Q A;  2KV8 A;  5HFC A;  1ZUB A;  1OBZ A;  1UEZ A;  4F8K A;  2I0L A;  2KJK A;  5GLJ A;  1PDR A;  3VQG A;  3TMH A;  3L4F D;  4REY A;  4GVD A;  2KOJ A;  5HFF A;  1RGR A;  1QAV A;  3KHF A;  3SHU A;  1Q7X A;  5JXB A;  3GCO A;  2DLS A;  1UJD A;  1NTE A;  2PA1 A;  2VRF A;  3ID4 A;  2YUB A;  1N7T A;  1UEW A;  1BFE A;  3SFJ A;  2EV8 A;  1RY4 A;  2VWR A;  2AWU A;  3ZRT A;  1GQ4 A;  3AXA A;  1X5R A;  4EDJ A;  4KFW A;  4NXP A;  2K20 A;  1LCY A;  1FCF A;  3PDZ A;  4NMP A;  3O46 A;  2H3M A;  1L6O A;  4KFV A;  2OZF A;  2E7K A;  1ZOK A;  1Y8T A;  4OEP A;  2RRM A;  5D13 A;  1UHP A;  1WFV A;  4XHV A;  2HE4 A;  1TE0 A;  2MHO A;  2OSG A;  5E11 A;  1KWA A;  3ID3 A;  2CSJ A;  3KZE A;  4Q6H A;  2PDZ A;  5HFE A;  2YT8 A;  1IU2 A;  1UM1 A;  4G69 A;  3CBZ A;  4OEO A;  2G5M B;  3QGL A;  2KOH A;  4NXR A;  1UJV A;  2M10 A;  2KOM A;  2KPK A;  2H2B A;  5E1Y A;  1OBX A;  4FGM A;  1FC7 A;  3ID2 A;  1Z86 A;  2KL1 A;  2O2T A;  4NMT A;  3I18 A;  4P2A B;  1W9O A; 
#chains in the Genus database with same CATH topology
 1UFX A;  1VCW A;  1MC7 A;  1KEF A;  2H2C A;  1TP5 A;  3PV5 A;  3CBY A;  3NFL A;  3LNY A;  2D90 A;  5IL9 A;  1YBO A;  1G9O A;  3KDK A;  4AMH A;  1I16 A;  2WL7 A;  3DIW A;  2M0V A;  4K75 A;  2DM8 A;  1P1E A;  2EEH A;  2M0T A;  2EGN A;  3JXT A;  5EYZ A;  2DC2 A;  2JRE A;  3O5N A;  2VZ5 A;  2DLU A;  2Z9I A;  2RCZ A;  4JL7 A;  2AIN A;  2KRG A;  2QG1 A;  2JIK A;  1WI4 A;  5HDY A;  5HEB A;  2KPL A;  3NGH A;  1UF1 A;  1UJU A;  2AWX A;  3EGH C;  4PQW A;  1K32 A;  1B8Q A;  2UZC A;  3QJN A;  4JOE A;  3NFK A;  5DTH A;  5ILB A;  2IWO A;  1V5L A;  5A2P A;  4N6X A;  1WI2 A;  3MH4 A;  3BPU A;  2EDP A;  4UU6 A;  2VSV A;  4Z33 A;  2FCF A;  1Y7N A;  1Q3P A;  2DKR A;  2REY A;  3CYY A;  4H11 A;  4L8N A;  3RL8 A;  5E22 A;  2FNE A;  5H3J A;  2Z17 A;  2L4S A;  2LUI A;  2M3M A;  2EXG A;  2KJD A;  1X8S A;  2KYL A;  2KA9 A;  1WHA A;  1Q3O A;  4Q2Q A;  2DMZ A;  2KQF A;  5HFD A;  5HF4 A;  2I1N A;  2I0I A;  2YUY A;  3TSW A;  1VJ6 A;  3R0H A;  3SHW A;  4WYT A;  2IWQ A;  1QAU A;  5HFB A;  3K50 A;  4GHN A;  3GGE A;  4NMR A;  2EGK A;  2GZV A;  3CC0 A;  1N6E A;  1N99 A;  1MFG A;  1FC9 A;  1OZI A;  1N6D A;  5HET A;  2P3W A;  5HED A;  1X6D A;  3DOR A;  1WHD A;  3K1R A;  1RZX A;  2IWP A;  1NF3 C;  2I6V A;  3E17 A;  3PV2 A;  3PS4 A;  2H3L A;  2EDZ A;  4E3B A;  2L4T A;  3GDV A;  1SOT A;  3LNX A;  5G1E A;  1D5G A;  1UEQ A;  4JJ3 A;  5FHT A;  2OGP A;  4P0C A;  1Z87 A;  4Q6S A;  2IWN A;  1XZ9 A;  4IC6 A;  2R3Y A;  2EJY A;  4GVC A;  2KAW A;  2Q9V A;  3PV4 A;  3HPM A;  4HOP B;  3TSV A;  2OQS A;  4Q3H A;  1IU0 A;  1WG6 A;  4NXQ A;  2YT7 A;  2G2L A;  4Q2N A;  1TP3 A;  3DJ3 A;  1MFL A;  2V1W A;  1GM1 A;  4E34 A;  3VQF A;  3GDS A;  2OMJ A;  3WKL A;  2I4S A;  4JOR A;  3DJA A;  4NMQ A;  2R4H A;  4JOF A;  1UEP A;  1V62 A;  2OPG A;  3B76 A;  1WF7 A;  1V1T A;  1SOZ A;  2CSS A;  2YTW A;  2ZPM A;  4OAJ A;  2DB5 A;  1IHJ A;  2LC7 A;  3ID1 A;  2JOA A;  2QKT A;  4NMS A;  1WJL A;  2ENO A;  4WYU A;  2JSN A;  4Q2P A;  1WFG A;  2OS6 A;  3CH8 A;  3SUZ A;  1X5Q A;  3FY5 A;  1QAV B;  1KY9 A;  2EAQ A;  2GEF A;  3WKM A;  2F0A A;  2Q3G A;  2QT5 A;  3MH6 A;  1FC6 A;  1VA8 A;  2KG2 A;  2PKU A;  2D92 A;  3OU0 A;  4FLN A;  4JOH A;  4K6Y A;  4UU5 A;  1U39 A;  4JOP A;  2EDV A;  5G1D A;  2JIN A;  4E35 A;  1OBY A;  4YYX A;  1TQ3 A;  1U37 A;  5F3X A;  2F5Y A;  2PZD A;  5E21 A;  1WH1 A;  4JOG A;  2JWE A;  4LMM A;  2M0U A;  5HJ1 A;  4NMV A;  5I7Z A;  3CS0 A;  2DAZ A;  2ZPL A;  3OTP A;  5F67 A;  1N7E A;  3SOE A;  2L97 A;  2LA8 A;  3EGG C;  1X45 A;  2W4F A;  3DJ1 A;  1QLC A;  2BYG A;  3MH7 A;  2LC6 A;  4R2Z A;  1T2M A;  3TSZ A;  2HE2 A;  3HVQ C;  2LOB A;  4JOJ A;  2JIL A;  4MPA A;  1V5Q A;  1I92 A;  1N7F A;  2MX6 A;  1GQ5 A;  1R6J A;  2VPH A;  2VSP A;  1WIF A;  3GCN A;  3QDO A;  2DJT A;  1UM7 A;  3QO6 A;  3GSL A;  5GND A;  2PKT A;  1WF8 A;  4K72 A;  1VB7 A;  5FB8 C;  2EEI A;  2JXO A;  2QBW A;  2HGA A;  5EZ0 A;  5HF1 A;  3KZD A;  2PNT A;  2D8I A;  1UIT A;  2K1Z A;  3NCV A;  1M5Z A;  5B42 A;  1BE9 A;  3R68 A;  1VAE A;  3QJM A;  4NNM A;  2M0Z A;  2FN5 A;  3GAB A;  5B6L A;  4Q2O A;  3QE1 A;  2EEJ A;  1P1D A;  1W9E A;  2I04 A;  3RL7 A;  4HOP A;  4JOK A;  2V90 A;  4Z8J A;  2FE5 A;  2X7Z A;  2EGO A;  1V6B A;  1N6F A;  1U3B A;  4K78 A;  4NNL A;  3I1E A;  3CBX A;  3STJ A;  3K82 A;  5HEY A;  1RGW A;  4O06 A;  4YDP A;  2W7R A;  2QKU A;  2OCS A;  4JJ0 A;  2CS5 A;  3PDV A;  2KBS A;  3GDU A;  1U38 A;  4NMO A;  2QKV A;  3QIK A;  3RLE A;  5E6P B;  4K76 A;  1X5N A;  2KJP A;  3I4W A;  4RI0 A;  3GJ9 A;  2EHR A;  2EEG A;  3R69 A;  2AWW A;  3HPK A;  1W9Q A;  2KV8 A;  5HFC A;  1ZUB A;  1OBZ A;  1UEZ A;  4F8K A;  2I0L A;  2KJK A;  5GLJ A;  1PDR A;  3VQG A;  3TMH A;  3L4F D;  4REY A;  4GVD A;  2KOJ A;  5HFF A;  1RGR A;  1QAV A;  3KHF A;  3SHU A;  1Q7X A;  5JXB A;  3GCO A;  2DLS A;  1UJD A;  1NTE A;  2PA1 A;  2VRF A;  3ID4 A;  2YUB A;  1N7T A;  1UEW A;  1BFE A;  3SFJ A;  2EV8 A;  1RY4 A;  2VWR A;  2AWU A;  3ZRT A;  1GQ4 A;  3AXA A;  1X5R A;  4EDJ A;  4KFW A;  4NXP A;  2K20 A;  1LCY A;  1FCF A;  3PDZ A;  4NMP A;  3O46 A;  2H3M A;  1L6O A;  4KFV A;  2OZF A;  2E7K A;  1ZOK A;  1Y8T A;  4OEP A;  2RRM A;  5D13 A;  1UHP A;  1WFV A;  4XHV A;  2HE4 A;  1TE0 A;  2MHO A;  2OSG A;  5E11 A;  1KWA A;  3ID3 A;  3KDG A;  2CSJ A;  3KZE A;  4Q6H A;  2PDZ A;  5HFE A;  2YT8 A;  1IU2 A;  1X9Z A;  1UM1 A;  4G69 A;  3CBZ A;  4OEO A;  2G5M B;  3QGL A;  2KOH A;  4NXR A;  1UJV A;  2M10 A;  2KOM A;  2KPK A;  2H2B A;  5E1Y A;  1OBX A;  4FGM A;  1FC7 A;  3ID2 A;  1Z86 A;  2KL1 A;  2O2T A;  4NMT A;  3I18 A;  4P2A B;  1W9O A; 
#chains in the Genus database with same CATH homology
 1UFX A;  1VCW A;  1MC7 A;  1KEF A;  2H2C A;  1TP5 A;  3PV5 A;  3CBY A;  3NFL A;  3LNY A;  2D90 A;  5IL9 A;  1YBO A;  1G9O A;  3KDK A;  4AMH A;  1I16 A;  2WL7 A;  3DIW A;  2M0V A;  4K75 A;  2DM8 A;  1P1E A;  2EEH A;  2M0T A;  2EGN A;  3JXT A;  5EYZ A;  2DC2 A;  2JRE A;  3O5N A;  2VZ5 A;  2DLU A;  2Z9I A;  2RCZ A;  4JL7 A;  2AIN A;  2KRG A;  2QG1 A;  2JIK A;  1WI4 A;  5HDY A;  5HEB A;  2KPL A;  3NGH A;  1UF1 A;  1UJU A;  2AWX A;  3EGH C;  4PQW A;  1K32 A;  1B8Q A;  2UZC A;  3QJN A;  4JOE A;  3NFK A;  5DTH A;  5ILB A;  2IWO A;  1V5L A;  5A2P A;  4N6X A;  1WI2 A;  3MH4 A;  3BPU A;  2EDP A;  4UU6 A;  2VSV A;  4Z33 A;  2FCF A;  1Y7N A;  1Q3P A;  2DKR A;  2REY A;  3CYY A;  4H11 A;  4L8N A;  3RL8 A;  5E22 A;  2FNE A;  5H3J A;  2Z17 A;  2L4S A;  2LUI A;  2M3M A;  2EXG A;  2KJD A;  1X8S A;  2KYL A;  2KA9 A;  1WHA A;  1Q3O A;  4Q2Q A;  2DMZ A;  2KQF A;  5HFD A;  5HF4 A;  2I1N A;  2I0I A;  2YUY A;  3TSW A;  1VJ6 A;  3R0H A;  3SHW A;  4WYT A;  2IWQ A;  1QAU A;  5HFB A;  3K50 A;  4GHN A;  3GGE A;  4NMR A;  2EGK A;  2GZV A;  3CC0 A;  1N6E A;  1N99 A;  1MFG A;  1FC9 A;  1OZI A;  1N6D A;  5HET A;  2P3W A;  5HED A;  1X6D A;  3DOR A;  1WHD A;  3K1R A;  1RZX A;  2IWP A;  1NF3 C;  2I6V A;  3E17 A;  3PV2 A;  3PS4 A;  2H3L A;  2EDZ A;  4E3B A;  2L4T A;  3GDV A;  1SOT A;  3LNX A;  5G1E A;  1D5G A;  1UEQ A;  4JJ3 A;  5FHT A;  2OGP A;  4P0C A;  1Z87 A;  4Q6S A;  2IWN A;  1XZ9 A;  4IC6 A;  2R3Y A;  2EJY A;  4GVC A;  2KAW A;  2Q9V A;  3PV4 A;  3HPM A;  4HOP B;  3TSV A;  2OQS A;  4Q3H A;  1IU0 A;  1WG6 A;  4NXQ A;  2YT7 A;  2G2L A;  4Q2N A;  1TP3 A;  3DJ3 A;  1MFL A;  2V1W A;  1GM1 A;  4E34 A;  3VQF A;  3GDS A;  2OMJ A;  3WKL A;  2I4S A;  4JOR A;  3DJA A;  4NMQ A;  2R4H A;  4JOF A;  1UEP A;  1V62 A;  2OPG A;  3B76 A;  1WF7 A;  1V1T A;  1SOZ A;  2CSS A;  2YTW A;  2ZPM A;  4OAJ A;  2DB5 A;  1IHJ A;  2LC7 A;  3ID1 A;  2JOA A;  2QKT A;  4NMS A;  1WJL A;  2ENO A;  4WYU A;  2JSN A;  4Q2P A;  1WFG A;  2OS6 A;  3CH8 A;  3SUZ A;  1X5Q A;  3FY5 A;  1QAV B;  1KY9 A;  2EAQ A;  2GEF A;  3WKM A;  2F0A A;  2Q3G A;  2QT5 A;  3MH6 A;  1FC6 A;  1VA8 A;  2KG2 A;  2PKU A;  2D92 A;  3OU0 A;  4FLN A;  4JOH A;  4K6Y A;  4UU5 A;  1U39 A;  4JOP A;  2EDV A;  5G1D A;  2JIN A;  4E35 A;  1OBY A;  4YYX A;  1TQ3 A;  1U37 A;  5F3X A;  2F5Y A;  2PZD A;  5E21 A;  1WH1 A;  4JOG A;  2JWE A;  4LMM A;  2M0U A;  5HJ1 A;  4NMV A;  5I7Z A;  3CS0 A;  2DAZ A;  2ZPL A;  3OTP A;  5F67 A;  1N7E A;  3SOE A;  2L97 A;  2LA8 A;  3EGG C;  1X45 A;  2W4F A;  3DJ1 A;  1QLC A;  2BYG A;  3MH7 A;  2LC6 A;  4R2Z A;  1T2M A;  3TSZ A;  2HE2 A;  3HVQ C;  2LOB A;  4JOJ A;  2JIL A;  4MPA A;  1V5Q A;  1I92 A;  1N7F A;  2MX6 A;  1GQ5 A;  1R6J A;  2VPH A;  2VSP A;  1WIF A;  3GCN A;  3QDO A;  2DJT A;  1UM7 A;  3QO6 A;  3GSL A;  5GND A;  2PKT A;  1WF8 A;  4K72 A;  1VB7 A;  5FB8 C;  2EEI A;  2JXO A;  2QBW A;  2HGA A;  5EZ0 A;  5HF1 A;  3KZD A;  2PNT A;  2D8I A;  1UIT A;  2K1Z A;  3NCV A;  1M5Z A;  5B42 A;  1BE9 A;  3R68 A;  1VAE A;  3QJM A;  4NNM A;  2M0Z A;  2FN5 A;  3GAB A;  5B6L A;  4Q2O A;  3QE1 A;  2EEJ A;  1P1D A;  1W9E A;  2I04 A;  3RL7 A;  4HOP A;  4JOK A;  2V90 A;  4Z8J A;  2FE5 A;  2X7Z A;  2EGO A;  1V6B A;  1N6F A;  1U3B A;  4K78 A;  4NNL A;  3I1E A;  3CBX A;  3STJ A;  3K82 A;  5HEY A;  1RGW A;  4O06 A;  4YDP A;  2W7R A;  2QKU A;  2OCS A;  4JJ0 A;  2CS5 A;  3PDV A;  2KBS A;  3GDU A;  1U38 A;  4NMO A;  2QKV A;  3QIK A;  3RLE A;  5E6P B;  4K76 A;  1X5N A;  2KJP A;  3I4W A;  4RI0 A;  3GJ9 A;  2EHR A;  2EEG A;  3R69 A;  2AWW A;  3HPK A;  1W9Q A;  2KV8 A;  5HFC A;  1ZUB A;  1OBZ A;  1UEZ A;  4F8K A;  2I0L A;  2KJK A;  5GLJ A;  1PDR A;  3VQG A;  3TMH A;  3L4F D;  4REY A;  4GVD A;  2KOJ A;  5HFF A;  1RGR A;  1QAV A;  3KHF A;  3SHU A;  1Q7X A;  5JXB A;  3GCO A;  2DLS A;  1UJD A;  1NTE A;  2PA1 A;  2VRF A;  3ID4 A;  2YUB A;  1N7T A;  1UEW A;  1BFE A;  3SFJ A;  2EV8 A;  1RY4 A;  2VWR A;  2AWU A;  3ZRT A;  1GQ4 A;  3AXA A;  1X5R A;  4EDJ A;  4KFW A;  4NXP A;  2K20 A;  1LCY A;  1FCF A;  3PDZ A;  4NMP A;  3O46 A;  2H3M A;  1L6O A;  4KFV A;  2OZF A;  2E7K A;  1ZOK A;  1Y8T A;  4OEP A;  2RRM A;  5D13 A;  1UHP A;  1WFV A;  4XHV A;  2HE4 A;  1TE0 A;  2MHO A;  2OSG A;  5E11 A;  1KWA A;  3ID3 A;  3KDG A;  2CSJ A;  3KZE A;  4Q6H A;  2PDZ A;  5HFE A;  2YT8 A;  1IU2 A;  1X9Z A;  1UM1 A;  4G69 A;  3CBZ A;  4OEO A;  2G5M B;  3QGL A;  2KOH A;  4NXR A;  1UJV A;  2M10 A;  2KOM A;  2KPK A;  2H2B A;  5E1Y A;  1OBX A;  4FGM A;  1FC7 A;  3ID2 A;  1Z86 A;  2KL1 A;  2O2T A;  4NMT A;  3I18 A;  4P2A B;  1W9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...