1LCYA

Crystal structure of the mitochondrial serine protease htra2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
320
structure length
296
Chain Sequence
b'PPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HtrA2 serine protease
publication title Structural insights into the pro-apoptotic function of mitochondrial serine protease HtrA2/Omi.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 296
sequence length 320
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1lcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA02
1VCQA 4HZHA 3U98H 1DWCH 2ZU2A 3A82A 2D26C 1GJBB 1IHSH 1O38A 2G5VA 1MD7A 1FQ3A 3SOSA 2F9BH 1UCYH 2WV5A 1K28D 2P16A 2VH6A 2ZQ1A 2VVUA 5HXFA 1TNIA 4MDSA 2A1DB 4D9RA 2B5TB 3S9CA 1C5NH 4Y11E 5C67A 2PKAB 3T27A 2GMTB 1GVLA 2V3HH 3V13A 3O8RA 2IWQA 1BFEA 1H9LB 3RXIA 2W5EA 1T7CA 2ZWLH 4YT7H 1HV7A 2QIQA 1KTSB 1SGRE 4VGCC 1O3BA 2EEIA 4Y0YE 1NRSH 1O3HA 1V3XA 1GMDG 1Z8IB 2ALPA 4BXSA 2JH6D 5E2PA 1GGDB 1K1OA 1P9SA 2EDPA 4AORA 2Y81A 4B71A 2H5DA 4E7NA 1N6DA 5FX6A 1ZPBA 4NXPA 3RXAA 1QURH 4ISOA 1HBTH 2WPJS 2GV7A 1O2IA 3ATMA 4AFQA 2F9PA 1O34A 5CMXH 2PSXA 4FUDA 5JDUB 4TY6A 1V1TA 2PTNA 2GMTC 1TONA 2H5CA 3SNEA 1AWHB 5E0GA 1QRXA 1ZSLA 3ZVFA 2Z6BD 1O3FA 2LPRA 3F1SB 1NRRH 4JZDH 4GVCA 1RTLA 4J1YA 4Q7YA 1BMLA 1G2MA 2FWWA 2G4TA 1AKSA 1P1DA 1XZ9A 3ZZ6A 3KZDA 1YCPM 2VNTA 1GGDC 2QXGA 2OXSA 1UJDA 1N99A 1RTFB 1SGTA 5GDSH 1K1MA 1DUAA 4ABGA 1FV9A 4IC6A 4A5TS 1TRMA 4AN7A 1NTPA 2O8LA 3R68A 2G55A 2AYWA 4BXWA 1WTGH 1QNJA 1A61H 3GY7A 2BVRH 1BTXA 2GZ8A 2R2MB 3SJ8A 3UTUH 5EG4A 1GDQA 3SU1A 5C2ZA 1RGWA 2ZI2H 1BQYA 5DKMA 5JB9S 1SLXB 4BNRA 1RGRA 3SORA 3HPTB 2OTVA 2VPHA 1NRQH 1WUNH 2Z3DA 3C27B 3ZZ3A 2V1WA 3E3TA 5EXLA 1TPPA 1Z6JH 3P17H 2EV8A 1C4Y2 4WVPE 1O2RA 2NU1E 3LGUA 1Q2WA 1EOJA 1XX9A 2KAIA 4RI0A 1O36A 3RXEA 3SQEE 1PYTC 3UFAA 4ESTE 2Q6GA 4MG3A 1K1PA 1AGJA 2BVSH 2A4RA 2P3TB 1D6WA 1FUJA 1YBWA 4LZ4B 3PLBA 3A7YA 1W11U 5GPIB 2KAIB 1SBWA 1C5VA 2XCNA 3DJ3A 4U32A 4RKOB 3ZYEA 3PS4A 2AMQA 3B23B 3UY9A 3TSZA 3D65E 1O3MA 5EQRA 2QC2A 4HOPB 4F4OC 1MMJN 1S83A 1O3PB 3BV9B 5I25A 4G69A 2ZU5A 1WOFA 2Y6TA 3MFJA 2EEKA 1DSTA 2H2BA 2H2CA 2L4SA 1C2KA 3HK3B 1DUEA 1LPZB 1T32A 3PLPA 1U38A 3AW0A 2QF3A 1LVMA 4UE7H 2QCYA 1QCPA 3FZDA 3ATWA 2ZDKA 3FAOA 1NFXA 1N6EA 2F9OA 4JYTA 3S69A 1THSH 1WHDA 1RD3B 5IYTA 4Y76A 3LGVA 3S9AA 1W12U 2FOMB 1ELGA 4IGDA 4JOPA 1ZRKA 3RLYH 1MKWH 2C3SA 4YLUA 1TBZH 2CF8H 3W95A 3CP7A 4MPAA 2M5TA 3A8DA 1QAVA 2PLXA 4XDEA 1P2KA 1G3EA 5JXBA 1VJ9U 3BTHE 4Y8XA 3KN2A 3SJ9A 3ZVBA 1JMOH 1KLIH 5EW2H 1C1VH 1GI1A 1C4V2 4FU8A 2VWMA 5A8XA 3DJ1A 1NT1A 1QAVB 5HFDA 1C5XB 1UHBA 1SGIB 6GCHG 5I46H 1HAOH 2KA9A 3VQGA 1S85A 2XWBI 1AVWA 1BMAA 1Y3VA 1QBOA 5JB8S 2QKTA 3VXEH 5EZ0A 1BRUP 2H2ZA 3UNQA 1FLEE 5AFZH 3RU4D 1BMNH 1GHYH 1KSNA 2DMZA 1AUTC 1JBUH 1BTHH 3VEQB 3UUZA 2VINA 1THPB 2DKRA 4NIYA 2JH0D 3SHUA 1IU2A 3TSWA 2QKUA 3RMNH 2HLCA 1V2OT 4BAOB 3MWIU 1HAVA 1DLEA 2X7ZA 3CYYA 4PQWA 1O3KA 4NNMA 1B5GH 1BT7A 3WKLA 1V2VT 5L30H 5FCRA 5HFBA 2BD5A 1ELFA 2HPPH 1CGIE 4Y79A 4WH6A 1Y3WA 5TCCA 1JWTA 1L4DA 3SUEA 1U3BA 3NFLA 1KDQB 1WJLA 2ZQ2A 1T8LA 1S5SA 4MNWA 1D5GA 2SFAA 1KLJH 2EI8A 1KXDA 3T26A 2ILNA 1TOMH 1TNJA 3BTME 4R8TB 2BY6X 2BLQA 2LOBA 4GAWA 1O3IA 1V2RT 3ZZ8A 5A8YA 1D3DB 1T4UH 3L3TA 4JL7A 2EJYA 4Q2PA 2AMPA 5L2ZH 1UTMA 2Z9IA 1A7SA 1GMDF 2BMGB 5C20A 7GCHG 1BTPA 2DLUA 4HTCH 2QGRA 1TPAE 4DIIH 1MU8B 1J17T 9LPRA 1BCUH 1P06A 4OS5A 2TIOA 5JBBS 5LPFA 5HJ1A 2FOHA 1TOCB 1P03A 2GZ9A 2F91A 2QXIA 3P8GA 4FUGA 1N6YA 4RN6A 3DJAA 2Y7ZA 4IMQA 3UQOA 2GDDA 1LHEH 2V3OH 2R2WU 2QXHA 1GBLA 4R0IA 3DA9B 2EEGA 4K2YA 2GTBA 1FXYA 3RLWH 2JILA 2R0LA 2CN0H 2ODQA 5EYZA 1Q7XA 1C2FA 1UJVA 3RXHA 3SN8A 2TGPZ 3ZZAA 3M5NA 2BDBA 4U01A 3RP2A 4BTUB 1IHTH 2STBE 3LDXH 3OSYA 1T8NA 5EQSA 3SUDA 1GDNA 1TFXA 1TQ0B 5BRRE 3TGKE 4KFVA 1A5HA 1LHGH 1PYTD 2ZHQH 2VVVA 1ZRBA 3HPKA 2G52A 2XXLA 1ANDA 4E7RG 2B8OH 1FC9A 3BF6H 4J2YB 3K50A 1TLDA 2JKHA 2R4HA 1SL3A 2FESH 3A81A 3LONA 3D23A 4LMMA 1O0DH 5A8ZA 2JH5D 1BUIA 4XFQA 4Z0KA 1EJMA 1ZHMA 1T8MA 2BD7A 1S81A 3LU9B 5B6OA 2ULLA 2XYAA 1JIMA 1NRNH 1K2I1 5DGJA 3UREA 4NWKA 1NM6A 3ID3A 5LPRA 1O2LA 2BX3A 3UR6A 2Z9LA 1O2GH 3BTGE 3SZNA 1FY1A 2KOMA 1Z1JA 3B9FH 2GCHG 1O3AA 4X8TH 4H6TA 1GI6A 2GKVE 1N6FA 1R6JA 1YPMH 1O30A 1BIOA 4YM9A 4AYYB 1OZIA 2ODYB 3LKWA 2FI5E 1CHOG 1ZSJA 1L4ZA 1PPCE 2ZGCA 3M3TA 3SW2B 3ZZBA 2RA3A 1YPHC 3ZZCA 2SGDE 4BOHA 1AMHA 1O3JA 4JK5A 1GBHA 2FTLE 1Z8JB 4INLA 3SV8A 1LHDH 3BEUA 3PWCA 3TJNA 3UWJH 3BTEE 1CGHA 1KWAA 1MH0A 3AAUA 2F9VA 2GVFA 4CRBA 4XBDA 4Y71A 1BTWA 1L1NA 1GJ7B 3HPMA 4GHTA 2VWNA 3GYLB 1HDTH 1RFNA 1O33A 3UNRA 1C5UA 1E36B 1GBBA 3RM0H 4U2WA 2EA3A 3SJOA 3GCOA 2VIQA 1TALA 1WH1A 2OUAA 3QN7A 1AZZA 1DFPA 1FONA 1ZSKA 2BDYA 3EA7A 1C5RA 1P2QA 3RXJA 1V5QA 2I0LA 4ABDA 4MPVA 1LVBA 1UCYK 3FY5A 2RRMA 1OX1A 1FC7A 1MC7A 2P3WA 1A3BH 2RG3A 4IC5A 1C1MA 2GZ7A 3MO3A 4GSOA 3URDA 1IQKA 1CSOE 3SI3H 4UFEH 2QN5T 2RCZA 2Z9KA 1GBFA 1UM7A 2QXJA 4A92A 3QGJA 1M5ZA 2BYAX 5HGGA 4KTSA 1CGJE 1FJSA 1THRH 2H9TH 4NZLA 1L0ZA 4P2AB 3TNSA 4CREA 3M5OA 1MD8A 4ABAA 1DY8A 5AF9H 1A0HB 3MO9A 1T2MA 2L4TA 3RXVA 3M37A 3SHAH 3T5FH 2AEIH 2Z7FE 1EQ9A 2SNVA 5HETA 4YESB 5GXPA 1IQHA 1VCPA 3I77A 1O2YA 1C2LA 3RL7A 2HGAA 2ZDAH 4ZAEA 4GHNA 1RS0A 9ESTA 5C1YA 3S7KB 2IWNA 1O2KA 3NKKA 2ZFFH 7ESTE 1C1UH 1TB6H 3P92A 4FUIA 4AG2A 4DGJA 1MQ5A 1JIRA 1V6DA 1CE5A 5J4QA 2GT7A 2UWLA 4WYTA 4DCDA 2FOGA 2O8TA 1ABJH 3LH3A 4X1SU 1PPBH 1K21H 5DP4A 1EASA 4KFWA 1P3CA 2FX4A 4X1NU 3ZVDA 1UM1A 1Z71A 1J14A 3CENA 1S84A 3AAVA 2A31A 4FVDA 1ELCA 4JZEH 3S9BA 1BRAA 1HAYB 2OLGA 1DLKB 4CH2B 5DP5A 1ZUBA 1XUIA 2BLOA 3MTYA 1ZTKA 5DP6A 5I7ZA 1P12E 1KIGH 1VAEA 3DD2H 4EDJA 2PFEA 3LH1A 1GVZA 4NXRA 3HGNA 5C3NA 1DXPA 1X5NA 3GDSA 1SGNE 3CBZA 4MNVA 2H3LA 5G1DA 1HGTH 1VITF 3SOEA 1QBVH 2ZFTA 4CR9A 2XBXA 5G4BA 3H7TA 1BBRH 1Q31A 2XC0A 4Z8JA 2JWEA 4Q6HA 1DITH 3RXTA 1B7XB 1UVUH 4CBNA 1Y7NA 4I8KA 2GGVB 3QDZB 2ZDMA 3A8CA 2AWWA 1GHVH 3UNSA 4ABEA 1AB9B 3JXTA 4NA7A 2P3UB 2BVXH 4CRFA 2SGPE 1F2SE 1MBMA 2FI4E 2ANWA 1W13U 2FOAA 4A7IB 2HNTE 2J38A 5SGAE 4O9VA 2ZPMA 4B1TA 4K3JA 4UD9H 5J4SA 1C2EA 1GI8B 2AS9A 1YPGH 3SU2A 1W7GH 2FTMA 1ZJDA 1O2WA 3MYWA 4WYUA 4NA8A 1ESBA 4NFEA 4MVNA 4DG4A 1T31A 3QWCH 1XUJA 1W2KH 2KL1A 4B74A 1GI4A 4ABJA 2ZU1A 1KXFA 4ISIH 1HAHH 2D92A 5T3HA 3LT3A 1V6BA 4CH8B 1UJ1A 1AB9C 4X8VH 1K1IA 3QX5H 4UEHH 5C1UA 4O97A 2GCHF 4XE4A 1SG8B 2BDAA 1VJ6A 2MHOA 4NA9H 1HAPH 4DIHH 1SQOA 2A45B 2ZA5A 3QJNA 3GCNA 1MKWK 2VJ1A 3VGCB 2WYGA 2R3UA 3QGLA 4WMFA 3LOXA 1YF4A 2FPZA 1OWKA 2PKAA 3ID4A 2W7SA 2EHRA 2IWPA 1O2UA 1O5CB 4JZFH 2PUQH 2RA0A 3KZEA 2QG1A 4Q3HA 2BOHB 1C5TA 5EOKA 1W9QA 1V2QT 4BAKB 3ELAH 4YOJA 5FPTA 5DK1A 1F5LA 1IQMA 3NCLA 4B2AA 2ZGJA 5L2YH 5K7RA 1C9TA 5F8ZA 1O2QA 5EXMA 4OGYA 2OPGA 3VB5A 1DY9A 1GJAB 3DORA 2VIOA 3VGCC 3CS7A 1LMWB 2FOCA 3WY8A 5JYIA 1LHFH 3MH7A 2ZCKP 5DP8A 5JBAS 1Z87A 4GCHF 1ORFA 1ARCA 4FUFA 1V2KT 1P2NA 2F9NA 8LPRA 5EU8A 3RXGA 1N7EA 3SU4A 2ZO3H 2W7RA 1WFVA 3H5CB 2PNTA 1IU0A 1C5SA 2J34A 3BEIB 1O2SA 3KQCA 2LNCA 2PGQB 1EAUA 5B6LA 2BDIA 1OOKB 4GLYA 4A1VA 4ABIA 2OQUA 1BTZA 3IITA 2W26A 3KCGH 1B0FA 2P95A 3PWBA 1AFQB 1HAGE 2AGIX 3M3VA 4AYVB 1ELDE 4I7YH 1O3GA 3TK6A 1QJ7B 2A4GA 1PPEE 1TX6A 1VR1H 3ZVCA 4B2BA 2A4OA 2KOHA 3RXLA 3JZ1B 6CHAB 1T8OA 1C2HA 2PA1A 3SGAE 2VWLA 2A2XH 1VB7A 1XKBC 3MU8A 2ZFQH 4JK6A 2HNTC 2UUKB 1KYNA 4CRCA 1FZZA 1FDPA 4B75A 3QIKA 1XUFA 1IHJA 1S0RA 3KEEA 4NNLA 1JRTA 1SLVB 4KTCA 1BTYA 2I4SA 4TY7A 3E8LA 3U8TH 1M9UA 1ZR0A 2A0QB 1V2WT 4JZIA 1PFXC 1Q3XA 1AFQC 2ZTXA 2BD8A 2ZPLA 1NU7B 5L6NH 3A86A 1E35B 2F9UA 3OTPA 1TGSZ 3IG6B 2BYGA 3LNYA 4YLQH 1GI9B 6CHAC 4Q2NA 2QY0B 1UCYE 2YT8A 5GLJA 1G2LA 5EPYA 2JOAA 4JORA 1EB2A 1P10A 2EDZA 1UTKA 2OMJA 4LK4A 3CS0A 1HJ8A 5DPAA 1IQIA 1SOZA 1WYKA 4HOPA 4KP0A 2QV1A 3Q3XA 1GHXH 2ZC9H 5HMAA 4X8SH 2J92A 2BD2A 1P01A 2JXOA 2KJKA 1GI7B 1F5KU 2K20A 2XWAA 1C1QA 2HRVA 1P02A 1XVOA 1U37A 2FN5A 3MNSA 2PKTA 1TGTA 3Q76A 3FZZA 1HLTH 1C5WB 2CSSA 4CBOA 2FI3E 3PV5A 1VJAU 1WU1A 1PQ8A 2ASUB 2QA9E 3L6PA 1ZMNA 2IN2A 1UF1A 4JCNA 3ESTA 1H9HE 2WPMS 4YOIA 1MBQA 2ZIQH 1C1RA 2Z17A 1EP5A 1MZAA 2Y7XA 3K9XB 4DOQA 1XXFA 2W4FA 5HFEA 1S6HA 4BAQB 1SGQE 1WSSH 5AVDA 1Z1IA 2H3MA 4X6NA 1WAYB 2DB5A 1GBMA 3K65B 2PDZA 1UO6A 2EGKA 4FVBA 1Z7KA 1FI8A 1LPGB 1LCYA 3O8CA 1INCA 1C2JA 4E06H 3STJA 3M61U 1IQFA 2FIRH 2TRMA 4Y7AA 2W3KA 4H42U 2ANKH 3MU5A 2OQ5A 1CA0B 2FOEA 4AFSA 4X0WU 1CU1A 1ZHRA 2FDAA 3TVJB 3RXMA 2UZCA 1LDTT 2P93A 1OXGA 3VXFH 3LPRA 4Z33A 3QJMA 4X6PA 3L33A 5EW1H 3A80A 5FX5A 5GCHF 1BB0B 1UVPA 1ZHPA 4SGBE 1XXDA 1YPJH 1HAXB 3U1JB 1NRPH 1VZQH 1G9OA 2ZTZA 3QTOH 2NU4E 1GMCG 1IOEA 1FY4A 5D13A 1NPMA 3E16B 1YPHE 3BN9A 4WMEA 2A4QA 1KDQA 3SBKA 1RZXA 3P6ZB 3MHWU 4GHQA 1CT0E 1GG6B 2Z3EA 5E22A 1CA0C 2VIVA 3LC5A 1O2OA 3ATIA 4DVAU 2BDCA 2BDGA 3ZZ4A 3D49H 1UK4A 2G4UA 2ZZUH 1GDUA 3GY6A 2FYRA 1QIXB 2OP9A 1O2VA 1NS3A 3CBYA 1SOTA 1U6QA 2LC6A 2KYLA 2FP7B 2ODPA 4K5ZA 2FOFA 4PROA 4OEPA 1TWXB 4L8NA 1H8DH 4ABFA 1OBXA 4Y0ZE 1VA8A 1V2ST 2Z9JA 1PQAA 1C2IA 3FP6E 2ALVA 2VSPA 5FBEA 2AFQB 4KKDA 1FNIA 1SFQB 3HATH 2OD3B 3T62A 2ZP0H 3SNCA 1MUEB 2BDHA 4JOGA 1BITA 1NFUA 3W94A 1GG6C 2I1NA 1A3EH 2PKSB 3PO1C 4AGKA 1PPGE 1C1OA 1AVGH 1GJ6A 4THNH 1XUHA 1H4WA 1UTLM 1EAIA 4I8JA 1MCTA 2M0UA 2OC7A 1TIOA 4H4FA 1VITG 3PYHA 4NMPA 4GUXA 3GJ9A 3RXFA 3ID2A 3U9AH 1BJVA 2HALA 3PROA 3K1RA 3GDVA 5DJ7A 1HJAB 5ESBA 2ZTYA 1C1TA 2WPHS 5E6PB 2O8WA 1OWHA 1TX7A 1GJCB 5LGOA 2CV3A 2HVXA 1C5YB 1ANCA 1C5OH 1MU6B 2PKUA 1L2EA 2HOBA 4HI3A 1LQEA 3SI4H 4NMTA 2HNTF 3P8FA 2Q9VA 1T4VH 3RMLH 1UMAH 2GCTB 3BTDE 1GJ8B 1AHTH 3RXUA 3L4FD 4X6MA 3F9HA 2PKSC 2VVCA 4I31A 4NCYA 1D3TB 5A0AE 1GM1A 4OAJA 1E0FD 2D2DA 4KTUA 1D3QB 5C5OA 2FE5A 2EI7A 1EJAA 3RXSA 3ID1A 2A7CA 4NFFA 2K1QA 2W7UA 2ZFPH 3TK9A 2C90B 4FU9A 2PUXB 3GCHB 1C9PA 2E7KA 1YCPH 4CRAA 3ODDA 1PDRA 1N7FA 1BBRK 1HJAC 2D8WA 2UWPA 3AVZA 1P9UA 2BLWA 5HF1A 1C5MD 1FPCH 1KXAA 1Q3PA 1Y8TA 2G8TA 3ZZ5A 5E11A 4AX9H 1K22H 2CJIA 3U69H 2GCTC 3MNXA 1ELBA 2ZF0H 1YM0A 3EGGC 1J16A 1NC6A 4ZH8A 2EGOA 1WBGB 2FM2A 2BX4A 2H6MA 2IWOA 2Q6FA 4K78A 1ABIH 1F0UA 7KMEH 2ZECA 4SGAE 2CSJA 1SGYE 3ATLA 2G5NA 2OCVB 2TPIZ 2VIPA 3QUMP 2HE4A 4X2YA 2A2QH 2ZU4A 4JOKA 4NMVA 1GMHF 3GCHC 1AI8H 2YOLA 2EC9H 1O37A 3GYMA 1RGQA 3KQDA 4TWWA 3RXBA 5ABWA 1C1WH 1QQ4A 1OP8A 3VB4A 1EUFA 8GCHG 3DUXH 3EAJA 1PQ5A 3OTJE 1AWFH 1EZSC 3T25A 3MNBA 3CH8A 2JETB 1TA6A 2WV4A 5FPYA 4AZ2B 2ANYA 2W3IA 2G00A 2Y5FA 4ASHA 1TAWA 2ZPRA 2YUYA 1K9OE 1AO5A 1ZTLA 2V35A 2BOKA 4H6SB 3OY6U 3LGTA 3R0FA 3ENSB 2OGPA 3TSVA 1P3EA 5IDKA 4AB9A 4A1TA 4GCHG 4Q80A 1WFGA 4Q2OA 3EE0B 4XSKU 3A7ZA 3MU1A 1BMMH 3PMBB 1QGFA 1O3EA 3M3SA 2O8UA 2DJTA 1HB0B 2CHAB 1W7XH 2M0ZA 1SHHB 3OYPA 1BRCE 2JETC 2Y5GA 2WL7A 3RU4T 4ISLA 1O3LA 2GD4B 2ZPQA 1BOQA 1UTNA 3URCA 4ZHMU 2CMYA 2R3YA 1TMUH 4ZKNU 3RLEA 1TNGA 3E17A 1QAUA 3KHFA 3P8NA 1AQ7A 2H1UA 2BY8X 3NWUA 4Y8YA 1SQTA 4ZXYH 3SV9A 3SHCH 2F0AA 1SVPA 2C8ZB 4IW4E 4AG1A 3NXPA 4O03A 1UTQA 4RSPA 3SNDA 2ANMH 1O2TA 1G32B 1CT4E 3FP8E 1Y3YA 3FP7E 1C5QA 1O32A 3OY5U 3RMOH 3ZZDA 1LKBA 2BZAA 3TLOA 1SQAA 1V2PT 1GMCF 1O3CA 5F8XA 2CHAC 2AINA 2G5MB 4N6XA 2QBWA 1P57B 1SHYA 3RC6A 1EB1H 3SU6A 3ZV8A 3FFGA 4BAHB 4K1SA 4MPUA 4E05H 1TPOA 2QAAA 2NU0E 1TNLA 1AE8H 4YO9A 6ESTA 1K1JA 2ZHEH 2R9PA 4FUEA 1SGEE 1CVWH 2CF9H 2Z94A 1OWEA 2UUJB 3RC4A 1OSSA 3F6UH 1F92A 4K8BA 4Q7XA 1EATA 5A0CA 4GVUA 1ELAA 2GZVA 3GISB 2M3MA 2DAZA 3K82A 2K1ZA 3RC5A 1TRYA 4BAMB 4LOYH 3ZZ9A 1OKXA 1GBAA 3EGHC 4FGMA 5EODA 1UITA 4B73A 3TK5A 2IOTA 4ZKRU 1UTJA 5JBTA 2VB0A 1W10U 2ZNKH 2THFB 3JZ2B 3LGIA 3F68H 1JXPA 1DT2A 5E0HA 5ETXA 2JIKA 2D90A 2VZ5A 3QZQA 1A46H 3UR9A 3A8BA 3MNCA 4WXVA 3TGIE 5K0HA 4AB8A 3Q3KA 4AOQA 4I33A 3MH5A 4Z6AH 5FHTA 3GSLA 2F5YA 3I78A 3KQBA 2OC1A 1WIFA 5F6MA 5LH8A 4A6LA 2Z3CA 4XBCA 1LTOA 1C1SA 3GY8A 4K60A 4D8NA 3QZRA 1EZUC 2R0KA 4UFGH 1NU9A 3FVFB 1NTEA 1O3NA 1ACBE 4D7GA 1QA7A 3E6PH 1C5ZB 1UVOA 3PLKA 5FB8C 1Z6EA 2ZHDA 3VPKA 3RM2H 1OYTH 2EI6A 5HEBA 1AVXA 1YP9A 2HPQH 1CQQA 1E34B 4UFFH 5AFYH 3P95A 4ISHH 3SV6A 3PDZA 1YPEH 1QL7A 1V2MT 2FYQA 4RKJB 1P1EA 1IQJA 2GX4A 1P09A 1SFIA 1YPLH 3A83A 3NZIA 1FY8E 4OS4A 4AGJA 1GJ4H 3GCTF 5FXLA 3A89A 1GBIA 1ZMLA 1GQ5A 4YYXA 5A2MH 2UWOA 1AD8H 1FAKH 2AWUA 1C2GA 1GJDB 3I1EA 1TGNA 4I32A 3NPSA 3F9EA 3R0HA 5T6FA 2TGTA 1DPOA 3E0PB 1NFWA 1RRKA 1EPTB 4IS5A 1MTVA 3A7VA 3BG4B 1HNEE 2O8MA 1Y3XA 5E0JA 5G1EA 1V2JT 5GCHG 4GPGA 2P8OB 1UEQA 5GJ4B 4MNXA 3RXQA 1Q3OA 1GL0E 3M7UA 1O3DA 2PW8H 3HVQC 2FNEA 4X8UH 2FLRH 2YNAA 1DANH 1Z8GA 4YTAA 4ZKSU 2NWNA 3BIUH 3FANA 3KL6A 3M7QA 1YPKH 4Q7ZA 1MTSA 4JOJA 2Y80A 1I16A 3SUZA 2Y82A 5HM2A 2RDLA 3A88A 3HGPA 1GCDA 3S7HB 2FS9A 2CS5A 1EX3A 1C2DA 3SU5A 2REYA 4FUBA 5GNDA 3ZVAA 7LPRA 4K1TA 1GL1A 1EPTC 2FZZA 3M7TA 1EJNA 8GCHF 2CGAA 1HUTH 4Y6DA 3BG4C 5A0BA 2AWXA 4MNYA 2PTCE 3TH2H 1N8OB 2XNIA 2AGGX 1DWBH 1CA8B 1P05A 1UVSH 2P8OC 2SGAA 3BTWE 1ESAA 1I92A 3K6YA 2P59A 1C1PA 3SV2H 3QLPH 1OWIA 3RXPA 1X5RA 1XM1A 1C1NA 3TITA 1V62A 1AE5A 2ZPSA 4FUHA 2GDEH 2PWXA 3MOCA 3HKJB 1BBRE 1YLCA 2SNWA 3OX7U 1DICA 2Q1JA 2BB4A 2BD4A 4BTTB 3GY2A 3M5LA 1F0SA 1QTFA 1C2MA 3PMAB 3B76A 3NUMA 3PMJA 4B2CA 2C4FH 1AU8A 1DSUA 2GP9B 3U1IB 4JOFA 2ZGBH 5C1XA 1W0ZU 5DTHA 5JBCS 3TPIZ 4OGXA 5A2PA 1VGCB 1B8QA 1O35A 1GHWH 1S82A 1ETRH 1L1JA 3P70B 2C93B 5H4IB 1GHAF 2GT8A 1GHBF 1N8OC 2QYIA 8KME2 1IQLA 1CT2E 4DW2U 1ZPZA 5F8TA 3QO6A 2OQSA 2KJDA 1HJ9A 2ZEBA 2SGFE 1H8IH 1QL8A 3ZV9A 2JREA 1FN6A 4IN2A 3DT0H 4IMZA 3U8RH 4BTIB 5EPNA 1VITH 1UVTH 3TJOA 5HM9A 1BHXB 3NFKA 4ZROA 1OWJA 3Q00A 5JPMH 2STAE 2PR3A 1WHAA 4Q2KA 3SO3A 2FLBH 3A7WA 4NXQA 1OPHB 1FY5A 1X6DA 3BIVH 1G9IE 1O2MA 1QR3E 2FEQH 1Y5AT 1O3OA 1SR5C 4WH8A 1VGCC 2DUCA 5DP3A 4XOJA 2AGEX 1Z8RA 5AHGH 4AFUA 1H9IE 1B0EA 2VH0A 3D62A 3T2NA 1WI4A 1OBYA 2PSYA 3VQFA 1QLCA 1DDJA 3SUFA 1YC0A 1OWDA 2BM2A 3H7OA 1FPHH 1AKSB 1AY6H 1G3DA 1EAWA 3N7OA 3RL8A 4UONA 1FCFA 4GVDA 5HEDA 3KNXA 3BPUA 8ESTE 3LJOA 3MH6A 2BQWB 1UEPA 4P0CA 3ODFA 1TNHA 2MX6A 2WPIS 1IQGA 1V5LA 1MTNB 4JOEA 4NSYA 2KAWA 3TGJE 1IAUA 1QJ1B 1O2HA 4NZQA 1NFYA 3K2UA 3QE1A 4NIWA 2WUBA 4YT6H 4UDWH 3TIUA 1GI2A 3VFEA 1HAIH 2Y5HA 3TH4H 1ELVA 4JZ1A 1GMHG 2BY7X 1GBDA 5DP9A 1CHGA 4NSVA 2M0TA 1SGDE 2A5AA 3WKMA 1YCPK 1BE9A 2Q6DA 1O5AB 5H3JA 2AH4X 2BQ7B 1GHZA 2B9LA 2BLVA 3MU4A 1A1RA 1A2CH 2YUBA 3M35A 4WJG2 3QK1A 1NROH 2QT5A 1TX8A 1HFDA 1EZQA 3EA8A 1ZJKA 3M5MA 4OS2A 1W14U 4I8HA 1MTNC 3A84A 2VWRA 1XUGA 3SU3A 4NMOA 2ZDVH 2NU2E 1ZGIA 4A1XA 2KPKA 4K69A 4E3BA 1ZOKA 4AFZA 2WUCA 1ZOMA 1FIZA 3F9FA 4YOGA 3GY4A 2D8IA 1J9CH 4MPXA 4JYVH 1ELEE 4KELA 1ZYOA 5CHAB 2D1JA 4ZKOU 2XC4A 2A7HA 4FXGH 2J94A 4X2WA 1BZXE 2VIWA 3ZVGA 3HK6B 3PTNA 1RIWB 4K6YA 3HKIB 2ZGXH 3LC3A 3O8BA 2WYJA 1KLTA 1UK2A 1TABE 3BTFE 1FIWA 2F83A 1O2PA 2VGCB 4KGAA 4X2XA 1QHRB 3PM3A 4LZ1H 2LUIA 1F5RA 1N6XA 1G3BA 1XVMA 3LIWA 4YDPA 1TBQH 2OSGA 1N7TA 4D76A 1WV7H 3KGPA 2SGQE 1OP2A 4ZUHA 1C4U2 3R3GB 2H9HA 1TQ7B 1O2JA 2B7DH 3A8AA 1O5EH 4H11A 3I18A 5E21A 1A0JA 2ZFSA 1PJPA 1BTUA 2G81E 5CHAC 1HRTH 3I4WA 1MCVA 1O5DH 1HPGA 3KF2A 4WWYA 1HIAA 4AMHA 4X2VA 5F67A 3ATKA 3SGQE 1RIWC 3GY3A 6LPRA 2BY5X 2G51A 2ZG0H 1BA8B 1KXCA 2WPKS 3PO1B 2I6VA 1L6OA 2V90A 1GJ9B 1MKXK 2OINA 1DWEH 1HIAB 1UHBB 2VGCC 4UU6A 2ZFRH 3RXKA 3NGHA 1O5FH 2BY9X 3QDOA 1RXPA 4ISNA 4WY3A 3E90B 3MO6A 2ZCHP 3QGNB 3BEFB 1D3PB 1YLDA 1YGCH 1YYY1 2OBOA 3SNAA 1Z86A 1WTHD 1W9OA 2I04A 2KPLA 1SGPE 2EGNA 3RDZA 5PTPA 1LPKB 1QRWA 5DG6A 2AMDA 1HAVB 1E37B 5F3XA 1DXWA 1ARBA 3TNTA 3UOUA 2VIDA 4X1PU 2VWOA 5T6DA 3KHVA 2XBYA 3LGYA 1AFEH 3LNXA 3GOVB 4F8KA 5HEYA 4TPYA 3NK8A 1TP3A 2FS8A 3GGEA 1OYQA 1PPHE 4DURA 1S6FA 2ZDNA 1UEWA 1TE0A 4ZXXH 1LVYA 2M0VA 1XUKA 4OS1A 1G37A 3TU7H 1MFGA 1UEZA 1FN8A 1OS8A 2YT7A 1ETTH 4U30A 3SU0A 3SJKA 1UJUA 3PV4A 1NF3C 3VB7A 3SFJA 1W9EA 3CC0A 1W0YH 2QF0A 2A7JA 4NG9H 4OEOA 4D9QA 1YKTA 2AIQA 4NMQA 2BTCE 1RTKA 1SI5H 3DFJA 1AN1E 1V2NT 3S0NA 1O2XA 1ESTA 1PPZA 1UTOA 2NU3E 2DE9A 2WINI 1MTUA 3I29A 3C1KA 2PZDA 1L1GA 4F49A 1Y5BT 2ESTE 1ZLRA 2A5KA 1SGCA 1O39A 2A32A 1GBCA 3BG8A 4FU7A 3UIRA 2EDVA 3AXAA 2WPLS 1GVKB 1P11E 3EQ0H 2DE8A 1GBTA 1D9IA 3GCTG 1HAZB 3PTBA 3T28A 1U39A 1ZZZA 2CXVA 2I0IA 4X6OA 1DWDH 3ZRTA 3V12A 1BHXF 2XTTB 2LC7A 4X1QU 1TA2A 2ZGHA 2J95A 1WF8A 5F03A 4K75A 1TQ3A 3A87A 1NO9H 1QA0A 3RXDA 2KRGA 1D6RA 5T6GA 3O46A 1EP6A 2C8WB 4WF8A 3BTKE 1TGBA 4INKA 3GDUA 2PHBA 3CBXA 1BRBE 1EXFA 1WQVH 3RXRA 4X1RU 1QBNA 2VRFA 1GI0A 4TWYA 2L97A 1DVAH 4INHA 5E1YA 4ABHA 1GWAA 1PQ7A 3Q77A 4OS7A 3OU0A 1TPSA 2XRCA 5E2OA 2DM8A 4NGAH 1GJ5H 1KTTB 2BD9A 5EXNA 3UPEA 4ZMAH 5DP7A 2ENOA 2PGBB 1ZGVA 1O2ZA 3VB3A 2Z9GA 1QQUA 2IPHA 1SPJA 1QB6A 3MI4A 1WF7A 1G36A 1SSXA 5A09A 2M10A 3QTVH 3PV2A 4LXBH 1CO7E 3SV7A 3G01A 1BJUA 1V2TT 1KY9A 3RMMH 2EAQA 1MZDA 1W8BH 1F0TA 2H9EH 4XBBA 3GICB 2P3FH 3U8OH 3UOPA 1EAXA 4I8GA 2V6NA 4Q6SA 4JMYA 1ANEA 1J15A 4K76A 1O5GH 4JYUH 1ZMJA 1TNKA 2FO9A 2KG2A 1MAYA 1JOUB 3A85A 2J4IA 4TPIZ 1P2IA 1IQEA 1QY6A 1SGFA 5EGMA 1MTWA 3ITIA 1UTPA 1OP0A 1NN6A 1OBZA 1C5PA 4NIVA 1XMNB 2BXUH 1GHAG 1TGCA 2OZFA 1GHBG 1SB1H 3A7TA 2BHGA 1MKXH 1LKAA 3M36A 1GCTB 4Y10E 3SNBA 4CRDA 4DT7B 1RJXB 5HF4A 1HCGA 2O9QA 3TMHA 3SHWA 3DFLA 2GV6A 4CR5A 5TJXA 5HFCA 1GI5A 3PMHB 4HFPB 1O5BB 3TH3H 1D4PB 1X7AC 3O8DA 3MH4A 4CRGA 2XBWA 1GQ4A 1A0LA 2HGTH 4UU5A 1MFLA 2KBSA 1K1LA 1ID5H 1Y59T 2IJOB 1TP5A 3RXCA 3KIDU 1DX5M 4WMDA 2ZHFH 2OCSA 4MPWA 1WQSA 4UFDH 1EKBB 1SGFG 6GCHF 1YBOA 2A5IA 2DLSA 1ANBA 3LGWA 1PPFE 1GCTC 3BSQA 1KXBA 1A4WH 4YZUA 3SGBE 4ZHAA 5LPEA 1J8AA 4JOHA 2DC2A 5HDYA 3AW1A 4FUCA 3TJVA 5ESTE 4XHVA 1GBEA 1MAXA 1DOJA 1X8SA 1LHCH 1W3CA 1WG6A 2I6SA 1K1NA 3R69A 3T29A 3RUOA 1XKAC 1LO6A 1QB1A 4MTBA 2EEJA 2LA8A 4K8YA 2KJPA 2TGDA 1UFXA 1SC8U 2C8YB 4D7FA 2Q3GA 1TMBH 4BANB 2FMJA 2VSVA 1O31A 3PB1E 2FX6A 2OS6A 2FCFA 2SGEE 2JINA 1NY22 4FUJA 2XCFA 4MLFB 1ZPCA 1VCWA 1Y5UT 1S0QA 3VB6A 4NMRA 1QRZA 1LQDB 1FC6A 1DE7H 3DHKH 4OS6A 1GI3A 1K32A 4ZHLU 5FPSA 1TYNA 3SUGA 1IQNA 3SQHE 4K72A 1NZQH 3GY5A 3RU4E 1N1LA 5HYOA 2BQ6B 1V2LT 4DY7B 1RY4A 2EXGA 2AIPA 2J9NA 4R2ZA 7GCHF 5CE1A 2ZKSA 5DO4H 1P8VC 3A7XA 3EYDA 1P0SH 1P04A 1A5GH 3KQEA 2ZU3A 4TYDA 3EGKH 1CBWB 4O06A 4NIXA 5GWZA 1JRSA 1P2JA 4NMSA 1SLWB 2BXTH 4QT8C 1EOLA 1TMTH 2C8XB 4CHAB 3ZZ7A 1HXEH 1KEFA 2ZDLA 4WXIA 2UUFB 4IN1A 1O2NA 1P2MA 2FXRA 5FBIA 4B76A 4Q2QA 1QFKH 1V2UT 3IWMA 4HGCA 3STIA 1Y3UA 2OC0A 1AIXH 1H1BA 2KQFA 3E1XB 1EZXC 1P2OA 3V0XA 3V3MA 3ZYDA 1UHPA 4I8LA 1X5QA 1AZ8A 2FOBA 2HE2A 1C5LH 3EA9A 3SJIA 1HYLA 2V0BA 2YTWA 1ELTA 2OBQA 3UWIA 1ZTJA 3B8JA 3RXOA 1FAXA 2HWLB 2XW9A 3LJJA 1G3CA 1EPTA 3E91A 1FMGA 3MU0A 4M7GA 2KOJA 5E8EH 1DM4B 3K6ZA 4MQAA 1CBWC 4NWLA 5TCAA 1WI2A 2BZ6H 1DS2E 2UUYA 2VU8E 2XC5A 3BTQE 5EQQA 4E34A 1GBKA 1HXFH 3AASA 1LVOA 4CHAC 1FY3A 2B0FA 1A5IA 1MQ6A 2YNBA 5GIBA 2F3CE 1AUJA 2P94A 1SLUB 2TGAA 1G30B 3P8OA 4O3TA 1GPZA 1NESE 3ZVEA 2G2LA 3F9GA 5HFFA 2XBVA 3BTTE 1SMFE 3UQVA 5FCKA 3V7TA 2AERH 1ETSH 1X45A 1WCZA 3E0NB 3MMGA 3O5NA 3DIWA 1F0RA 2I6QA 1E38B 1QJ6B 2EEHA 3PDVA 5C5NA 3Q3YA 1QB9A 2ZCLP 1BDAA 1TRNA 4Y7BA 4DJZB 1GBJA 1TBRH 4IBLH 2J2UA 2PV9B 2QKVA 2ZHWH 4O3UA 4REYA 3EDXB 2TBSA 1QL9A 4E35A 2O2TA 4VGCB 5FAHA 4ABBA 2FODA 2RCEA 1F7ZA 4K1EA 2KV8A 2OC8A 3TJUA 1UK3A 1CHOF 5BPEA 2BD3A 4Y8ZA 1KXEA
chains in the Genus database with same CATH superfamily
1VCQA 4HZHA 3U98H 1DWCH 2ZU2A 3A82A 2D26C 1GJBB 1IHSH 1O38A 2G5VA 1MD7A 1FQ3A 3SOSA 2F9BH 1UCYH 2WV5A 1K28D 2P16A 2VH6A 1FX0B 2ZQ1A 2VVUA 5HXFA 1TNIA 4MDSA 2A1DB 4D9RA 2B5TB 3S9CA 1C5NH 4Y11E 5C67A 2PKAB 3T27A 2GMTB 1GVLA 2V3HH 3V13A 3O8RA 2IWQA 1BFEA 3F0PA 1H9LB 3RXIA 4B6FA 2W5EA 1T7CA 2ZWLH 4YT7H 1HV7A 2QIQA 1KTSB 1SGRE 4VGCC 1O3BA 2EEIA 4Y0YE 5DSFA 1NRSH 1O3HA 1V3XA 1GMDG 1Z8IB 2ALPA 4BXSA 2JH6D 5E2PA 1GGDB 1K1OA 1P9SA 2EDPA 4AORA 2Y81A 4B71A 2H5DA 4E7NA 1N6DA 5FX6A 1ZPBA 4NXPA 3W1EA 3RXAA 1QURH 4ISOA 1HBTH 2WPJS 2GV7A 1O2IA 3ATMA 4AFQA 2F9PA 1O34A 5CMXH 2PSXA 4FUDA 5CHBA 5JDUB 4TY6A 1V1TA 2PTNA 2GMTC 1TONA 2H5CA 3SNEA 1AWHB 5E0GA 1QRXA 1ZSLA 3ZVFA 2Z6BD 1O3FA 2LPRA 3F1SB 1NRRH 4JZDH 4GVCA 1RTLA 4J1YA 4Q7YA 1BMLA 1G2MA 2FWWA 2G4TA 1AKSA 1P1DA 1XZ9A 3ZZ6A 2RDEA 3KZDA 1YCPM 2VNTA 1GGDC 2QXGA 2OXSA 1UJDA 1N99A 1RTFB 1SGTA 5GDSH 1K1MA 1DUAA 4ABGA 1FV9A 4IC6A 4A5TS 1TRMA 4AN7A 1NTPA 5C0TA 2O8LA 3R68A 2G55A 2AYWA 4BXWA 1WTGH 1QNJA 1A61H 3GY7A 3KYGA 2BVRH 1BTXA 2GZ8A 2R2MB 3SJ8A 3UTUH 5EG4A 1GDQA 2W6ID 3SU1A 5C2ZA 1RGWA 2ZI2H 1BQYA 5DKMA 5JB9S 1SLXB 4BNRA 1RGRA 3SORA 3HPTB 2OTVA 2VPHA 1NRQH 1WUNH 2Z3DA 3C27B 3ZZ3A 2V1WA 3E3TA 5EXLA 1TPPA 1Z6JH 3P17H 2EV8A 1C4Y2 4WVPE 1O2RA 2NU1E 3LGUA 1Q2WA 1EOJA 1XX9A 2KAIA 4RI0A 1O36A 2WPDD 3RXEA 3SQEE 1PYTC 3UFAA 4ESTE 2Q6GA 4MG3A 1K1PA 4FOUC 1AGJA 2BVSH 2A4RA 2P3TB 1D6WA 1FUJA 1YBWA 4LZ4B 3PLBA 3A7YA 1W11U 5GPIB 2KAIB 1SBWA 1C5VA 2XCNA 3DJ3A 4U32A 4RKOB 3ZYEA 3PS4A 2AMQA 3B23B 3UY9A 3TSZA 3D65E 1O3MA 5EQRA 2QC2A 4HOPB 4F4OC 1MMJN 1S83A 1O3PB 3BV9B 1H8HD 5I25A 4G69A 4ZCNA 2ZU5A 1WOFA 2Y6TA 3MFJA 2EEKA 1DSTA 2H2BA 2H2CA 2L4SA 1C2KA 3HK3B 1DUEA 1LPZB 1T32A 3PLPA 1U38A 3AW0A 2QF3A 1LVMA 4UE7H 2QCYA 1QCPA 3FZDA 3ATWA 2ZDKA 3FAOA 1NFXA 1N6EA 5C17A 2F9OA 4JYTA 3S69A 3U28C 1THSH 1WHDA 1RD3B 3FN8A 5IYTA 4Y76A 3LGVA 3S9AA 1W12U 2FOMB 1ELGA 4IGDA 4JOPA 1ZRKA 3RLYH 1MKWH 2C3SA 4YLUA 4ASUD 1TBZH 2CF8H 3W95A 3CP7A 4MPAA 2M5TA 3A8DA 1QAVA 2PLXA 4XDEA 1P2KA 1G3EA 5JXBA 1VJ9U 3BTHE 4Y8XA 3KN2A 3SJ9A 3ZVBA 1JMOH 1KLIH 5EW2H 1C1VH 1GI1A 1C4V2 4FU8A 4YXWD 2VWMA 5A8XA 3DJ1A 1NT1A 1QAVB 5HFDA 1C5XB 1UHBA 1SGIB 6GCHG 5I46H 1HAOH 2KA9A 3GABA 3VQGA 1S85A 2XWBI 1AVWA 1BMAA 1Y3VA 1QBOA 5JB8S 2QKTA 3VXEH 2KX4A 5EZ0A 1BRUP 2H2ZA 3UNQA 1FLEE 5AFZH 3RU4D 1BMNH 1GHYH 1KSNA 2DMZA 1AUTC 1JBUH 1BTHH 3VEQB 3UUZA 2VINA 1THPB 2DKRA 4NIYA 2JH0D 3SHUA 1IU2A 2LELA 3TSWA 2QKUA 3RMNH 2HLCA 1V2OT 4BAOB 3MWIU 1HAVA 1DLEA 2X7ZA 3CYYA 4PQWA 1O3KA 4NNMA 1B5GH 1BT7A 3WKLA 1V2VT 5L30H 5FCRA 5HFBA 2BD5A 1ELFA 2HPPH 1CGIE 4Y79A 4WH6A 1Y3WA 5TCCA 1JWTA 1L4DA 3SUEA 1U3BA 3NFLA 1KDQB 1WJLA 2ZQ2A 1T8LA 1S5SA 4MNWA 1D5GA 2SFAA 1KLJH 2EI8A 1KXDA 3T26A 2ILNA 1TOMH 4P00A 1TNJA 3BTME 5CDFE 4R8TB 2BY6X 2BLQA 2LOBA 4GAWA 1O3IA 4HG6A 1V2RT 3ZZ8A 5A8YA 1D3DB 1T4UH 3L3TA 4JL7A 2EJYA 4Q2PA 2AMPA 5L2ZH 1UTMA 2Z9IA 1A7SA 1GMDF 2BMGB 5C20A 7GCHG 3MQKC 1BMFD 2DLUA 1BTPA 4HTCH 2QGRA 1TPAE 1KMHB 4DIIH 1MU8B 1J17T 9LPRA 1BCUH 1P06A 4OS5A 2TIOA 3KQ5A 5JBBS 5LPFA 5HJ1A 2FOHA 1TOCB 1P03A 2GZ9A 2F91A 2QXIA 3P8GA 4FUGA 1N6YA 4RN6A 3DJAA 5HIZA 2Y7ZA 4IMQA 3UQOA 2GDDA 1LHEH 2V3OH 2R2WU 2QXHA 1GBLA 4R0IA 3DA9B 2EEGA 4K2YA 2GTBA 1FXYA 3RLWH 2JILA 2R0LA 2CN0H 2ODQA 5EYZA 1Q7XA 1C2FA 1NBME 1UJVA 3RXHA 3SN8A 2TGPZ 3ZZAA 3M5NA 2BDBA 4U01A 3RP2A 4BTUB 1IHTH 2STBE 3LDXH 3OSYA 1T8NA 5EQSA 3SUDA 1GDNA 1TFXA 1TQ0B 5BRRE 3TGKE 4KFVA 1A5HA 1LHGH 1PYTD 2ZHQH 2VVVA 1ZRBA 3HPKA 2G52A 2XXLA 1ANDA 4E7RG 2B8OH 1FC9A 3BF6H 4J2YB 4AC9A 3K50A 1TLDA 2JKHA 2R4HA 1SL3A 2FESH 3A81A 3LONA 3D23A 4LMMA 1O0DH 5A8ZA 2JH5D 1BUIA 4XFQA 4Z0KA 1EJMA 1ZHMA 1T8MA 2BD7A 1S81A 3LU9B 5B6OA 2ULLA 2XYAA 1JIMA 1NRNH 1K2I1 5DGJA 3UREA 4NWKA 3KDGA 1NM6A 3ID3A 5LPRA 1O2LA 2BX3A 3UR6A 2Z9LA 1O2GH 3BTGE 3SZNA 1FY1A 2KOMA 1Z1JA 3B9FH 2GCHG 1O3AA 4X8TH 4H6TA 1GI6A 2GKVE 1N6FA 1R6JA 1YPMH 1O30A 1BIOA 4YM9A 4AYYB 1OZIA 2ODYB 3LKWA 2FI5E 1CHOG 1ZSJA 1L4ZA 1PPCE 2ZGCA 3M3TA 3SW2B 3ZZBA 2RA3A 1YPHC 3ZZCA 2SGDE 4BOHA 1AMHA 1O3JA 4JK5A 1GBHA 2FTLE 1Z8JB 4INLA 3SV8A 4XD7D 1LHDH 3BEUA 3PWCA 3PRBA 3TJNA 3UWJH 3BTEE 1CGHA 1KWAA 5C94A 1MH0A 3AAUA 4P02A 2F9VA 2GVFA 4CRBA 4XBDA 4Y71A 1BTWA 1L1NA 1GJ7B 3HPMA 1X9ZA 4GHTA 2VWNA 3GYLB 3N99A 1HDTH 1RFNA 1O33A 3UNRA 1C5UA 1E36B 1GBBA 3RM0H 4U2WA 2HVYB 2EA3A 3SJOA 3GCOA 2VIQA 1TALA 1WH1A 2OUAA 3QN7A 1AZZA 1DFPA 5T1VA 1FONA 1ZSKA 2BDYA 3EA7A 1C5RA 1P2QA 3RXJA 1V5QA 2I0LA 4ABDA 4MPVA 1LVBA 1UCYK 3FY5A 2RRMA 1OX1A 1FC7A 1MC7A 2P3WA 1A3BH 2RG3A 4IC5A 1C1MA 2GZ7A 3MO3A 4GSOA 3URDA 1IQKA 1CSOE 3SI3H 4UFEH 2QN5T 2RCZA 2Z9KA 1GBFA 1UM7A 2QXJA 4Q4LA 4A92A 3QGJA 1M5ZA 2BYAX 5HGGA 4KTSA 1CGJE 3KDKA 1FJSA 1THRH 2H9TH 4NZLA 1L0ZA 4P2AB 3TNSA 4CREA 3M5OA 1MD8A 4ABAA 1DY8A 5AF9H 1A0HB 3MO9A 1T2MA 2L4TA 3RXVA 3M37A 3SHAH 3T5FH 2AEIH 2Z7FE 1EQ9A 2SNVA 5HETA 4YESB 5GXPA 1IQHA 1VCPA 3I77A 1O2YA 3KYFA 1C2LA 1YLNA 3RL7A 2HGAA 2ZDAH 4ZAEA 4GHNA 1RS0A 9ESTA 5C1YA 3S7KB 2IWNA 1O2KA 3NKKA 3F2HA 2ZFFH 7ESTE 1C1UH 1TB6H 3P92A 4FUIA 4AG2A 4DGJA 1MQ5A 1JIRA 1V6DA 1CE5A 5J4QA 2GT7A 2UWLA 4WYTA 4DCDA 2FOGA 2O8TA 1ABJH 3LH3A 4X1SU 1PPBH 1K21H 5DP4A 1EASA 4KFWA 1P3CA 2PP6A 2FX4A 4X1NU 3ZVDA 4OM9A 1UM1A 1Z71A 1J14A 3CENA 1S84A 3AAVA 2A31A 4FVDA 1ELCA 4JZEH 3S9BA 1BRAA 1HAYB 3FO8D 2OLGA 1DLKB 4CH2B 5DP5A 3NCVA 1ZUBA 1XUIA 2BLOA 3MTYA 1ZTKA 5DP6A 5I7ZA 1P12E 1KIGH 1VAEA 3DD2H 4EDJA 2PFEA 3LH1A 1GVZA 2KFWA 4NXRA 3HGNA 5C3NA 1DXPA 1X5NA 3GDSA 1SGNE 2KM0A 3CBZA 4MNVA 2H3LA 5G1DA 1K0HA 1HGTH 1VITF 3SOEA 1QBVH 2ZFTA 4CR9A 2XBXA 3H09A 5G4BA 3H7TA 1BBRH 1Q31A 2XC0A 4Z8JA 2JWEA 4Q6HA 1DITH 3RXTA 1B7XB 1UVUH 4CBNA 1Y7NA 4I8KA 2GGVB 3QDZB 2ZDMA 3A8CA 2AWWA 2J98A 1GHVH 3UNSA 4ABEA 1AB9B 3JXTA 4NA7A 2P3UB 2BVXH 4CRFA 2SGPE 1F2SE 1MBMA 2FI4E 2ANWA 1W13U 4TSFD 2FOAA 4A7IB 2HNTE 2J38A 5SGAE 4O9VA 2ZPMA 2K8IA 4B1TA 4K3JA 4UD9H 5J4SA 1C2EA 1GI8B 2AS9A 1YPGH 3SU2A 1W7GH 2FTMA 1ZJDA 1O2WA 3MYWA 4WYUA 4NA8A 1ESBA 4NFEA 4MVNA 5F53A 5KECA 4DG4A 1T31A 3QWCH 2QF5A 1XUJA 1W2KH 3F0OA 2KL1A 4B74A 1GI4A 4ABJA 2ZU1A 1KXFA 4ISIH 1HAHH 2D92A 5T3HA 3LT3A 4FLNA 1V6BA 4CH8B 1UJ1A 1AB9C 4X8VH 1K1IA 3QX5H 4UEHH 5C1UA 4FETA 4O97A 2GCHF 4XE4A 1SG8B 2BDAA 3PRDA 1VJ6A 2MHOA 4NA9H 2JJ2D 1HAPH 4DIHH 1SQOA 2A45B 2ZA5A 3QJNA 3GCNA 1MKWK 2VJ1A 3VGCB 2WYGA 2R3UA 3QGLA 4WMFA 3LOXA 1YF4A 2FPZA 3CNRA 1OWKA 2PKAA 3ID4A 2W7SA 2EHRA 2IWPA 1O2UA 1O5CB 4JZFH 2PUQH 2RA0A 3KZEA 2QG1A 4Q3HA 2BOHB 2QE7D 1C5TA 2KR7A 5EOKA 1W9QA 1V2QT 4BAKB 3ELAH 4YOJA 5FPTA 5DK1A 1F5LA 1IQMA 5EJLA 3NCLA 4B2AA 2ZGJA 5L2YH 5K7RA 1C9TA 5F8ZA 1COWD 1O2QA 5EXMA 1NBMD 4OGYA 2OPGA 3VB5A 1DY9A 1GJAB 3DORA 2VIOA 3VGCC 3CS7A 1LMWB 2FOCA 3WY8A 5JYIA 1LHFH 1W0KD 3MH7A 2ZCKP 5DP8A 5JBAS 1Z87A 4GCHF 1ORFA 2KCPA 1ARCA 4FUFA 1V2KT 1P2NA 2F9NA 8LPRA 5EU8A 3RXGA 2WSSD 1N7EA 3SU4A 2ZO3H 2W7RA 1WFVA 3H5CB 2PNTA 1IU0A 1C5SA 2J34A 3BEIB 1O2SA 3KQCA 2LNCA 2PGQB 1EAUA 5B6LA 2BDIA 1OOKB 4GLYA 2LP6A 4A1VA 4ABIA 2OQUA 1BTZA 3IITA 2W26A 3KCGH 1B0FA 2P95A 3PWBA 1AFQB 1HAGE 2AGIX 3M3VA 4AYVB 1ELDE 4I7YH 1O3GA 2GJGA 3TK6A 1QJ7B 2A4GA 2QF4A 1PPEE 1TX6A 2JSNA 1VR1H 3ZVCA 4B2BA 2A4OA 2KOHA 3RXLA 3JZ1B 6CHAB 1T8OA 1C2HA 2PA1A 3SGAE 2VWLA 2A2XH 1VB7A 1XKBC 3WWBA 3MU8A 2ZFQH 4JK6A 2HNTC 2UUKB 1KYNA 4CRCA 1FZZA 1FDPA 4B75A 3QIKA 1XUFA 1IHJA 1S0RA 3KEEA 4RT1A 4NNLA 1JRTA 1SLVB 4KTCA 1BTYA 2I4SA 4TY7A 3E8LA 3U8TH 1M9UA 5FL7D 1ZR0A 2A0QB 1V2WT 4JZIA 1PFXC 1Q3XA 1AFQC 2ZTXA 2BD8A 2ZPLA 1NU7B 5L6NH 3A86A 1E35B 2F9UA 3OTPA 1TGSZ 3IG6B 2BYGA 3LNYA 4YLQH 1GI9B 6CHAC 4Q2NA 2QY0B 1UCYE 2YT8A 5GLJA 1G2LA 5EPYA 2JOAA 4JORA 1EB2A 1P10A 2EDZA 1UTKA 2OMJA 4LK4A 3CS0A 1HJ8A 5DPAA 1IQIA 1SOZA 1WYKA 4HOPA 3WWFA 4KP0A 2QV1A 3Q3XA 1GHXH 2ZC9H 3EE7A 5HMAA 4X8SH 2J92A 2BD2A 1P01A 2JXOA 2KJKA 1GI7B 1F5KU 2K20A 2XWAA 1C1QA 2HRVA 1P02A 1XVOA 1U37A 2FN5A 3MNSA 2PKTA 1TGTA 3Q76A 3FZZA 1HLTH 1C5WB 2CSSA 4CBOA 2FI3E 3UB0A 3PV5A 1VJAU 1WU1A 1PQ8A 2ASUB 2QA9E 3L6PA 1ZMNA 2IN2A 1UF1A 4JCNA 3ESTA 1H9HE 2WPMS 4YOIA 1MBQA 2ZIQH 1C1RA 2Z17A 1EP5A 1MZAA 2Y7XA 3K9XB 4DOQA 1XXFA 2W4FA 2OK5A 5HFEA 1S6HA 4BAQB 1SGQE 1WSSH 5AVDA 1Z1IA 2H3MA 4X6NA 1WAYB 2DB5A 2GEFA 2W6JD 1GBMA 5IL9A 3K65B 2PDZA 1UO6A 2EGKA 4FVBA 2JJ1D 1Z7KA 1FI8A 1LPGB 1LCYA 3O8CA 1INCA 1C2JA 4E06H 3STJA 3M61U 1IQFA 2FIRH 2TRMA 4Y7AA 2W3KA 4H42U 2ANKH 3MU5A 5EJ1A 2OQ5A 2AHME 1CA0B 2FOEA 4AFSA 4X0WU 1CU1A 1ZHRA 2FDAA 3TVJB 3GS9A 3RXMA 2UZCA 1LDTT 2P93A 1OXGA 3VXFH 3LPRA 4Z33A 3QJMA 4X6PA 3L33A 5EW1H 2IPQX 2L74A 3A80A 5FX5A 5GCHF 2J97A 1BB0B 1UVPA 1ZHPA 4SGBE 1XXDA 1YPJH 1HAXB 3U1JB 1NRPH 1VZQH 1G9OA 2ZTZA 2XNDD 3QTOH 2NU4E 1GMCG 1IOEA 1FY4A 5D13A 1NPMA 3E16B 1YPHE 3BN9A 4WMEA 2A4QA 1KDQA 3SBKA 1RZXA 3P6ZB 3MHWU 4GHQA 1CT0E 1GG6B 2Z3EA 5E22A 1CA0C 2VIVA 3LC5A 1O2OA 3ATIA 4DVAU 2BDCA 2BDGA 3ZZ4A 3D49H 1UK4A 2G4UA 2ZZUH 1GDUA 1W0JD 3GY6A 2FYRA 1QIXB 2OP9A 1O2VA 1NS3A 3CBYA 1SOTA 1U6QA 2LC6A 2KYLA 2FP7B 2ODPA 4K5ZA 2FOFA 4PROA 3UAIC 4OEPA 1TWXB 4L8NA 1H8DH 4ABFA 1OBXA 4Y0ZE 1VA8A 1V2ST 2Z9JA 2KCYA 1PQAA 1C2IA 3FP6E 2ALVA 2VSPA 5FBEA 2AFQB 4KKDA 1FNIA 1SFQB 3HATH 2YMSB 5C0UA 2OD3B 3T62A 2ZP0H 3SNCA 1MUEB 2BDHA 4JOGA 3F2GA 1BITA 3OFND 1NFUA 3W94A 1GG6C 4JJ3A 2I1NA 1A3EH 2PKSB 3PO1C 4AGKA 1PPGE 1C1OA 1AVGH 1GJ6A 4THNH 1XUHA 1H4WA 1UTLM 1EAIA 4I8JA 1MCTA 2M0UA 2OC7A 1TIOA 4H4FA 1VITG 3PYHA 4NMPA 4GUXA 3GJ9A 3RXFA 3ID2A 3U9AH 1BJVA 5ILBA 5DN6D 2HALA 3PROA 3K1RA 3GDVA 5DJ7A 1HJAB 5ESBA 2ZTYA 1C1TA 2WPHS 5E6PB 2O8WA 1OWHA 1TX7A 1GJCB 5LGOA 2CV3A 2HVXA 1C5YB 1ANCA 1C5OH 2YMSC 1MU6B 2PKUA 1L2EA 2HOBA 4HI3A 1LQEA 3SI4H 4NMTA 2HNTF 3P8FA 2Q9VA 1T4VH 3RMLH 1UMAH 2GCTB 3BTDE 1GJ8B 1AHTH 3RXUA 3L4FD 4X6MA 3F9HA 2PKSC 2VVCA 4I31A 4NCYA 1D3TB 5A0AE 1GM1A 4OAJA 1E0FD 2D2DA 4KTUA 1D3QB 5C5OA 2FE5A 2EI7A 1EJAA 3RXSA 3ID1A 2A7CA 4NFFA 2K1QA 2W7UA 2ZFPH 3TK9A 2C90B 4FU9A 2PUXB 3GCHB 1C9PA 2E7KA 1YCPH 4CRAA 3ODDA 5HKKD 1PDRA 1N7FA 1BBRK 1HJAC 2D8WA 2UWPA 3AVZA 1E1RD 1P9UA 2BLWA 5HF1A 1C5MD 1FPCH 1KXAA 1Q3PA 1Y8TA 2G8TA 3ZZ5A 5E11A 4AX9H 1K22H 2CJIA 2VBCA 3U69H 1H8ED 2GCTC 3MNXA 4RT0A 1ELBA 2ZF0H 1YM0A 3EGGC 1J16A 1NC6A 4ZH8A 2EGOA 1WBGB 2FM2A 4Z1MD 2BX4A 2H6MA 2IWOA 2Q6FA 4K78A 1ABIH 1F0UA 7KMEH 2ZECA 4SGAE 2CSJA 1SGYE 3ATLA 2G5NA 2OCVB 2TPIZ 2VIPA 3QUMP 2HE4A 4X2YA 2A2QH 2ZU4A 4JOKA 4NMVA 1GMHF 3GCHC 1AI8H 2YOLA 2EC9H 1O37A 3GYMA 1RGQA 3KQDA 4TWWA 3RXBA 5ABWA 1C1WH 1QQ4A 1OP8A 3VB4A 4F55A 1EUFA 8GCHG 3DUXH 3EAJA 1PQ5A 3OTJE 1AWFH 1EZSC 3T25A 3MNBA 3CH8A 2JETB 1TA6A 2WV4A 5FPYA 4AZ2B 2ANYA 2W3IA 2G00A 2Y5FA 4ASHA 1TAWA 2ZPRA 2YUYA 1K9OE 1AO5A 1ZTLA 2V35A 2BOKA 4H6SB 3OY6U 3LGTA 3R0FA 3DSPA 3ENSB 2OGPA 4XRNA 3TSVA 1P3EA 5IDKA 4AB9A 4A1TA 2M2AA 4GCHG 4Q80A 1WFGA 4Q2OA 3EE0B 4XSKU 5KEDA 3A7ZA 5EJZA 3OEHD 3MU1A 1BMMH 2EQNA 3PMBB 1QGFA 1O3EA 3M3SA 2O8UA 2DJTA 1HB0B 2CHAB 1W7XH 2M0ZA 1SHHB 3OYPA 1BRCE 2KCOA 2JETC 2Y5GA 2WL7A 3RU4T 4ISLA 1O3LA 2GD4B 2ZPQA 1BOQA 1UTNA 3URCA 4ZHMU 2CMYA 1S6LA 2R3YA 1TMUH 4ZKNU 5KGOA 3RLEA 1TNGA 3E17A 1QAUA 3KHFA 3P8NA 1AQ7A 2H1UA 2BY8X 3NWUA 4Y8YA 1SQTA 4ZXYH 3ZV9A 3SHCH 3SV9A 2F0AA 1SVPA 2C8ZB 4IW4E 4AG1A 3NXPA 4O03A 1UTQA 4RSPA 3SNDA 2ANMH 1O2TA 1G32B 1CT4E 3FP8E 1Y3YA 3FP7E 1C5QA 1O32A 3OY5U 3RMOH 3ZZDA 1LKBA 2BZAA 3TLOA 1SQAA 1V2PT 1GMCF 1O3CA 5F8XA 2CHAC 2AINA 2G5MB 4N6XA 2QBWA 1P57B 1SHYA 3RC6A 1EB1H 3SU6A 3ZV8A 3FFGA 4BAHB 4K1SA 4MPUA 4E05H 1TPOA 2QAAA 2NU0E 1TNLA 1AE8H 4YO9A 6ESTA 1K1JA 2F43B 2ZHEH 2R9PA 4FUEA 1SGEE 1CVWH 2CF9H 2Z94A 1OWEA 2UUJB 3RC4A 1OSSA 3F6UH 1F92A 4K8BA 4Q7XA 1EATA 5A0CA 3OAAD 3DSGA 4GVUA 1ELAA 2GZVA 3GISB 2M3MA 2DAZA 3K82A 2K1ZA 3RC5A 1TRYA 4BAMB 2YMSD 4LOYH 2JIZD 3ZZ9A 1OKXA 1GBAA 3EGHC 4FGMA 5EODA 1UITA 4B73A 3TK5A 2IOTA 4ZKRU 1UTJA 5JBTA 2VB0A 1W10U 2ZNKH 2THFB 3JZ2B 3LGIA 3F68H 1JXPA 1DT2A 5E0HA 5ETXA 2JIKA 2D90A 2VZ5A 3QZQA 1A46H 3UR9A 3A8BA 3MNCA 4WXVA 3TGIE 5K0HA 4AB8A 3Q3KA 4AOQA 4I33A 3MH5A 4Z6AH 5FHTA 3GSLA 2F5YA 3I78A 3KQBA 1E79D 2OC1A 1WIFA 1E1QD 5F6MA 5LH8A 4A6LA 2Z3CA 4XBCA 1LTOA 1C1SA 3GY8A 4K60A 4D8NA 3QZRA 1EZUC 1OHHD 2R0KA 4UFGH 1NU9A 3FVFB 1NTEA 1O3NA 1ACBE 4D7GA 1QA7A 3E6PH 1C5ZB 1UVOA 3PLKA 5FB8C 1Z6EA 2ZHDA 3VPKA 3RM2H 1OYTH 2EI6A 5HEBA 1AVXA 1YP9A 2HPQH 1VKYA 1CQQA 1E34B 4UFFH 5AFYH 3P95A 4ISHH 3SV6A 3PDZA 1YPEH 1QL7A 1V2MT 2FYQA 4RKJB 1P1EA 1IQJA 2GX4A 1P09A 1SFIA 1YPLH 2XOKD 3A83A 3NZIA 1FY8E 4OS4A 3N7EA 2KZ4A 4AGJA 1GJ4H 3GCTF 5FXLA 3A89A 1GBIA 1ZMLA 1GQ5A 4YYXA 5A2MH 2UWOA 5B42A 1AD8H 1FAKH 2AWUA 1C2GA 1GJDB 3I1EA 1TGNA 3F3BA 3NPSA 4I32A 2JDID 3F9EA 3R0HA 5T6FA 2TGTA 1DPOA 3E0PB 1NFWA 1RRKA 1EPTB 4IS5A 1MTVA 3A7VA 3BG4B 1HNEE 2O8MA 1SQRA 1Y3XA 5E0JA 5G1EA 1V2JT 5GCHG 4GPGA 2P8OB 1UEQA 5GJ4B 4MNXA 3RXQA 2WHXA 1Q3OA 3VG8A 1GL0E 3M7UA 1O3DA 2PW8H 3HVQC 2FNEA 4X8UH 2FLRH 2YNAA 1DANH 1Z8GA 4YTAA 4ZKSU 2NWNA 3BIUH 3FANA 3KL6A 3M7QA 1YPKH 4Q7ZA 1MTSA 4JOJA 2Y80A 1I16A 3SUZA 2Y82A 5HM2A 2RDLA 3A88A 3HGPA 1GCDA 3S7HB 2FS9A 2CS5A 1EX3A 1C2DA 3SU5A 2EY4C 2REYA 4FUBA 5GNDA 3ZVAA 7LPRA 4K1TA 1GL1A 1EPTC 2FZZA 3M7TA 1EJNA 8GCHF 2CGAA 1HUTH 4Y6DA 3BG4C 5A0BA 2AWXA 4MNYA 2PTCE 3TH2H 1N8OB 2XNIA 2AGGX 1DWBH 1CA8B 1P05A 1QZ8A 1UVSH 2P8OC 2SGAA 3BTWE 1ESAA 1I92A 2HLDD 3K6YA 2P59A 1C1PA 3SV2H 3QLPH 1OWIA 3RXPA 1X5RA 1XM1A 1C1NA 3TITA 1V62A 1AE5A 2ZPSA 4FUHA 2GDEH 2PWXA 3MOCA 3HKJB 1BBRE 1YLCA 2SNWA 3OX7U 1DICA 2Q1JA 2BB4A 2BD4A 4BTTB 3GY2A 3M5LA 1F0SA 1QTFA 1C2MA 3PMAB 3B76A 3NUMA 3PMJA 4B2CA 2C4FH 1AU8A 1DSUA 2GP9B 3U1IB 4JOFA 2ZGBH 5C1XA 1W0ZU 5DTHA 5JBCS 3TPIZ 4OGXA 5A2PA 1VGCB 1B8QA 1O35A 1GHWH 1S82A 1ETRH 1L1JA 3P70B 2C93B 5H4IB 1GHAF 2GT8A 1GHBF 1N8OC 2QYIA 8KME2 1IQLA 1CT2E 4DW2U 1ZPZA 5F8TA 3QO6A 2OQSA 2KJDA 1HJ9A 3AK5A 2ZEBA 2SGFE 1H8IH 1QL8A 1UW7A 2JREA 1FN6A 4IN2A 3DT0H 4IMZA 3U8RH 2K0QA 5EPNA 1VITH 4BTIB 1UVTH 3TJOA 5HM9A 1BHXB 3NFKA 4ZROA 1OWJA 3Q00A 5JPMH 2STAE 2PR3A 1WHAA 4Q2KA 3SO3A 2FLBH 3A7WA 4NXQA 1OPHB 1FY5A 2V7QD 1X6DA 3BIVH 1G9IE 1O2MA 1QR3E 2FEQH 1Y5AT 1O3OA 1SR5C 4WH8A 1VGCC 2DUCA 5DP3A 4XOJA 2AGEX 1Z8RA 5AHGH 4AFUA 1WXRA 1H9IE 1B0EA 2VH0A 3D62A 3T2NA 3NRLA 1WI4A 1OBYA 2PSYA 3VQFA 1QLCA 1DDJA 3SUFA 1YC0A 1OWDA 2BM2A 3H7OA 1FPHH 1AKSB 1AY6H 1G3DA 1EAWA 3N7OA 3RL8A 4UONA 1FCFA 4GVDA 5HEDA 3KNXA 3BPUA 8ESTE 3LJOA 3MH6A 2BQWB 1UEPA 4P0CA 3ODFA 1TNHA 2MX6A 2WPIS 1IQGA 1V5LA 1MTNB 4JOEA 4NSYA 2KAWA 3TGJE 1IAUA 1QJ1B 1O2HA 4NZQA 1NFYA 3K2UA 3QE1A 4NIWA 2WUBA 4YT6H 4UDWH 3TIUA 1GI2A 3VFEA 1HAIH 2Y5HA 3TH4H 1ELVA 4JZ1A 1GMHG 2BY7X 1GBDA 3FKSD 5DP9A 1CHGA 4NSVA 2M0TA 1SGDE 2A5AA 3WKMA 1YCPK 1BE9A 2Q6DA 1O5AB 5H3JA 2AH4X 2BQ7B 1GHZA 2B9LA 2BLVA 3MU4A 1A1RA 1A2CH 2YUBA 3M35A 4WJG2 3QK1A 1NROH 2QT5A 1TX8A 1HFDA 1EZQA 3EA8A 1ZJKA 3M5MA 4OS2A 1W14U 4I8HA 1MTNC 3A84A 2VWRA 5EIYA 1XUGA 3SU3A 4NMOA 2ZDVH 2NU2E 1ZGIA 4A1XA 2KPKA 4K69A 4E3BA 1ZOKA 4AFZA 2WUCA 1ZOMA 1FIZA 3F9FA 4YOGA 3GY4A 4DT4A 2D8IA 1J9CH 4MPXA 4JYVH 1ELEE 4KELA 1ZYOA 5CHAB 2D1JA 4ZKOU 2XC4A 2A7HA 4FXGH 2J94A 4X2WA 1BZXE 2VIWA 3ZVGA 3HK6B 3PTNA 1RIWB 4K6YA 3HKIB 2ZGXH 3LC3A 3O8BA 2WYJA 1KLTA 1UK2A 1TABE 3BTFE 1FIWA 2F83A 1O2PA 2VGCB 4KGAA 4X2XA 1QHRB 3PM3A 4LZ1H 2LUIA 1F5RA 1N6XA 1G3BA 1XVMA 3LIWA 4YDPA 1TBQH 2OSGA 1N7TA 4D76A 1WV7H 3KGPA 2SGQE 1OP2A 4ZUHA 1C4U2 3R3GB 2H9HA 1TQ7B 1O2JA 2B7DH 3A8AA 1O5EH 4H11A 3I18A 5E21A 1A0JA 2ZFSA 1PJPA 1BTUA 2G81E 5CHAC 1HRTH 3I4WA 1MCVA 1O5DH 1HPGA 3KF2A 4WWYA 1HIAA 3OEED 4AMHA 4X2VA 5F67A 3ATKA 3SGQE 1RIWC 3GY3A 6LPRA 2BY5X 2G51A 2ZG0H 1BA8B 1KXCA 2WPKS 3PO1B 2I6VA 1L6OA 2V90A 1GJ9B 1MKXK 2OINA 1DWEH 1HIAB 1UHBB 2VGCC 4UU6A 2ZFRH 3RXKA 3NGHA 1O5FH 2BY9X 3SYJA 3QDOA 1RXPA 4ISNA 4WY3A 3E90B 3MO6A 2ZCHP 3QGNB 3BEFB 1D3PB 1YLDA 1YGCH 1YYY1 2OBOA 3SNAA 1Z86A 1WTHD 1W9OA 2I04A 2KPLA 1SGPE 2EGNA 3RDZA 5PTPA 1LPKB 1QRWA 5DG6A 2AMDA 1HAVB 1E37B 5F3XA 1DXWA 1ARBA 3TNTA 3UOUA 2VIDA 4X1PU 2VWOA 4ACBA 5T6DA 3KHVA 2XBYA 3LGYA 1AFEH 3LNXA 3GOVB 4F8KA 5HEYA 4TPYA 3NK8A 1TP3A 1MABB 2FS8A 3GGEA 5HIYA 1OYQA 1PPHE 4DURA 1S6FA 2ZDNA 1UEWA 1TE0A 4ZXXH 1LVYA 2M0VA 1XUKA 4OS1A 1G37A 3TU7H 1MFGA 1UEZA 1FN8A 1OS8A 2YT7A 1ETTH 4U30A 3SU0A 3SJKA 1UJUA 3PV4A 1NF3C 3VB7A 3SFJA 1W9EA 3CC0A 1W0YH 2QF0A 2A7JA 4NG9H 4OEOA 4D9QA 1YKTA 2AIQA 4NMQA 3SZEA 2BTCE 2WV9A 3DCLA 1RTKA 1SI5H 3DFJA 1AN1E 1V2NT 3S0NA 1O2XA 1ESTA 1PPZA 1UTOA 2NU3E 2DE9A 2WINI 1MTUA 3I29A 3C1KA 2PZDA 1L1GA 4F49A 1Y5BT 2ESTE 1ZLRA 2A5KA 1SGCA 1O39A 2KCAA 2A32A 1GBCA 3BG8A 4FU7A 3UIRA 2EDVA 3AXAA 2WPLS 1GVKB 1P11E 3EQ0H 2DE8A 1GBTA 1D9IA 3GCTG 1HAZB 3PTBA 3T28A 1U39A 1ZZZA 2CXVA 2I0IA 4X6OA 1DWDH 3ZRTA 3V12A 1BHXF 2XTTB 2LC7A 4X1QU 1TA2A 2ZGHA 2J95A 1WF8A 5F03A 4K75A 1TQ3A 3A87A 1NO9H 1QA0A 3RXDA 2KRGA 1D6RA 5T6GA 3O46A 1EP6A 2C8WB 4WF8A 3BTKE 1TGBA 4INKA 3GDUA 2PHBA 3CBXA 1BRBE 1EXFA 1WQVH 3ZIAD 3RXRA 4X1RU 1QBNA 2VRFA 3OE7D 1GI0A 4TWYA 2L97A 1DVAH 4INHA 5E1YA 4ABHA 1GWAA 1PQ7A 3Q77A 4ACAA 4OS7A 3OU0A 1TPSA 2WZQA 2XRCA 5E2OA 2DM8A 4M9FA 4NGAH 1GJ5H 1KTTB 2BD9A 5EXNA 3UPEA 4ZMAH 5DP7A 2ENOA 2PGBB 1ZGVA 1O2ZA 3VB3A 2Z9GA 1QQUA 2IPHA 1SPJA 1QB6A 3MI4A 1WF7A 1G36A 1SSXA 5A09A 2M10A 3QTVH 3PV2A 4LXBH 1CO7E 3SV7A 3G01A 1BJUA 1V2TT 1KY9A 3RMMH 2EAQA 1MZDA 1W8BH 1F0TA 2H9EH 4XBBA 3GICB 2P3FH 3U8OH 3UOPA 1EAXA 4I8GA 2V6NA 4Q6SA 4JMYA 1ANEA 1J15A 4K76A 1O5GH 4JYUH 1ZMJA 1TNKA 2FO9A 2KG2A 1MAYA 1JOUB 3A85A 2J4IA 4TPIZ 1P2IA 1IQEA 1QY6A 1SGFA 5EGMA 1MTWA 3ITIA 1UTPA 1OP0A 1NN6A 1OBZA 1C5PA 4NIVA 1XMNB 2BXUH 1GHAG 1TGCA 2OZFA 1GHBG 1SB1H 3A7TA 2BHGA 1MKXH 1LKAA 3M36A 1GCTB 4Y10E 3SNBA 4CRDA 4DT7B 1RJXB 5HF4A 1HCGA 2O9QA 3TMHA 3SHWA 3DFLA 2GV6A 4CR5A 5TJXA 5HFCA 1GI5A 3PMHB 4HFPB 1O5BB 3TH3H 1D4PB 1X7AC 3O8DA 3MH4A 4CRGA 2XBWA 1GQ4A 1A0LA 2HGTH 4UU5A 1MFLA 2KBSA 1K1LA 1ID5H 1Y59T 2IJOB 1TP5A 3RXCA 3KIDU 1DX5M 4WMDA 2ZHFH 2OCSA 4MPWA 3N7DA 1WQSA 4UFDH 1EKBB 1SGFG 6GCHF 1YBOA 2A5IA 2DLSA 1ANBA 3LGWA 4F48B 1PPFE 1GCTC 3BSQA 1KXBA 1A4WH 4YZUA 3SGBE 4ZHAA 5LPEA 1J8AA 4JOHA 2DC2A 5HDYA 3AW1A 4FUCA 3TJVA 5ESTE 4XHVA 1GBEA 1MAXA 1DOJA 1X8SA 1LHCH 1W3CA 1WG6A 2I6SA 1K1NA 3R69A 3T29A 3RUOA 1XKAC 2RFKC 1LO6A 1QB1A 4JJ0A 4MTBA 1YY3A 2EEJA 2LA8A 4K8YA 2KJPA 2TGDA 1UFXA 1SC8U 2C8YB 4D7FA 2Q3GA 1TMBH 4BANB 2FMJA 2VSVA 1O31A 3PB1E 2FX6A 2OS6A 2FCFA 2SGEE 2JINA 1NY22 4FUJA 2XCFA 4MLFB 1ZPCA 1VCWA 1Y5UT 1S0QA 3VB6A 4NMRA 1QRZA 4Y8ZA 1LQDB 1FC6A 1DE7H 3DHKH 4OS6A 1GI3A 1K32A 4ZHLU 5FPSA 1TYNA 3SUGA 1IQNA 1YWUA 4K72A 3SQHE 3WW7A 1NZQH 3GY5A 3RU4E 1N1LA 5HYOA 2BQ6B 1V2LT 4DY7B 1RY4A 1SKYE 2EXGA 3DSOA 2AIPA 2J9NA 4R2ZA 2L6OA 5CE1A 7GCHF 2ZKSA 5DO4H 1P8VC 3A7XA 3EYDA 1P0SH 1P04A 1A5GH 3KQEA 2ZU3A 4TYDA 3EGKH 1CBWB 4O06A 4NIXA 5GWZA 1JRSA 1P2JA 4NMSA 1SLWB 2BXTH 4QT8C 4B6EA 1EOLA 1TMTH 2C8XB 4CHAB 3ZZ7A 1HXEH 1KEFA 2ZDLA 4WXIA 2UUFB 4IN1A 1O2NA 1P2MA 2FXRA 5FBIA 4B76A 4TT3D 4Q2QA 1QFKH 1V2UT 3F2FA 3IWMA 4HGCA 3STIA 1Y3UA 2OC0A 1AIXH 1H1BA 2KQFA 3E1XB 1EZXC 1P2OA 3V0XA 3V3MA 3ZYDA 1UHPA 4I8LA 1X5QA 1AZ8A 2FOBA 2HE2A 1C5LH 3EA9A 3SJIA 4Q63A 1HYLA 2V0BA 2YTWA 1ELTA 2OBQA 3UWIA 1ZTJA 3B8JA 3FOAA 3RXOA 1FAXA 2HWLB 4I86A 2XW9A 3LJJA 1G3CA 1EPTA 3E91A 1FMGA 3MU0A 4M7GA 2KOJA 1EFRD 1DM4B 5E8EH 3K6ZA 4MQAA 2CK3D 1CBWC 4NWLA 5TCAA 1WI2A 2BZ6H 1DS2E 2J98B 2UUYA 2VU8E 2XC5A 3BTQE 4E34A 1GBKA 1HXFH 2J5UA 3AASA 1LVOA 5EQQA 4CHAC 1FY3A 2B0FA 1A5IA 1MQ6A 5IK2D 2YNBA 5GIBA 2F3CE 1AUJA 2P94A 1SLUB 2TGAA 1G30B 3P8OA 4O3TA 1GPZA 1NESE 3ZVEA 2G2LA 3F9GA 5HFFA 2XBVA 3BTTE 1SMFE 3UQVA 5FCKA 3V7TA 2AERH 1ETSH 1X45A 1WCZA 3E0NB 3MMGA 3O5NA 3DIWA 1F0RA 2I6QA 1E38B 1QJ6B 2IJD1 2EEHA 3PDVA 5C5NA 3Q3YA 1QB9A 2ZCLP 1BDAA 1TRNA 4Y7BA 4DJZB 1GBJA 1TBRH 2V3MA 4IBLH 2J2UA 2PV9B 2QKVA 2ZHWH 4O3UA 4REYA 3EDXB 2TBSA 1QL9A 4E35A 2O2TA 2F4LA 4VGCB 5FAHA 4ABBA 2FODA 2RCEA 1F7ZA 4K1EA 2KV8A 2OC8A 3TJUA 1UK3A 1CHOF 5BPEA 2BD3A 1WDIA 1KXEA
chains in the Genus database with same CATH topology
1VCQA 4HZHA 3U98H 1DWCH 2ZU2A 3A82A 2D26C 1GJBB 1IHSH 1O38A 2G5VA 1MD7A 1FQ3A 3SOSA 2F9BH 1UCYH 2WV5A 1K28D 2P16A 2VH6A 2ZQ1A 2VVUA 5HXFA 1TNIA 4MDSA 2A1DB 4D9RA 2B5TB 3S9CA 1C5NH 4Y11E 5C67A 2PKAB 3T27A 2GMTB 1GVLA 2V3HH 3V13A 3O8RA 2IWQA 1BFEA 1H9LB 3RXIA 2W5EA 1T7CA 2ZWLH 4YT7H 1HV7A 2QIQA 1KTSB 1SGRE 4VGCC 1O3BA 2EEIA 4Y0YE 1NRSH 1O3HA 1V3XA 1GMDG 1Z8IB 2ALPA 4BXSA 2JH6D 5E2PA 1GGDB 1K1OA 1P9SA 2EDPA 4AORA 2Y81A 4B71A 2H5DA 4E7NA 1N6DA 5FX6A 1ZPBA 4NXPA 3RXAA 1QURH 4ISOA 1HBTH 2WPJS 2GV7A 1O2IA 3ATMA 4AFQA 2F9PA 1O34A 5CMXH 2PSXA 4FUDA 5JDUB 4TY6A 1V1TA 2PTNA 2GMTC 1TONA 2H5CA 3SNEA 1AWHB 5E0GA 1QRXA 1ZSLA 3ZVFA 2Z6BD 1O3FA 2LPRA 3F1SB 1NRRH 4JZDH 4GVCA 1RTLA 4J1YA 4Q7YA 1BMLA 1G2MA 2FWWA 2G4TA 1AKSA 1P1DA 1XZ9A 3ZZ6A 3KZDA 1YCPM 2VNTA 1GGDC 2QXGA 2OXSA 1UJDA 1N99A 1RTFB 1SGTA 5GDSH 1K1MA 1DUAA 4ABGA 1FV9A 4IC6A 4A5TS 1TRMA 4AN7A 1NTPA 2O8LA 3R68A 2G55A 2AYWA 4BXWA 1WTGH 1QNJA 1A61H 3GY7A 2BVRH 1BTXA 2GZ8A 2R2MB 3SJ8A 3UTUH 5EG4A 1GDQA 3SU1A 5C2ZA 1RGWA 2ZI2H 1BQYA 5DKMA 5JB9S 1SLXB 4BNRA 1RGRA 3SORA 3HPTB 2OTVA 2VPHA 1NRQH 1WUNH 2Z3DA 3C27B 3ZZ3A 2V1WA 3E3TA 5EXLA 1TPPA 1Z6JH 3P17H 2EV8A 1C4Y2 4WVPE 1O2RA 2NU1E 3LGUA 1Q2WA 1EOJA 1XX9A 2KAIA 4RI0A 1O36A 3RXEA 3SQEE 1PYTC 3UFAA 4ESTE 2Q6GA 4MG3A 1K1PA 1AGJA 2BVSH 2A4RA 2P3TB 1D6WA 1FUJA 1YBWA 4LZ4B 3PLBA 3A7YA 1W11U 5GPIB 2KAIB 1SBWA 1C5VA 2XCNA 3DJ3A 4U32A 4RKOB 3ZYEA 3PS4A 2AMQA 3B23B 3UY9A 3TSZA 3D65E 1O3MA 5EQRA 2QC2A 4HOPB 4F4OC 1MMJN 1S83A 1O3PB 3BV9B 5I25A 4G69A 2ZU5A 1WOFA 2Y6TA 3MFJA 2EEKA 1DSTA 2H2BA 2H2CA 2L4SA 1C2KA 3HK3B 1DUEA 1LPZB 1T32A 3PLPA 1U38A 3AW0A 2QF3A 1LVMA 4UE7H 2QCYA 1QCPA 3FZDA 3ATWA 2ZDKA 3FAOA 1NFXA 1N6EA 2F9OA 4JYTA 3S69A 1THSH 1WHDA 1RD3B 5IYTA 4Y76A 3LGVA 3S9AA 1W12U 2FOMB 1ELGA 4IGDA 4JOPA 1ZRKA 3RLYH 1MKWH 2C3SA 4YLUA 1TBZH 2CF8H 3W95A 3CP7A 4MPAA 2M5TA 3A8DA 1QAVA 2PLXA 4XDEA 1P2KA 1G3EA 5JXBA 1VJ9U 3BTHE 4Y8XA 3KN2A 3SJ9A 3ZVBA 1JMOH 1KLIH 5EW2H 1C1VH 1GI1A 1C4V2 4FU8A 2VWMA 5A8XA 3DJ1A 1NT1A 1QAVB 5HFDA 1C5XB 1UHBA 1SGIB 6GCHG 5I46H 1HAOH 2KA9A 3GABA 3VQGA 1S85A 2XWBI 1AVWA 1BMAA 1Y3VA 1QBOA 5JB8S 2QKTA