1LCYA

Crystal structure of the mitochondrial serine protease htra2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
320
structure length
296
Chain Sequence
PPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the pro-apoptotic function of mitochondrial serine protease HtrA2/Omi.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords HtrA2 serine protease
total genus 67
structure length 296
sequence length 320
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1lcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA02
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 1Q3PA 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 3NKKA 4XHVA 3ZYDA 4NXPA 3TMHA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 2KBSA 3PTNA 1Z86A 1O35A 3SUDA 3FFGA 1GBFA 1HJ8A 4Z33A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2VZ5A 2A1DB 2QC2A 4R8TB 2DLUA 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 2LA8A 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 3RLEA 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 2CSSA 3HK3B 2BOKA 1ORFA 2YT8A 1P9SA 3Q77A 5JB8S 1WI4A 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 1R6JA 3VB5A 1ZMLA 2RA3A 1C5UA 2H3LA 1IQFA 4DT7B 1D3PB 3UY9A 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 1X5RA 3MH5A 5GJ4B 2X7ZA 2YUYA 1CQQA 2UWOA 2ZCKP 3SNBA 1BE9A 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 4NMRA 1UTNA 1HRTH 3E17A 4GPGA 1ZJDA 2IOTA 2HE4A 4OS4A 3VB3A 5F8TA 1F5RA 5LPEA 3NFKA 1ZOMA 4RKOB 2CSJA 3RXQA 3S7KB 1RY4A 1Y3UA 1WF7A 1MAXA 3HVQC 1J16A 3K6ZA 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2DE8A 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 4Q2PA 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 3VQGA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 3STJA 1B7XB 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 4K6YA 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 2G8TA 5ESBA 2REYA 3ZVDA 2M3MA 4E34A 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 1Q31A 2RRMA 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 3GDVA 5E0GA 1TABE 3KCGH 1HV7A 4MLFB 2DUCA 2M5TA 4HGCA 3SNCA 3T5FH 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2EGKA 2UZCA 2FOMB 4WF8A 4Z8JA 4N6XA 2OBQA 2Z9KA 2KV8A 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 2EGNA 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 5HFEA 3R69A 2CN0H 4INLA 1EJNA 2KG2A 5GNDA 3TGJE 2K1QA 2H9EH 4X1NU 2EEJA 1O0DH 1FV9A 1K1IA 1QL7A 2BYAX 1UEPA 1TB6H 2QG1A 1YM0A 1SOTA 1C1NA 1S6FA 2C93B 2OQ5A 2GTBA 2NWNA 1DICA 3RLYH 1MD7A 4AORA 1L0ZA 1THSH 3E90B 2OP9A 4PROA 1O2OA 3O8CA 1OWEA 3KIDU 2K1ZA 1MQ5A 2I0LA 2VJ1A 1SGFA 3V13A 1Q2WA 3URCA 1G2LA 2GT7A 1LMWB 2AGGX 3LU9B 3HPMA 1TBQH 1IHJA 1Y7NA 2ZP0H 3DT0H 5EQQA 3MNBA 1C5ZB 1O2WA 1DLEA 1DY9A 4UFEH 4WY3A 2A4GA 5J4QA 2FOEA 2R3UA 1AFEH 3LNXA 2B8OH 4Q6HA 1Z8JB 2JREA 5FPSA 1WG6A 1GBAA 5DTHA 4Q2KA 3RXTA 1Y3XA 4BXSA 3M3TA 1UJ1A 3VFEA 4E7NA 3CBXA 3ZVBA 2ZFPH 2TPIZ 1XXFA 3ID3A 2DB5A 3SW2B 1L4ZA 2J34A 1L6OA 1YLDA 1YP9A 1FJSA 1FZZA 4X0WU 3B8JA 3GY2A 3AAVA 2GZVA 1OYTH 3RXEA 1HPGA 2VWNA 1FN8A 1O3IA 2C90B 1ZGVA 2KPLA 1S81A 4P2AB 5DKMA 1J9CH 3JZ2B 4O3TA 7KMEH 3TSWA 2VVVA 1H9HE 2GV6A 1TGNA 5GLJA 1YBOA 2KOMA 2OSGA 1G37A 1TPSA 2ZHEH 3M3SA 2A32A 2NU1E 1ZMNA 1UM1A 3IWMA 1KY9A 1KDQB 1O5DH 1OOKB 3MU4A 2ZPRA 4WXIA 2F83A 2A5AA 3D49H 1P0SH 3MNCA 3KL6A 1VAEA 4X8SH 3A8DA 1YPJH 1P10A 2RA0A 1CBWB 2P8OC 5EXLA 4A92A 1DX5M 3S0NA 2W7RA 3QUMP 2A45B 4FVDA 3T62A 1BHXB 1BMMH 2OGPA 1KYNA 1CT2E 2TIOA 4I8HA 1W9OA 1P3CA 1CA0B 1O5AB 1QB9A 2ZZUH 1FONA 1O5BB 1WV7H 2PGBB 1C9PA 2H9HA 2AERH 3F1SB 3QGJA 1IQNA 5B6OA 2W3KA 1V2KT 5HM2A 2DAZA 3GISB 4MPWA 2EAQA 2D92A 2Q6DA 4U32A 1VGCB 2BD2A 2ZTXA 1HAYB 5F67A 3OU0A 3FVFB 4NIWA 1DXWA 5B6LA 4FUJA 4JCNA 2D26C 4DIHH 2PR3A 1O38A 1Y5BT 2IWPA 3CC0A 5GWZA 4E05H 3DORA 5HMAA 4NWLA 4K2YA 3TNTA 1V2OT 2VGCB 5FCRA 1JXPA 4KFVA 1TLDA 4AYVB 2FXRA 1UM7A 2V3OH 1UTMA 4MNWA 4FUGA 4HZHA 1QBOA 2BDIA 4OGYA 3L33A 2FS8A 1QB1A 1GHYH 2O8MA 1BTZA 3M3VA 4YOIA 3SOSA 3MMGA 4B1TA 3V7TA 1QJ1B 4TWWA 1SOZA 2I4SA 4NNMA 1H8DH 3Q3YA 3SI4H 1NRQH 4O06A 3RXOA 4CR9A 2W5EA 2XC5A 3RUOA 1MTVA 5HFBA 2Z9IA 4I8JA 2WV4A 3RC5A 5JXBA 3H7OA 1UVTH 4X2YA 2JH6D 5C2ZA 1MKXK 1W9EA 1P57B 1O30A 2VVCA 3LC3A 4YDPA 2XBYA 4GCHF 5HEYA 3L3TA 3KQEA 1P03A 3WY8A 2BOHB 4P0CA 1UK3A 5A2PA 2VNTA 4B2BA 2LNCA 2UUJB 3E6PH 1DDJA 4K75A 1GG6B 3KNXA 2VINA 2EDZA 1J14A 3MO3A 1C2HA 4JYVH 3B76A 4WMDA 3SNDA 5F03A 3SHWA 2FDAA 4ESTE 2ZQ1A 1QL9A 2P8OB 1TFXA 1K1LA 2I6QA 1FAKH 3C27B 4KELA 1KXEA 5A2MH 1YPGH 1EJMA 4NXQA 1GJCB 4NWKA 1JIMA 4DOQA 3RXAA 3H7TA 2FTMA 4ZXXH 1AB9C 1C5LH 2STAE 1W3CA 1W11U 5DPAA 1J15A 1AVXA 6CHAB 1ELBA 4X6NA 1QFKH 1Y3WA 2AMDA 5EXNA 3GICB 3UREA 1PYTD 3LJJA 3QE1A 1LVBA 1ZRKA 1XX9A 3QGLA 2GZ7A 3MU5A 1QAVB 2M10A 3ATIA 3P70B 3QDZB 4JYUH 1AZZA 2PFEA 1FC7A 1JBUH 1P2JA 1ANEA 1GBMA 2SGDE 3TJUA 1BT7A 4Y8ZA 1ELTA 1EZXC 5E6PB 4GVCA 1OWJA 1DT2A 4NCYA 1O3FA 1F0SA 2Z3EA 1GGDB 2EGOA 1ABJH 1YPKH 3MO6A 9LPRA 4YYXA 2ZGHA 3URDA 4VGCC 1BRAA 4KTUA 3SOEA 3F9HA 4IBLH 1CVWH 4CRBA 1G3DA 1FC9A 4GVUA 2HNTF 3RXLA 4NNLA 2B7DH 1TBRH 4Q7ZA 2W7SA 7GCHG 2J4IA 4B2CA 1P02A 1GHAG 1TMBH 4FUFA 1DFPA 1C5TA 1HAIH 1A5IA 4ZAEA 1A3EH 3MU1A 2XBXA 3TU7H 4ABJA 3LC5A 1DUAA 1SGTA 2QKUA 5L2YH 3SGAE 2QV1A 3I4WA 3ZZCA 3M61U 1IQMA 4HOPB 5I7ZA 4IC6A 2VIVA 5E2PA 1N7FA 2AIPA 1F5LA 3MNSA 2O9QA 3Q3XA 1SLVB 1TWXB 5T6DA 3DFJA 3ZZ3A 2JH5D 1UEZA 2JILA 1C1UH 4NA7A 3GDUA 2FCFA 1C2FA 2BQ6B 3RC4A 1G9OA 2FS9A 1TQ3A 1VCWA 1EPTA 1WHAA 1SBWA 2UWLA 4OS6A 1BDAA 1LHEH 2OINA 5CMXH 4WMFA 2Z6BD 1C4V2 3TSZA 3GCTF 2OQSA 1IHSH 2R2MB 2KJKA 1CSOE 1HJ9A 1TONA 1SGIB 2ZPQA 1SGPE 1C2MA 1XM1A 2SGQE 3ZZDA 2Y82A 1U37A 2VIOA 1KSNA 1W0ZU 5HF4A 1GL0E 2A5KA 1C1QA 1LDTT 3RMNH 1XZ9A 4BTIB 2RDLA 3BEIB 3SU4A 3TLOA 2TGDA 1ZJKA 2PKSC 4ZMAH 1S85A 5C5OA 2J95A 2UWPA 5C67A 4I8KA 1C1WH 1MUEB 2F9PA 1MKWK 3NXPA 1OWDA 1U6QA 1Q3OA 4XSKU 3U8RH 2G51A 3RXJA 1V2LT 4DURA 1P05A 2WPMS 1NFWA 1SB1H 2FX6A 3U1IB 3SUGA 4BNRA 4WYTA 2ZO3H 3P8FA 4BXWA 5DP5A 2ZFTA 2FESH 7LPRA 1DOJA 1EPTB 2PA1A 4ISLA 4HFPB 5I25A 1AQ7A 1HAVA 1THPB 1OBZA 1HDTH 1ANBA 1YGCH 2G5VA 1VCQA 5A0AE 1V6DA 1MU8B 3RXDA 3PMHB 4KKDA 1WIFA 3L4FD 3NPSA 1A0JA 3MH4A 1N6XA 1IU0A 2GT8A 4Q2NA 3SQHE 4BOHA 3T25A 4E06H 3HGPA 2P94A 2ANYA 4DY7B 1OP0A 1TNGA 3BTFE 1PPCE 1D5GA 2ZF0H 2PTCE 5DP3A 2STBE 2H3MA 1C5OH 2BY6X 3ZZAA 1GHBF 1GHAF 2HWLB 1AUJA 3RXVA 1DLKB 1GJDB 3CENA 2BY9X 2BDAA 1OWKA 2PSXA 3HKIB 5EG4A 2WINI 1FAXA 1GVLA 2Z3CA 5G1DA 2BHGA 4U01A 3K82A 1IHTH 4PQWA 2BVSH 1GVKB 1HCGA 3Q3KA 1A5GH 1PPFE 3BF6H 1S5SA 2VVUA 1W9QA 1OKXA 2Z7FE 3TH3H 1L4DA 1AFQB 1ZHPA 2BDHA 4GAWA 2JH0D 4X8TH 2BVXH 2WPJS 1V2JT 8ESTE 4DCDA 1GHVH 5DP8A 3A82A 1AUTC 3ID4A 4OS2A 1Y8TA 1HLTH 1V1TA 2BDYA 1FDPA 1TNKA 2KQFA 1F92A 1E36B 3LGTA 5A0BA 2H5CA 2H2BA 2A5IA 2QXIA 2E7KA 4UFFH 1BRCE 2C8XB 4YM9A 1P09A 2V3HH 3CP7A 1ZYOA 4I31A 1QB6A 4A1VA 1O3BA 3SBKA 1ARCA 1U38A 3HATH 1TGSZ 4YLQH 1LPZB 1T4UH 2LOBA 3NZIA 2CV3A 1BBRE 3E0PB 4L8NA 3ATMA 1V2QT 4UU5A 2ZHFH 1O3HA 4JOFA 2ANWA 2H2ZA 5DO4H 2ZGJA 1NC6A 4XDEA 2ZKSA 1AD8H 1HAXB 1D9IA 3M7UA 2VWRA 5DP4A 3RXIA 1O37A 1GBCA 1O2LA 5HDYA 3A86A 3UUZA 4A1TA 1GMHG 1NM6A 1JRTA 2QCYA 4ZH8A 5EPYA 2GDEH 4IN1A 4JYTA 5LPFA 3GOVB 4WYUA 3ZVGA 1MTUA 1TMTH 3HGNA 4BAOB 2M0UA 1WTHD 4X2XA 1N6DA 2O8UA 2W26A 2FEQH 3UTUH 1MAYA 3SV2H 3O8RA 3ODDA 2TRMA 3LIWA 2EXGA 4JMYA 2A0QB 5C1UA 2BLOA 1BJVA 1BFEA 3PLBA 1B5GH 2RCEA 1O3AA 1E37B 1B8QA 3RXMA 3QTVH 4Q80A 5CE1A 2GCHF 3VPKA 1UK4A 3E0NB 4Y8YA 4NG9H 2Y80A 1C5WB 1MH0A 2FZZA 3TGKE 1X7AC 1P1DA 1E35B 1D3DB 5FPYA 2KJPA 1EUFA 4BANB 3SJIA 4O3UA 4NXRA 1EZQA 1S83A 3LJOA 4MPUA 4AX9H 2BTCE 1GHZA 2RG3A 1O2ZA 2ZU5A 1CHGA 5E2OA 1HAVB 2KRGA 4ZUHA 2VB0A 1HXFH 4K1EA 1WQVH 1O2QA 1HAGE 1X45A 2EDPA 3FP7E 2YNBA 2ZWLH 3EYDA 1GBIA 3RXSA 3O8BA 3KEEA 2G81E 3MOCA 1SC8U 4MNXA 2AMQA 1ZLRA 4Y0YE 3PDZA 4NMSA 1PPZA 3VQFA 2WV5A 3LH1A 1K22H 1BBRH 2ZCLP 1UCYH 4ZKNU 1OBXA 1AWFH 2JIKA 3S9AA 3SU5A 1PQAA 1VITG 1XUFA 4TY7A 3WKLA 3UOPA 1JWTA 1DWDH 3SU6A 1P2OA 1KLTA 1C4U2 1GJAB 1I16A 1ZSLA 3SJ9A 1T8LA 3RL7A 4CHAB 2PKTA 1U39A 1MTSA 1OWIA 4KTCA 3LPRA 1NESE 1OPHB 2H2CA 1QIXB 2Q9VA 4ABHA 3SU3A 5JBTA 2ODYB 1QCPA 2ENOA 1MBMA 4ZXYH 1FNIA 1ELDE 3RMLH 2V1WA 1V2VT 4K8YA 1QL8A 1RTKA 1GJ4H 4J2YB 3QN7A 2M0TA 2FI3E 2O2TA 2HLCA 4RN6A 1ACBE 1SQOA 2FNEA 4Y8XA 3TGIE 2AFQB 1VJ6A 3LH3A 2Y6TA 2OD3B 2KAWA 3BTWE 1WH1A 3SHCH 2A2QH 4AFQA 4E7RG 4K8BA 1TRNA 2PKSB 1DITH 1EAWA 2XCNA 2FYQA 1BOQA 2XYAA 1NY22 1T7CA 1C5VA 1CT4E 5G1EA 1P2NA 3SV8A 5C1YA 2CMYA 5HFDA 5TJXA 4JZFH 1SSXA 1TX7A 2FI4E 2PZDA 2G00A 1BJUA 1XUIA 5DP7A 4TY6A 3ZZ6A 2ZDLA 4UFGH 2SGAA 1GMDG 1B0EA 1ZTJA 1UTOA 1FY8E 3GYLB 1QRWA 1D3TB 1C1VH 1FQ3A 2ZGCA 1KXBA 2D8WA 3B9FH 3R0FA 1YCPH 1LHDH 1ZPBA 1KXCA 1QQUA 1ZHMA 2ESTE 3RDZA 3Q00A 1EXFA 3AAUA 2OC1A 3SNEA 2BVRH 1O3EA 5DG6A 1K21H 3O46A 1Z6EA 3KZEA 3CBZA 1MMJN 4ABFA 1FY5A 2BD8A 1GCTB 1OZIA 2BXTH 2GV7A 2F9UA 3SUZA 4FUBA 4KGAA 3VB4A 2PKUA 2O8WA 4IMZA 3BTDE 3GCHC 1XUKA 4I8GA 2G5MB 1C2EA 3PLPA 1UCYK 2BM2A 3LNYA 3RL8A 3W94A 4OS5A 1GQ5A 1HFDA 4GLYA 1LVOA 1G36A 5LGOA 4SGAE 4ZKOU 3PROA 1V6BA 1NFUA 5HEBA 1Y59T 3BTQE 1SGEE 5T6FA 5CHAC 3CS0A 1GWAA 3PS4A 3ATWA 3ELAH 1C5SA 3F9GA 1O3MA 1NZQH 1A7SA 3KQDA 4Y7AA 2EV8A 3MU0A 1QGFA 3PM3A 1ID5H 1GJ7B 2FOGA 2EHRA 1GL1A 1A2CH 3OTJE 3VXEH 1YPHE 1PPEE 1FC6A 5GPIB 2KOHA 3PMJA 4ZKSU 4ASHA 3A88A 3HPTB 1TE0A 1C5QA 4F4OC 3UWIA 1L1GA 4K69A 2J92A 1HAHH 2J94A 2Q3GA 1TNLA 1YYY1 2ZFRH 4FXGH 3RMMH 2BD7A 1P06A 6CHAC 3E16B 1SQTA 1C1RA 1N7TA 2OZFA 2TGPZ 4X1RU 2VSVA 1NRSH 3E8LA 3QLPH 1GMHF 1IQJA 1P1EA 2AWWA 3QO6A 1W10U 2ALVA 3I78A 1AVGH 1FY3A 3QIKA 1UVSH 2GX4A 5L30H 4K60A 2UUYA 4TPIZ 3RM2H 1DM4B 1O3OA 1HIAA 4MQAA 4ABGA 1GDNA 1AO5A 2OTVA 1SFIA 1ESTA 4FUDA 1QURH 3JZ1B 2XW9A 1RZXA 1L1JA 4DIIH 5GCHF 2R2WU 4LZ1H 1Z6JH 3KZDA 2FOFA 2QF0A 2H5DA 2WPKS 3AASA 1WJLA 2IWQA 5C3NA 1GJBB 1GG6C 1V2WT 3RXCA 3K9XB 4JK5A 3SJOA 1GBEA 2VU8E 1UF1A 2KPKA 1SFQB 1CGJE 2HPPH 3SU1A 2GCTB 1RIWC 1BBRK 3P92A 3M35A 1FN6A 1QR3E 2BD3A 4HI3A 4WJG2 1E34B 3A89A 3R3GB 1EX3A 4U30A 2ZCHP 3TVJB 1RJXB 3AVZA 3KGPA 2EI7A 3A7VA 2FOCA 3DIWA 2I0IA 1SGDE 5FPTA 4OEOA 2EI6A 1NRNH 2BLVA 1Y5UT 1Z8RA 1BTPA 1C5YB 1C1PA 3M36A 4RSPA 1NU7B 1S84A 5FHTA 2HE2A 5FB8C 2EC9H 2QN5T 1C1TA 1SGQE 1T32A 3EAJA 1EOJA 3LGWA 2DKRA 1DWCH 4AG1A 1FMGA 5EOKA 2YT7A 1LKAA 2A7CA 1CGHA 1N6EA 2JETC 3RU4T 1K28D 2R0KA 1C2IA 2XBWA 2EI8A 1Y5AT 2WUBA 4F8KA 1LPGB 3BPUA 2GP9B 1RFNA 4MPXA 4JL7A 1Z87A 1TAWA 3A7ZA 1NRPH 2FI5E 1GMCG 1K9OE 4WMEA 3SUFA 1GDQA 1S0QA 3QDOA 3RXUA 4BAKB 4CRFA 1ZTKA 1AB9B 2XWAA 3SV9A 1W0YH 4JZDH 2KA9A 2JXOA 1AFQC 1BQYA 1GJ8B 1TPPA 2XBVA 2HVXA 1EOLA 2Z3DA 2JWEA 3FY5A 1H4WA 1IQHA 1G9IE 4NZLA 3S9CA 1K1JA 1MKWH 4H11A 2ZU2A 3FZZA 3BTME 3P8GA 3WKMA 2PGQB 1BITA 2Z17A 2QAAA 3HKJB 3LGIA 2O8LA 4Q6SA 2BD4A 3ID1A 5ETXA 4WH6A 4I8LA 2HGAA 4YZUA 4GVDA 1W14U 2B9LA 3UQVA 1O2SA 1HJAC 1RTFB 4HOPA 4AFSA 3ITIA 2LC6A 3AW0A 3U8OH 3SNAA 2QKTA 4NA9H 2QBWA 1WTGH 4LMMA 3S69A 2PDZA 1F0RA 4CBNA 4AZ2B 2GDDA 1IQKA 2XRCA 1CA8B 4OS7A 1CBWC 2ZHWH 3M5MA 3R0HA 1RTLA 2PW8H 3TPIZ 1QQ4A 4AN7A 5H3JA 2FMJA 5AFZH 3M5NA 4KP0A 5A09A 1WBGB 1GMCF 2SNWA 7ESTE 2HGTH 2FOBA 1AHTH 5HM9A 1WFVA 2IN2A 3UQOA 1P2QA 1V2RT 3QJMA 6GCHG 3F6UH 3A7WA 3QZRA 5FBEA 4O9VA 1K2I1 3V12A 3P8NA 4B2AA 1EZSC 2C8ZB 1O3CA 4K3JA 1HNEE 3U69H 1O3JA 1LVMA 1Z7KA 1QAVA 2BY8X 3A87A 2Y5GA 3PLKA 5LH8A 3BTHE 4JOPA 1DY8A 2DC2A 1SLUB 3KQCA 1KEFA 1YCPM 4AOQA 3MWIU 2CS5A 2OS6A 1V2ST 5EZ0A 3PMAB 1B0FA 3ATLA 5DGJA 5HFFA 1CGIE 3O5NA 4E3BA 2OC7A 3SJ8A 2P93A 2TGTA 2ANMH 2ZG0H 1OXGA 4X8VH 1LHCH 3DJ1A 1PFXC 3DJAA 2MHOA 4JOHA 1AWHB 1BMLA 2JINA 2ODQA 3IG6B 1IU2A 4WH8A 5HEDA 4NMQA 1MCVA 1TGCA 3GY7A 5EODA 3SUEA 1TOCB 1BTUA 3GY4A 2KYLA 2SGFE 3MHWU 3W95A 3PV5A 1DE7H 3LOXA 5JBBS 3ZVEA 2LPRA 1W2KH 1FY1A 2V90A 1RGQA 4ISHH 1MTWA 3IITA 1UTLM 3MH7A 4OAJA 1J8AA 3H5CB 2PWXA 4UD9H 7GCHF 1NN6A 4JK6A 3K6YA 3SU2A 2GZ9A 3PO1C 4Q3HA 4BAQB 1J17T 3K50A 3B23B 1GI0A 3ZZ7A 1MFLA 2OC8A 1ARBA 2CHAB 3ZV8A 3NUMA 1SHYA 2K20A 2NU2E 1P12E 4XE4A 4MNVA 3Q76A 1IOEA 1O34A 2PKAB 1V5LA 4KTSA 3A8CA 1SLWB 1V2TT 2DE9A 4JZ1A 1DXPA 3A84A 5BRRE 1A1RA 2YNAA 2GMTC 4INKA 1RGWA 2BZAA 3RP2A 1V3XA 4JZIA 2R9PA 3DHKH 1LQEA 2EJYA 1UCYE 2VH6A 4WXVA 4UEHH 3F9FA 1ZUBA 1OS8A 1VJ9U 1DS2E 1S0RA 1C9TA 4MPVA 2ZU3A 1O2GH 1N7EA 4DJZB 1YPMH 1ZMJA 1EATA 4JOJA 2IPHA 3TK6A 1MBQA 4NMVA 1UITA 4I32A 3PV2A 4UU6A 5JPMH 3NK8A 1NPMA 4B76A 1JMOH 4XBBA 4A1XA 1Y3YA 2D8IA 1Z8IB 3GY8A 3VB7A 3OTPA 2ZDAH 3SV6A 4Q2OA 2QY0B 1SPJA 4X2VA 1SR5C 5EU8A 5H4IB 2ZDVH 1O5EH 1WOFA 1N6FA 3I1EA 5EPNA 4EDJA 3SQEE 1UHBB 2ZDKA 1ZPZA 4NFFA 3PYHA 1GDUA 2BD5A 4R0IA 3RXBA 3A7YA 2VWOA 4X1SU 1N8OC 2CF8H 2HRVA 3QTOH 2QYIA 1Q7XA 3STIA 1MTNC 3GYMA 1GBJA 2MX6A 4YOJA 1QNJA 4NFEA 1TP3A 1EZUC 1C2GA 3OSYA 1UVPA 2QGRA 5AVDA 5GXPA 1F0TA 2VGCC 1BTYA 3BG8A 1MZAA 4JOGA 2QA9E 3LONA 1YCPK 1BZXE 3E3TA 4H6SB 2I6SA 4YO9A 1C2JA 3ZVCA 5G4BA 1F2SE 4K72A 1WHDA 2Y5FA 4XBDA 1O5CB 4TYDA 1DPOA 2AS9A 4Y6DA 3SHAH 1V5QA 3TSVA 5FBIA 2F91A 4R2ZA 2EA3A 1NFXA 2XTTB 4QT8C 3UFAA 1GJ9B 4Y0ZE 4D7FA 4CH8B 2G2LA 4MNYA 1H9IE 2UUKB 4AMHA 1GBBA 2Q6GA 2RCZA 1FPHH 3AXAA 3K1RA 5ABWA 2ASUB 1BMNH 3FP6E 5BPEA 4NMPA 1ZRBA 3RXRA 1AE8H 5EQSA 1ELVA 3M5LA 5E21A 2GD4B 1FIWA 1GGDC 2GGVB 2KL1A 3GY3A 2WYGA 3D62A 3ZZ8A 5JYIA 4REYA 2ZTYA 4ZHMU 4THNH 4I33A 2QXJA 2ZHQH 2L4TA 1WU1A 4MVNA 4ABAA 4ISNA 2BLQA 2OCVB 2A4QA 2Z94A 4TWYA 3PMBB 5F6MA 2L97A 4WVPE 4BTTB 5C5NA 2AH4X 3A85A 3R68A 1A3BH 4ABEA 4AFZA 1X6DA 1QBVH 3GY6A 1C2KA 1YKTA 1YBWA 3QWCH 2F9NA 3GY5A 4NMOA 3ODFA 4GUXA 4U2WA 1W8BH 1ANDA 2AIQA 2ZGXH 1WUNH 1GI7B 1KLIH 1O32A 2KOJA 3DUXH 1C5PA 3P95A 1O3PB 5JBCS 4FUHA 4NSVA 2R3YA 4J1YA 4NIYA 3BTEE 1EJAA 1UO6A 4Z6AH 1GJ6A 4Q7YA 5EQRA 5F8ZA 1MFGA 4NIXA 3SORA 3UR9A 1QA0A 1EP5A 3FAOA 2F9OA 1NO9H 3E1XB 1P9UA 4OEPA 2PHBA 2I6VA 1TNHA 1O31A 3BTKE 2F9BH 1A5HA 2BY5X 1N99A 1GBLA 2KJDA 1GI1A 2AMPA 2CF9H 4H6TA 1HAPH 2EEKA 5HXFA 1O2MA 1S82A 4F49A 1MTNB 3MH6A 1D6RA 3I29A 5HYOA 3F9EA 1TRYA 1ETRH 3PO1B 2WUCA 1LHGH 1T2MA 1SGCA 2FE5A 1K32A 1GCDA 2H1UA 2NU3E 2JOAA 1CO7E 1VCPA 1SI5H 1AZ8A 1TX8A 3SJKA 2J38A 3KHFA 2VIDA 1GI6A 3DD2H 2D90A 1BHXF 2ZU4A 4LK4A 2VRFA 3TITA 2SGEE 1P8VC 4CREA 3PDVA 2GKVE 4K1SA 1THRH 1WF8A 1SLXB 4OGXA 1UEWA 2Y81A 4Z0KA 3EDXB 1ELCA 1XVMA 2R0LA 2VWLA 2PNTA 1GJ5H 3EA7A 4GCHG 2M0VA 1CT0E 3NWUA 2FOAA 3QZQA 2VIWA 4ZHLU 1HAZB 3LT3A 1OX1A 5A0CA 3V0XA 4MPAA 1LKBA 3RU4D 3RXGA 3TK9A 1BCUH 1TP5A 3SU0A 3CYYA 1KXAA 2BX3A 2A31A 1DANH 5JBAS 2HNTC 4JORA 2F5YA 1LTOA 1G3EA 3CBYA 4UFDH 4Y71A 4AB8A 2FYRA 1E38B 2W4FA 1QLCA 1T8MA 1TOMH 3MNXA 2ZNKH 1AKSB 2GCTC 2A4RA 1WFGA 2FX4A 2P95A 2W7UA 4AGKA 3EQ0H 1QHRB 2J2UA 4JOEA 3DA9B 3RC6A 1SGNE 3N7OA 3ID2A 2A7JA 1U3BA 3T2NA 2QF3A 2FLBH 5FXLA 1O2UA 3S7HB 1CA0C 3BSQA 1XUGA 5EXMA 1F7ZA 3ZYEA 4X6PA 1P04A 2WYJA 1W13U 1VITH 1MU6B 2BDCA 2THFB 3P6ZB 4NZQA 2I1NA 1XVOA 2CHAC 2QXHA 1C5NH 2IWOA 5HGGA 1UJDA 3GJ9A 5E11A 1A0HB 3EE0B 1FUJA 3SHUA 1O39A 2KAIA 5C20A 1HUTH 4X1PU 4AG2A 3TJOA 1G2MA 4A6LA 2GCHG 5L6NH 1TX6A 2BDBA 4D7GA 4O03A 1O2PA 2PV9B 2ZDNA 4ZKRU 4GHTA 3TNSA 2FN5A 3PWCA 4FU9A 1ZSJA 3ZVFA 4ABIA 3EGKH 1QAUA 1A4WH 4YTAA 1HAOH 1TBZH 1LO6A 3U9AH 5K0HA 1F0UA 1ZR0A 3SV7A 2SNVA 2CXVA 1G3BA 2BDGA 2VH0A 2DJTA 1F5KU 1H1BA 1UTKA 3A8BA 4CRGA 1OSSA 1GBHA 1EAUA 1PYTC 1ETTH 1D4PB 4B71A 2EDVA 2EEIA 1C1MA 2A7HA 2G4UA 1KIGH 1O3NA 1AU8A 2VWMA 4LXBH 4VGCB 1D3QB 2UUFB 4IGDA 4FUEA 2HALA 4I7YH 3P17H 4Y7BA 1P11E 5K7RA 1FLEE 4X2WA 4DVAU 1M9UA 2OQUA 3DFLA 5HJ1A 5LPRA 1GVZA 3NCLA 4OS1A 3VGCC 1EP6A 1IQGA 5F3XA 3PV4A 3FANA 1Z1JA 4NGAH 4YESB 1Q3XA 1EB2A 1HXEH 2Y7XA 1P2IA 3A7XA 1A46H 3UNRA 2ZPSA 1EKBB 3RXKA 3ZZ4A 1GBDA 2TBSA 1LVYA 4D76A 1SVPA 2IWNA 4FU7A 1T8OA 1O36A 1SQAA 1Z1IA 2D1JA 3MU8A 4CRAA 5EW2H 4AB9A 1T31A 1PDRA 1QBNA 2Y5HA 1XUHA 1HIAB 2ANKH 4FU8A 4CR5A 2NU4E 2EEHA 2P3WA 3HPKA 2BMGB 2SGPE 2F9VA 1FCFA 1OBYA 1AGJA 2YUBA 3KF2A 2QKVA 6GCHF 3ZZ5A 1VA8A 2I04A 3UIRA 2BX4A 2AINA 1AMHA 1YPHC 1X5QA 4RI0A 1NTEA 4A5TS 4IMQA 2FM2A 4FVBA 4XBCA 4H4FA 3BV9B 1I92A 2VPHA 1C2LA 2BQWB 2O8TA 3BG4B 1TNJA 3MYWA 3M7TA 1ZTLA 5TCCA 3OYPA 4Q2QA 1KXFA 1HGTH 1NTPA 2QT5A 2XC4A 1CHOG 4NMTA 2HOBA 1YLCA 1UTQA 4UDWH 3M7QA 1VITF 4GHNA 1A61H 2P3FH 1QJ6B 2FODA 1GI2A 3UNSA 4Y76A 4NA8A 1TA2A 2B0FA 2FP7B 1GI4A 1INCA 1K1OA 5L2ZH 4CRDA 2H9TH 2PUQH 2XC0A 1ANCA 5DK1A 1UTJA 3KQBA 3SFJA 2V6NA 6ESTA 3T26A 1XUJA 1DWEH 4K78A 1MC7A 4NSYA 4D9RA 4INHA 1NF3C 3ENSB 4TPYA 5FCKA 1PPBH 1FIZA 1LQDB 2ZA5A 1FI8A 3LGVA 5SGAE 1IAUA 1O33A 2AGIX 2C3SA 2ZPMA 1ESBA 2BB4A 1P2MA 1WI2A 2FOHA 2SFAA 2P3TB 1QRZA 2VIPA 1VJAU 2P3UB 1O3GA 5CHAB 1YPLH 1SGYE 1O2RA 6LPRA 3K2UA 1TPOA 4YLUA 1QA7A 1TPAE 4O97A 3GSLA 1UVOA 1MD8A 2XWBI 3ESTA 5DP9A 1M5ZA 2F3CE 1HJAB 1HBTH 2OC0A 3D23A 1MZDA 3EGGC 1EAIA 1RS0A 4AYYB 1NROH 1C4Y2 1BB0B 1JRSA 1BA8B 1PJPA 1VGCC 3PWBA 4ISOA 3TH4H 1O5GH 4SGBE 2OMJA 3BN9A 1AE5A 5I46H 3TH2H 2OCSA 1BTWA 1GCTC 2ZQ2A 1O3DA 1WYKA 1X5NA 1O5FH 5AHGH 3ZZ9A 1O2YA 3UNQA 5J4SA 2R4HA 5D13A 3ATKA 1ELAA 3QJNA 1XMNB 1TGBA 1XKAC 1GQ4A 2VSPA 2GVFA 3RLWH 1PPGE 2Z9LA 1DUEA 3A81A 2DLSA 2JETB 2ZPLA 1GBKA 1RXPA 5JB9S 3LKWA 2DMZA 4K76A 2XCFA 1GI9B 2WPIS 1UJVA 1E0FD 3S9BA 1TGTA 1BIOA 1G3CA 1KLJH 3U8TH 4G69A 2M0ZA 1UJUA 1HB0B 5PTPA 5A8XA 1ELFA 1TALA 2L4SA 1O2VA 1RD3B 3T27A 3A8AA 4ZROA 1NT1A 1KTTB 3SGBE 1V62A 2FO9A 5A8ZA 3A83A 3UOUA 1WSSH 4KFWA 1SMFE 3QX5H 1SHHB 1RGRA 3SI3H 1UFXA 2BXUH 2F0AA 2JKHA 1NRRH 1O2HA 4ABBA 4A7IB 3VXFH 2GZ8A 2OXSA 1VR1H 1DSTA 5E22A 3VEQB 3RXPA 4X6OA 2HNTE 1OP8A 1IQEA 1NS3A 5T3HA 4AGJA 1BUIA 3FZDA 4ABDA 2AWXA 3BIVH 1TNIA 1TIOA 2ZC9H 1YC0A 2C4FH 2J9NA 2YTWA 4B73A 1GHWH 5HETA 2EEGA 2W3IA 4JOKA 4JZEH 1UHBA 2PSYA 2AWUA 1ESAA 3A7TA 1PQ5A 1WCZA 3ZV9A 1C5XB 1X8SA 1V2MT 2AYWA 2DM8A 1GI8B 4E35A 1ETSH 2G52A 3UPEA 2OPGA 3EGHC 1FPCH 2Z9GA 1ZGIA 3DJ3A 1TRMA 1GM1A 1KXDA 5E0JA 2BQ7B 2A4OA 1C1SA 1CHOF 3QK1A 3UR6A 8GCHG 3L6PA 4ZHAA 4CBOA 3E91A 4K5ZA 3CS7A 2BY7X 4Y10E 1XKBC 1GPZA 3BTGE 1AVWA 3FP8E 2LC7A 3NGHA 1W7XH 5HF1A 1WQSA 2NU0E 4XOJA 1BTXA 1MCTA 1UEQA 5E8EH 3GGEA 1PPHE 1AKSA 4LZ4B 2WL7A 4M7GA 3D65E 3AW1A 1P2KA 3NFLA 2FTLE 1V2NT 2AGEX 3O8DA 3TK5A 3SN8A 2WPLS 2XNIA 1K1NA 2WPHS 4HTCH 4WWYA 1UMAH 3GCOA 4BAMB 2A2XH 1CU1A 1OYQA 5E0HA 1JOUB 4Y79A 2AEIH 5HFCA 2Q6FA 1MKXH 1GHXH 1ZSKA 1GHBG 5DP6A 1BRUP 1NU9A 1T8NA 2ZI2H 1W7GH 4CH2B 4IW4E 2OLGA 3LGYA 1LCYA 4ISIH 1GMDF 3GCHB 3RMOH 2VIQA 3JXTA 2BYGA 1TQ0B 1UHPA 3V3MA 3I18A 1HYLA 5AF9H 1AY6H 3CH8A 2ZU1A 1AI8H 1KTSB 2ZIQH 2FPZA 1EASA 5E1YA 3GDSA 5EYZA 1EQ9A 2HPQH 4XFQA 1VB7A 2PLXA 3U1JB 5EGMA 1G30B 2H6MA 4Q7XA 2G5NA 4FGMA 3F68H 5DJ7A 1P01A 1C2DA 3BEFB 2ODPA 3TJNA 2Q1JA 1RRKA 1RIWB 1QJ7B 1AIXH 2QIQA 1UK2A 1KWAA 1WAYB 1MQ6A 2ZHDA 3ZRTA 1ZOKA 1C1OA 1LHFH 3HK6B 1L1NA 1TYNA 3T28A 2LUIA
chains in the Genus database with same CATH superfamily
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 1Q3PA 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 1OHHD 3NKKA 4XHVA 3ZYDA 4NXPA 3TMHA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 2KBSA 3U28C 4B6EA 3PTNA 4RT0A 1Z86A 1O35A 3SUDA 5DN6D 3DCLA 3FFGA 1GBFA 1HJ8A 4Z33A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2VZ5A 2A1DB 2QC2A 4R8TB 2DLUA 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 2LA8A 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 3RLEA 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 2CSSA 3HK3B 2BOKA 1ORFA 2YT8A 1P9SA 2WV9A 3Q77A 5JB8S 1WI4A 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 1R6JA 3VB5A 1ZMLA 2RA3A 1C5UA 2H3LA 1IQFA 4DT7B 1D3PB 3UY9A 2YMSB 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 3W1EA 1X5RA 3MH5A 5GJ4B 2X7ZA 3F0PA 2YUYA 1CQQA 2UWOA 2ZCKP 3SNBA 1BE9A 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 4NMRA 1UTNA 1HRTH 3E17A 2GEFA 4GPGA 1ZJDA 2IOTA 2HE4A 4OS4A 3VB3A 5F8TA 1F5RA 5LPEA 3NFKA 1ZOMA 4RKOB 2CSJA 3RXQA 3S7KB 1RY4A 1Y3UA 1WF7A 1MAXA 3HVQC 1J16A 3K6ZA 3FO8D 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2CK3D 2DE8A 2EQNA 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 4Q2PA 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 3VQGA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 3STJA 1B7XB 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 3FKSD 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 4K6YA 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 4FETA 2G8TA 5ESBA 2REYA 3ZVDA 2M3MA 4E34A 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 2LELA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 2AHME 1Q31A 2RRMA 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 3GDVA 2M2AA 5E0GA 1TABE 3KCGH 1HV7A 4YXWD 4MLFB 2DUCA 2M5TA 4HGCA 3WW7A 3SNCA 3T5FH 1S6LA 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2EGKA 2UZCA 2FOMB 4WF8A 4Z8JA 4N6XA 2OBQA 2Z9KA 2KV8A 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 2EGNA 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 5HFEA 3R69A 2CN0H 4INLA 1EJNA 2KG2A 5GNDA 3TGJE 2K1QA 2H9EH 4X1NU 2EEJA 1O0DH 1FV9A 1K1IA 1QL7A 2BYAX 1UEPA 1TB6H 2QG1A 1YM0A 1SOTA 1C1NA 1S6FA 2C93B 2OQ5A 2GTBA 2NWNA 1DICA 3RLYH 1MD7A 4AORA 1L0ZA 1THSH 3E90B 2OP9A 4PROA 1O2OA 3O8CA 1OWEA 3KIDU 2K1ZA 1MQ5A 2I0LA 2VJ1A 1SGFA 3V13A 1Q2WA 3URCA 1G2LA 2GT7A 1LMWB 2AGGX 3LU9B 3HPMA 1TBQH 1IHJA 1Y7NA 2ZP0H 3DT0H 5EQQA 3MNBA 1C5ZB 1O2WA 1DLEA 1DY9A 4UFEH 4WY3A 2A4GA 5C17A 2FOEA 2R3UA 5J4QA 1AFEH 3LNXA 2B8OH 4Q6HA 1Z8JB 4AC9A 2JREA 5FPSA 1WG6A 1GBAA 5DTHA 4Q2KA 3RXTA 1Y3XA 1W0JD 3M3TA 1UJ1A 3VFEA 4BXSA 4E7NA 3CBXA 3ZVBA 2ZFPH 2TPIZ 1XXFA 3ID3A 2DB5A 3SW2B 1L4ZA 2J34A 1L6OA 1YLDA 1YP9A 1FJSA 1FZZA 4X0WU 3B8JA 3GY2A 3AAVA 2GZVA 1OYTH 3RXEA 1HPGA 2VWNA 1FN8A 1O3IA 2C90B 1ZGVA 2QF5A 2KPLA 1S81A 4P2AB 5DKMA 1J9CH 3JZ2B 4O3TA 7KMEH 3TSWA 2VVVA 4Q63A 1H9HE 2GV6A 1TGNA 5GLJA 1YBOA 2KOMA 2OSGA 1G37A 1TPSA 2ZHEH 3M3SA 2A32A 2NU1E 1ZMNA 1UM1A 3IWMA 1KY9A 5C94A 1KDQB 1O5DH 1OOKB 3MU4A 2ZPRA 4WXIA 2F83A 2A5AA 3D49H 1P0SH 3NCVA 3KL6A 3MNCA 1VAEA 4X8SH 3A8DA 1YPJH 1P10A 2RA0A 4F55A 1CBWB 2P8OC 2L6OA 5EXLA 4A92A 1DX5M 3S0NA 2W7RA 3QUMP 2A45B 4FVDA 3T62A 1BHXB 1BMMH 2OGPA 1KYNA 1CT2E 2TIOA 4I8HA 1W9OA 1P3CA 1CA0B 1O5AB 1QB9A 2ZZUH 1FONA 1O5BB 1WV7H 2PGBB 1C9PA 2H9HA 2AERH 3F1SB 3QGJA 1IQNA 5B6OA 2W3KA 1V2KT 5HM2A 2DAZA 3GISB 2RDEA 4MPWA 2EAQA 2D92A 2Q6DA 4U32A 1VGCB 2BD2A 2ZTXA 1HAYB 5F67A 3OU0A 3FVFB 4NIWA 1DXWA 5B6LA 4FUJA 4JCNA 2D26C 4DIHH 2PR3A 1O38A 1YWUA 1Y5BT 2IWPA 3CC0A 5GWZA 4E05H 3DORA 5HMAA 4NWLA 4K2YA 3TNTA 1V2OT 2VGCB 5FCRA 1JXPA 4KFVA 1TLDA 4AYVB 2FXRA 1UM7A 2V3OH 1UTMA 4MNWA 4FUGA 4HZHA 1QBOA 2BDIA 4OGYA 3L33A 2FS8A 1QB1A 1GHYH 2O8MA 1QZ8A 1BTZA 3M3VA 3EE7A 4YOIA 3SOSA 3MMGA 4B1TA 4ZCNA 3V7TA 1QJ1B 4TWWA 1SOZA 2I4SA 4NNMA 1H8DH 3Q3YA 3SI4H 1NRQH 4O06A 3RXOA 4CR9A 2W5EA 2XC5A 3RUOA 1MTVA 5HFBA 2Z9IA 4I8JA 2WV4A 3RC5A 5JXBA 3H7OA 1UVTH 4X2YA 2JH6D 5C2ZA 1MKXK 1W9EA 1P57B 1O30A 2VVCA 3LC3A 4YDPA 2XBYA 4GCHF 5HEYA 3L3TA 3KQEA 1P03A 3WY8A 2BOHB 4P0CA 1UK3A 4DT4A 5A2PA 2VNTA 4B2BA 2LNCA 2UUJB 3E6PH 1DDJA 2JJ1D 4K75A 1GG6B 3KNXA 2VINA 2EDZA 1J14A 3MO3A 1C2HA 4JYVH 3B76A 4WMDA 3SNDA 5F03A 3SHWA 2FDAA 4ESTE 2ZQ1A 1QL9A 3F3BA 3WWBA 2P8OB 2LP6A 1TFXA 1K1LA 2I6QA 1FAKH 3C27B 4KELA 1KXEA 5A2MH 1YPGH 1EJMA 4NXQA 1GJCB 4NWKA 1JIMA 4DOQA 3RXAA 3SYJA 3H7TA 2FTMA 4ZXXH 1AB9C 1C5LH 2STAE 1W3CA 3H09A 1W11U 5DPAA 1J15A 1AVXA 6CHAB 1ELBA 4P02A 1X9ZA 4X6NA 5HKKD 1QFKH 1Y3WA 2AMDA 5EXNA 3GICB 3UREA 1PYTD 3LJJA 3QE1A 1LVBA 1ZRKA 1XX9A 3QGLA 2GZ7A 3MU5A 1QAVB 2M10A 3ATIA 3P70B 3QDZB 4JYUH 1AZZA 2PFEA 1FC7A 1UW7A 4XRNA 1JBUH 1P2JA 1ANEA 1GBMA 2SGDE 3TJUA 1BT7A 4Y8ZA 1ELTA 1EZXC 5E6PB 4GVCA 1OWJA 1DT2A 4F48B 4NCYA 1O3FA 1F0SA 2Z3EA 1GGDB 2EGOA 1ABJH 1YPKH 2K8IA 3MO6A 4YYXA 9LPRA 2WHXA 2ZGHA 3URDA 4VGCC 1BRAA 4KTUA 3SOEA 3F9HA 4IBLH 1CVWH 4CRBA 1G3DA 1FC9A 4GVUA 2HNTF 3PRDA 4NNLA 2B7DH 3RXLA 1TBRH 4Q7ZA 2W7SA 7GCHG 3F0OA 2J4IA 4B2CA 1P02A 1GHAG 1TMBH 4FUFA 1DFPA 1C5TA 1BMFD 1HAIH 1A5IA 4ZAEA 1A3EH 3MU1A 2XBXA 3TU7H 4ABJA 3LC5A 1DUAA 1SGTA 2QKUA 5L2YH 3SGAE 2KCYA 2QV1A 3I4WA 3ZZCA 3M61U 1IQMA 4HOPB 5I7ZA 4IC6A 2VIVA 2W6JD 1SKYE 5E2PA 1N7FA 2AIPA 1F5LA 3MNSA 2O9QA 3Q3XA 1SLVB 1TWXB 5T6DA 3DFJA 3ZZ3A 2JH5D 1UEZA 2JILA 1C1UH 4NA7A 3GDUA 2FCFA 3KDKA 1C2FA 2BQ6B 3RC4A 1G9OA 2FS9A 1TQ3A 1VCWA 1EPTA 1WHAA 1SBWA 2UWLA 4OS6A 1BDAA 1LHEH 2OINA 5CMXH 4WMFA 2Z6BD 1C4V2 3TSZA 3GCTF 2OQSA 1IHSH 2R2MB 3DSPA 2KJKA 1CSOE 1HJ9A 1TONA 1SGIB 2ZPQA 1SGPE 1C2MA 1XM1A 2SGQE 3ZZDA 2Y82A 1U37A 2VIOA 1KSNA 1W0ZU 5HF4A 1GL0E 2A5KA 1C1QA 1LDTT 3N7DA 3RMNH 1XZ9A 4BTIB 4B6FA 2RDLA 3BEIB 3SU4A 3TLOA 2TGDA 1ZJKA 2PKSC 4ZMAH 1S85A 5C5OA 2J95A 2UWPA 5C67A 4I8KA 1C1WH 1MUEB 2F9PA 1MKWK 2IJD1 3NXPA 5HIZA 1OWDA 1U6QA 1Q3OA 4XSKU 3U8RH 2G51A 3RXJA 3WWFA 1V2LT 2L74A 4DURA 1P05A 2WPMS 1NFWA 1SB1H 2FX6A 3U1IB 3MQKC 3SUGA 4BNRA 4WYTA 2ZO3H 3P8FA 4BXWA 5DP5A 2ZFTA 2FESH 7LPRA 1DOJA 1EPTB 2PA1A 4ISLA 4HFPB 5I25A 1AQ7A 1HAVA 1MABB 1OBZA 1THPB 1HDTH 2JJ2D 1ANBA 1YGCH 1E1QD 2G5VA 3N99A 1VCQA 5A0AE 1V6DA 1MU8B 3RXDA 3PMHB 4KKDA 1WIFA 3L4FD 3NPSA 1A0JA 3MH4A 1N6XA 1IU0A 2GT8A 4Q2NA 3SQHE 4BOHA 3T25A 2WPDD 4E06H 3FOAA 3HGPA 2P94A 5B42A 2ANYA 4DY7B 1OP0A 1TNGA 3BTFE 1PPCE 1D5GA 2ZF0H 3OAAD 2PTCE 5DP3A 2STBE 2H3MA 1C5OH 2BY6X 3ZZAA 1GHBF 1GHAF 2HWLB 1AUJA 3RXVA 1DLKB 1GJDB 3CENA 2BY9X 2BDAA 1OWKA 2PSXA 2YMSC 3HKIB 5EG4A 2WINI 1FAXA 1GVLA 2Z3CA 5G1DA 2BHGA 4U01A 3K82A 1IHTH 4PQWA 2BVSH 1GVKB 1HCGA 3Q3KA 1A5GH 1PPFE 3BF6H 1S5SA 2VVUA 1W9QA 1OKXA 2Z7FE 3TH3H 1L4DA 1AFQB 1ZHPA 2BDHA 4GAWA 2JH0D 4X8TH 2BVXH 2WPJS 1V2JT 8ESTE 4DCDA 1GHVH 5DP8A 3A82A 1AUTC 3ID4A 4OS2A 1Y8TA 1HLTH 1V1TA 2BDYA 1FDPA 1TNKA 2KQFA 1F92A 1E36B 3LGTA 5A0BA 2H5CA 2H2BA 2A5IA 2QXIA 2E7KA 4UFFH 1BRCE 2C8XB 4YM9A 1P09A 2V3HH 3CP7A 1ZYOA 4I31A 1QB6A 4A1VA 1O3BA 3SBKA 1ARCA 1U38A 3HATH 1TGSZ 4YLQH 1LPZB 1T4UH 2LOBA 3NZIA 2CV3A 1BBRE 3E0PB 4L8NA 3ATMA 1V2QT 4UU5A 2ZHFH 5EJZA 1O3HA 4JOFA 2ANWA 2H2ZA 4TSFD 5DO4H 2ZGJA 1NC6A 4XDEA 2ZKSA 1AD8H 1KMHB 1HAXB 1D9IA 3M7UA 2VWRA 4I86A 5DP4A 3F2HA 3RXIA 1O37A 1GBCA 1O2LA 5HDYA 3A86A 3UUZA 4A1TA 1GMHG 1NM6A 1JRTA 1W0KD 2QCYA 4ZH8A 5EPYA 2GDEH 4IN1A 4JYTA 5LPFA 3GOVB 4WYUA 3ZIAD 3ZVGA 1MTUA 1TMTH 3HGNA 4BAOB 2M0UA 1FX0B 1WTHD 4X2XA 1N6DA 2O8UA 2W26A 2FEQH 3UTUH 1MAYA 3SV2H 3O8RA 3ODDA 2TRMA 3LIWA 4P00A 2EXGA 4JMYA 2A0QB 5C1UA 2BLOA 2KX4A 1BJVA 1BFEA 3PLBA 1B5GH 2RCEA 1O3AA 1E37B 1B8QA 3RXMA 3QTVH 4Q80A 3KYGA 5CE1A 2GCHF 3VPKA 1UK4A 3E0NB 4Y8YA 4NG9H 2Y80A 1C5WB 1MH0A 2FZZA 3TGKE 1X7AC 1P1DA 1E35B 1D3DB 5FPYA 2KJPA 1EUFA 4BANB 3SJIA 4O3UA 1S83A 4NXRA 1EZQA 3LJOA 2JSNA 4MPUA 4AX9H 2BTCE 1GHZA 2RG3A 1O2ZA 2ZU5A 1CHGA 5E2OA 1HAVB 2KRGA 2HLDD 4ZUHA 2VB0A 1HXFH 4K1EA 1WQVH 1O2QA 2J98B 1HAGE 1X45A 2EDPA 3FP7E 2YNBA 2ZWLH 3EYDA 1GBIA 3RXSA 3O8BA 3KEEA 2G81E 3MOCA 1SC8U 4MNXA 2AMQA 1ZLRA 4Y0YE 3PDZA 4NMSA 1PPZA 3VQFA 2WV5A 3LH1A 1K22H 1BBRH 2ZCLP 1UCYH 4ZKNU 1OBXA 4OM9A 1AWFH 2JIKA 3S9AA 3SU5A 1PQAA 1VITG 1XUFA 4TY7A 3WKLA 3UOPA 1JWTA 5ILBA 1DWDH 3SU6A 2IPQX 1P2OA 1KLTA 1C4U2 1GJAB 1I16A 1ZSLA 3SJ9A 1T8LA 5CDFE 3RL7A 4CHAB 2PKTA 1U39A 1MTSA 1OWIA 4KTCA 3LPRA 1NESE 1OPHB 2H2CA 1QIXB 2Q9VA 4ABHA 3SU3A 5JBTA 2ODYB 1QCPA 2ENOA 1MBMA 4ZXYH 1FNIA 1ELDE 3RMLH 2V1WA 1V2VT 2J98A 4K8YA 1QL8A 1RTKA 1GJ4H 4J2YB 3QN7A 2M0TA 2FI3E 2O2TA 2HLCA 4RN6A 1ACBE 1SQOA 2FNEA 4Y8XA 3TGIE 2AFQB 1VJ6A 3LH3A 2Y6TA 2OD3B 2KAWA 3BTWE 1WH1A 3SHCH 2A2QH 4AFQA 4E7RG 4K8BA 1TRNA 2PKSB 1DITH 1EAWA 2XCNA 2FYQA 1BOQA 2XYAA 1NY22 1T7CA 1C5VA 1CT4E 5G1EA 1P2NA 3SV8A 5C1YA 2CMYA 5HFDA 5TJXA 4JZFH 1SSXA 1TX7A 2FI4E 2PZDA 2G00A 1BJUA 1XUIA 5DP7A 4TY6A 3ZZ6A 2ZDLA 4UFGH 2SGAA 1GMDG 1B0EA 4JJ0A 1ZTJA 1UTOA 1FY8E 3GYLB 1QRWA 1D3TB 1C1VH 1FQ3A 2ZGCA 1KXBA 2D8WA 3B9FH 3R0FA 1YCPH 1LHDH 1ZPBA 1KXCA 1QQUA 1ZHMA 2ESTE 3RDZA 3Q00A 1EXFA 3AAUA 2OC1A 5EJLA 3SNEA 2BVRH 1O3EA 5DG6A 1K21H 3O46A 1Z6EA 3KZEA 3CBZA 1MMJN 4ABFA 1FY5A 2BD8A 1GCTB 1OZIA 2BXTH 2GV7A 2F9UA 3SUZA 4FUBA 4KGAA 3VB4A 2PKUA 2WZQA 2O8WA 4IMZA 3BTDE 3GCHC 1XUKA 4I8GA 2G5MB 1C2EA 5IK2D 3PLPA 1SQRA 1UCYK 2BM2A 3LNYA 3RL8A 3W94A 4OS5A 1GQ5A 1HFDA 4GLYA 1LVOA 1G36A 5LGOA 4SGAE 4ZKOU 3PROA 1V6BA 1NFUA 5HEBA 1Y59T 3BTQE 1SGEE 5T6FA 4HG6A 5CHAC 3CS0A 1GWAA 3PS4A 3ATWA 4FLNA 3ELAH 1C5SA 3F9GA 1O3MA 1NZQH 1A7SA 3KQDA 4Y7AA 2EV8A 3MU0A 1QGFA 3PM3A 1ID5H 1GJ7B 2FOGA 2EHRA 1GL1A 1A2CH 3OTJE 3UB0A 3VXEH 1YPHE 1PPEE 1FC6A 5GPIB 2KOHA 3PMJA 4ZKSU 4ASHA 3A88A 3HPTB 1TE0A 1C5QA 4F4OC 3UWIA 1L1GA 4K69A 2J92A 1HAHH 2J94A 2Q3GA 1TNLA 1YYY1 2ZFRH 4FXGH 3RMMH 2BD7A 3UAIC 1P06A 6CHAC 3E16B 1SQTA 1C1RA 1N7TA 2OZFA 2TGPZ 4X1RU 2VSVA 1NRSH 3E8LA 3QLPH 1GMHF 1IQJA 1P1EA 2AWWA 3QO6A 1W10U 2ALVA 3I78A 1AVGH 1FY3A 3QIKA 1UVSH 2GX4A 5L30H 4K60A 2UUYA 4TPIZ 3RM2H 1DM4B 1O3OA 1HIAA 4MQAA 5EJ1A 4ABGA 1GDNA 1AO5A 5F53A 2OTVA 1SFIA 1ESTA 4FUDA 1QURH 3JZ1B 2XW9A 1RZXA 1L1JA 2KCOA 4DIIH 5GCHF 2R2WU 4LZ1H 1Z6JH 3KZDA 2FOFA 2QF0A 2H5DA 2WPKS 3AASA 1WJLA 2IWQA 5C3NA 4Q4LA 1GJBB 1GG6C 1V2WT 3RXCA 3K9XB 4JK5A 2KCAA 1GBEA 2VU8E 3SJOA 1UF1A 2KPKA 1SFQB 1CGJE 2HPPH 3SU1A 2GCTB 1RIWC 5EIYA 1BBRK 3P92A 3M35A 1FN6A 1QR3E 2BD3A 4HI3A 4WJG2 1E34B 3A89A 3R3GB 1EX3A 4U30A 2J97A 2ZCHP 3TVJB 1RJXB 3AVZA 3KGPA 2EI7A 3A7VA 2FOCA 3DIWA 2I0IA 1K0HA 1SGDE 2KZ4A 4OEOA 2EI6A 1NRNH 2BLVA 5FPTA 1Y5UT 1Z8RA 1BTPA 1C5YB 1C1PA 3M36A 4RSPA 1NU7B 1S84A 5FHTA 2HE2A 5FB8C 2EC9H 2QN5T 1C1TA 1SGQE 1T32A 3EAJA 1EOJA 3LGWA 2DKRA 1DWCH 1E1RD 4AG1A 1FMGA 5EOKA 2YT7A 1LKAA 2A7CA 1CGHA 1N6EA 2JETC 3RU4T 1K28D 2R0KA 1C2IA 2XBWA 2EI8A 1Y5AT 2WUBA 3KDGA 4F8KA 1LPGB 3BPUA 2GP9B 1RFNA 4MPXA 4JL7A 1Z87A 1TAWA 3A7ZA 1NRPH 2FI5E 1GMCG 1K9OE 4WMEA 3SUFA 1GDQA 1S0QA 3QDOA 3RXUA 4BAKB 4CRFA 1ZTKA 1AB9B 2XWAA 3SV9A 1W0YH 4TT3D 4JZDH 2KA9A 2JXOA 1AFQC 1BQYA 1GJ8B 1TPPA 2XBVA 2HVXA 1EOLA 5T1VA 2Z3DA 2JWEA 3FY5A 1H4WA 2KFWA 1IQHA 1G9IE 4NZLA 3S9CA 1K1JA 1MKWH 4H11A 2ZU2A 3FZZA 1NBME 3BTME 3P8GA 3WKMA 2PGQB 3KQ5A 1BITA 2Z17A 2QAAA 3HKJB 3LGIA 2O8LA 4Q6SA 2BD4A 3ID1A 5ETXA 4WH6A 4I8LA 2HGAA 4YZUA 4GVDA 1W14U 2B9LA 3UQVA 1O2SA 1HJAC 1RTFB 4HOPA 4AFSA 3ITIA 2LC6A 3AW0A 3U8OH 3SNAA 2QKTA 4NA9H 2WSSD 2QBWA 1WTGH 4LMMA 3S69A 2PDZA 1F0RA 4CBNA 4AZ2B 2GDDA 1IQKA 2XRCA 1CA8B 4OS7A 1CBWC 2ZHWH 3M5MA 3R0HA 1RTLA 2PW8H 3TPIZ 1QQ4A 4AN7A 5H3JA 2FMJA 5AFZH 3M5NA 4KP0A 5A09A 1WBGB 1GMCF 2SNWA 7ESTE 2HGTH 2FOBA 1AHTH 5HM9A 1WFVA 2IN2A 3UQOA 1P2QA 1V2RT 3QJMA 6GCHG 3F6UH 3A7WA 3QZRA 1YY3A 5FBEA 4O9VA 1K2I1 3V12A 3P8NA 4B2AA 1EZSC 2C8ZB 1O3CA 4K3JA 1HNEE 3U69H 1O3JA 1LVMA 1Z7KA 1QAVA 2BY8X 3A87A 2Y5GA 3PLKA 5LH8A 3BTHE 4JOPA 1DY8A 2DC2A 1SLUB 3KQCA 1KEFA 1YCPM 4AOQA 3MWIU 2CS5A 2OS6A 1V2ST 5EZ0A 3PMAB 1B0FA 3ATLA 5DGJA 5HFFA 1CGIE 3O5NA 4E3BA 2OC7A 3SJ8A 2P93A 2TGTA 2ANMH 5KGOA 2ZG0H 1OXGA 4X8VH 1LHCH 3DJ1A 1PFXC 3DJAA 2MHOA 4JOHA 1AWHB 1BMLA 2JINA 2ODQA 3IG6B 5IL9A 1IU2A 4WH8A 5HEDA 4NMQA 1MCVA 1TGCA 3GY7A 5EODA 3SUEA 1TOCB 1BTUA 3GY4A 2KYLA 2SGFE 3MHWU 3W95A 3PV5A 1DE7H 3LOXA 5JBBS 3ZVEA 2LPRA 1W2KH 1FY1A 2V90A 1RGQA 4ISHH 1MTWA 3IITA 1UTLM 3MH7A 4OAJA 1J8AA 3H5CB 2PWXA 4UD9H 7GCHF 1NN6A 4JK6A 3K6YA 3SU2A 2GZ9A 3PO1C 4Q3HA 4BAQB 1J17T 3K50A 3B23B 1GI0A 3ZZ7A 1MFLA 2OC8A 1ARBA 2CHAB 3ZV8A 3NUMA 1SHYA 2K20A 2NU2E 1P12E 4XE4A 4MNVA 3Q76A 1IOEA 1O34A 2PKAB 1V5LA 4KTSA 3A8CA 1SLWB 1V2TT 2DE9A 4JZ1A 1DXPA 3A84A 5BRRE 1A1RA 2YNAA 2GMTC 1VKYA 4INKA 1RGWA 2BZAA 3RP2A 1V3XA 4JZIA 2R9PA 3DHKH 1LQEA 2EJYA 1UCYE 2VH6A 4WXVA 4UEHH 3F9FA 1ZUBA 1OS8A 1VJ9U 1DS2E 1S0RA 5DSFA 1C9TA 4MPVA 2ZU3A 1O2GH 1N7EA 4DJZB 3PRBA 1YPMH 1ZMJA 1EATA 4JOJA 2IPHA 3TK6A 1MBQA 4NMVA 1UITA 4I32A 3PV2A 4UU6A 5JPMH 3NK8A 1NPMA 4B76A 1JMOH 4XBBA 4A1XA 1Y3YA 2D8IA 1Z8IB 3GY8A 3VB7A 3OTPA 2K0QA 2ZDAH 3SV6A 4Q2OA 2QY0B 1SPJA 4X2VA 1SR5C 2KM0A 5EU8A 5H4IB 2ZDVH 1O5EH 1WOFA 1N6FA 3I1EA 5EPNA 3OEHD 4EDJA 3SQEE 1UHBB 2ZDKA 1H8HD 1ZPZA 4NFFA 3PYHA 1GDUA 2BD5A 4M9FA 4R0IA 3RXBA 3A7YA 2VWOA 4X1SU 1N8OC 2CF8H 2HRVA 3QTOH 2QYIA 1Q7XA 3STIA 1MTNC 3GYMA 1GBJA 2MX6A 4YOJA 1QNJA 4NFEA 1TP3A 1EZUC 1C2GA 3OSYA 1UVPA 2QGRA 5AVDA 5GXPA 1F0TA 2KR7A 2VGCC 1BTYA 3BG8A 1MZAA 4JOGA 2QA9E 3LONA 1YCPK 1BZXE 3E3TA 4H6SB 2I6SA 4YO9A 1C2JA 3ZVCA 5G4BA 1F2SE 2J5UA 4K72A 1WHDA 2Y5FA 5KECA 4XBDA 1O5CB 3SZEA 4TYDA 1DPOA 2AS9A 4Y6DA 3SHAH 1V5QA 3TSVA 3OFND 5FBIA 5FL7D 2F91A 4R2ZA 2EA3A 1NFXA 2XTTB 4QT8C 3UFAA 1GJ9B 4Y0ZE 4D7FA 4CH8B 2G2LA 4MNYA 1H9IE 2UUKB 4AMHA 1GBBA 3FN8A 2Q6GA 2RCZA 1FPHH 3AXAA 3K1RA 5ABWA 2ASUB 1BMNH 3FP6E 5BPEA 4NMPA 1ZRBA 3RXRA 1AE8H 5EQSA 1ELVA 3KYFA 5E21A 2GD4B 3M5LA 1FIWA 1GGDC 2GGVB 2KL1A 3GY3A 2WYGA 3D62A 3ZZ8A 5JYIA 4REYA 2ZTYA 4ZHMU 4THNH 4I33A 2QXJA 2ZHQH 2L4TA 1WU1A 4MVNA 2QF4A 4ABAA 4ISNA 2BLQA 2OCVB 2A4QA 2Z94A 4TWYA 3PMBB 5F6MA 2L97A 2PP6A 4WVPE 4BTTB 5C5NA 2AH4X 3A85A 3R68A 1A3BH 4ABEA 4AFZA 1X6DA 1QBVH 3GY6A 1C2KA 1YKTA 1YBWA 3QWCH 2F9NA 3GY5A 4NMOA 3ODFA 4GUXA 4U2WA 1W8BH 1ANDA 2AIQA 2ZGXH 1WUNH 1GI7B 1KLIH 1O32A 2KOJA 3DUXH 1C5PA 3P95A 1O3PB 5JBCS 4FUHA 4NSVA 2R3YA 4J1YA 4NIYA 3BTEE 1EJAA 1UO6A 4Z6AH 1GJ6A 3DSGA 4Q7YA 5EQRA 5F8ZA 1MFGA 4NIXA 3SORA 3UR9A 1QA0A 1EP5A 3FAOA 2F9OA 1NO9H 4FOUC 3E1XB 1P9UA 4OEPA 2PHBA 2I6VA 1TNHA 1O31A 3BTKE 2F9BH 1A5HA 2BY5X 1N99A 1GBLA 3GABA 1H8ED 2KJDA 1GI1A 2AMPA 2CF9H 4H6TA 1HAPH 2EEKA 5HXFA 1O2MA 1S82A 4F49A 1MTNB 3F2FA 3MH6A 1D6RA 3I29A 5HYOA 3F9EA 1TRYA 1ETRH 3PO1B 2WUCA 2F4LA 4XD7D 4ACBA 1LHGH 4RT1A 1T2MA 1SGCA 2FE5A 1K32A 1GCDA 2H1UA 2NU3E 2JOAA 2F43B 1CO7E 1VCPA 1SI5H 1AZ8A 1TX8A 3SJKA 2J38A 3KHFA 2VIDA 1GI6A 3DD2H 2D90A 1BHXF 2ZU4A 4LK4A 2VRFA 3TITA 2SGEE 1P8VC 4CREA 3PDVA 2GKVE 4K1SA 1THRH 1WF8A 1SLXB 4OGXA 1UEWA 2Y81A 4Z0KA 3EDXB 1ELCA 1XVMA 2R0LA 2VWLA 2PNTA 1GJ5H 3EA7A 4GCHG 2M0VA 1CT0E 3VG8A 3NWUA 2FOAA 3QZQA 2VIWA 4ZHLU 1HAZB 3LT3A 1OX1A 5A0CA 3V0XA 4MPAA 1LKBA 3RU4D 3RXGA 3TK9A 1BCUH 1TP5A 3SU0A 3CYYA 1KXAA 2BX3A 2A31A 3AK5A 1DANH 5JBAS 2HNTC 4JORA 2F5YA 1LTOA 1G3EA 3CBYA 4UFDH 4Y71A 4AB8A 5HIYA 2FYRA 1E38B 2W4FA 1QLCA 1T8MA 1TOMH 3MNXA 2ZNKH 1AKSB 2GCTC 2A4RA 1WFGA 2FX4A 2P95A 2W7UA 4AGKA 3EQ0H 1QHRB 2J2UA 4JOEA 3DA9B 3RC6A 1SGNE 3N7OA 3ID2A 2A7JA 1U3BA 3T2NA 2QF3A 2FLBH 1E79D 5FXLA 1O2UA 3S7HB 1CA0C 3BSQA 1XUGA 5EXMA 1F7ZA 3ZYEA 4X6PA 1P04A 2WYJA 1W13U 1VITH 1MU6B 2BDCA 2THFB 3P6ZB 4NZQA 2I1NA 1XVOA 2CHAC 2QXHA 1C5NH 2IWOA 5HGGA 1UJDA 3GJ9A 5E11A 1A0HB 3EE0B 1FUJA 3SHUA 1O39A 2KAIA 5C20A 1HUTH 4X1PU 4AG2A 3TJOA 1G2MA 2EY4C 4A6LA 2GCHG 5L6NH 1TX6A 2BDBA 4D7GA 4O03A 1O2PA 2PV9B 2ZDNA 4ZKRU 4GHTA 3TNSA 2FN5A 3PWCA 4FU9A 1ZSJA 3ZVFA 4ABIA 3EGKH 1QAUA 1A4WH 4YTAA 1HAOH 1TBZH 1LO6A 3U9AH 2JDID 5K0HA 1F0UA 1ZR0A 3SV7A 2SNVA 2CXVA 1G3BA 2BDGA 2VH0A 2DJTA 1F5KU 1H1BA 1UTKA 3A8BA 4CRGA 1OSSA 1GBHA 2RFKC 1EAUA 1PYTC 3GS9A 1ETTH 1D4PB 4B71A 2EDVA 4Z1MD 2EEIA 1C1MA 2A7HA 2G4UA 1KIGH 1O3NA 1AU8A 2VWMA 4LXBH 4VGCB 1D3QB 2UUFB 4IGDA 4FUEA 2HALA 4I7YH 3P17H 4Y7BA 1P11E 5K7RA 1FLEE 4X2WA 4DVAU 1M9UA 2OQUA 3DFLA 5HJ1A 5LPRA 1GVZA 3NCLA 4OS1A 2YMSD 3VGCC 1EP6A 1IQGA 5F3XA 3PV4A 3FANA 1Z1JA 4NGAH 4ASUD 4YESB 1Q3XA 1EB2A 1HXEH 2Y7XA 1P2IA 3A7XA 1A46H 3UNRA 2ZPSA 1EKBB 3RXKA 3ZZ4A 1GBDA 2TBSA 1LVYA 4D76A 1SVPA 2IWNA 4FU7A 1T8OA 1O36A 1SQAA 1Z1IA 2D1JA 3MU8A 4CRAA 5EW2H 4AB9A 1T31A 1PDRA 1QBNA 2Y5HA 1XUHA 1HIAB 2ANKH 4FU8A 4CR5A 2NU4E 2EEHA 2P3WA 3HPKA 2BMGB 3DSOA 2SGPE 2F9VA 1FCFA 1OBYA 1AGJA 2YUBA 3KF2A 2QKVA 6GCHF 3ZZ5A 1VA8A 2I04A 3UIRA 2BX4A 2AINA 1AMHA 1YPHC 1X5QA 4RI0A 1NTEA 4A5TS 4IMQA 2FM2A 4FVBA 4XBCA 4H4FA 3BV9B 3CNRA 1I92A 2VPHA 1C2LA 2BQWB 2O8TA 3BG4B 1TNJA 3MYWA 2VBCA 3M7TA 2GJGA 1ZTLA 5TCCA 3OYPA 4Q2QA 1KXFA 1HGTH 1NTPA 2QT5A 2XC4A 1CHOG 4NMTA 2HOBA 1YLCA 1UTQA 4JJ3A 4UDWH 3M7QA 1VITF 4GHNA 1A61H 2P3FH 1QJ6B 2FODA 1GI2A 3UNSA 4Y76A 4NA8A 1TA2A 2B0FA 2FP7B 1GI4A 1INCA 1K1OA 5L2ZH 4CRDA 2H9TH 2PUQH 2XC0A 1ANCA 1WXRA 5DK1A 1UTJA 3KQBA 3SFJA 2V6NA 6ESTA 3T26A 1XUJA 1DWEH 4K78A 1MC7A 4NSYA 4D9RA 4INHA 5C0TA 1NF3C 3ENSB 4TPYA 5FCKA 1PPBH 1FIZA 1LQDB 2ZA5A 1FI8A 3LGVA 5SGAE 1IAUA 1O33A 2AGIX 2C3SA 2KCPA 2ZPMA 1ESBA 2BB4A 1P2MA 1WI2A 2FOHA 2SFAA 2P3TB 1QRZA 2VIPA 1VJAU 2P3UB 1O3GA 5CHAB 1YPLH 1SGYE 1O2RA 6LPRA 3K2UA 1TPOA 4YLUA 1QA7A 1TPAE 4O97A 3GSLA 1UVOA 1MD8A 2XWBI 3ESTA 5DP9A 1M5ZA 2F3CE 1HJAB 1HBTH 2OC0A 3D23A 1MZDA 3EGGC 1EAIA 1RS0A 4AYYB 1NROH 1C4Y2 1BB0B 1JRSA 1BA8B 1PJPA 1VGCC 3PWBA 4ISOA 3TH4H 1O5GH 4SGBE 2OMJA 3BN9A 1AE5A 5I46H 3TH2H 2OCSA 1BTWA 1GCTC 2XNDD 2ZQ2A 1O3DA 1WYKA 1X5NA 1O5FH 2V7QD 5AHGH 3ZZ9A 1O2YA 3UNQA 5J4SA 2R4HA 5D13A 3ATKA 1ELAA 3QJNA 3N7EA 1XMNB 1TGBA 1XKAC 1GQ4A 2VSPA 2GVFA 3RLWH 1WDIA 1PPGE 2Z9LA 1DUEA 3A81A 2DLSA 3OEED 2JETB 2ZPLA 1GBKA 1RXPA 5JB9S 3LKWA 2DMZA 4K76A 2XCFA 1GI9B 2WPIS 1UJVA 1E0FD 3S9BA 1TGTA 1BIOA 1G3CA 1KLJH 3U8TH 4G69A 4ACAA 2M0ZA 1UJUA 1HB0B 5PTPA 5A8XA 1ELFA 2XOKD 1TALA 2L4SA 1O2VA 1RD3B 3T27A 3A8AA 4ZROA 1NT1A 1KTTB 3SGBE 3OE7D 1V62A 2FO9A 5A8ZA 3A83A 3UOUA 1WSSH 4KFWA 1SMFE 3QX5H 1SHHB 1RGRA 3SI3H 1UFXA 5C0UA 2BXUH 2F0AA 2JKHA 1NRRH 1O2HA 4ABBA 4A7IB 3VXFH 2GZ8A 2OXSA 1VR1H 1DSTA 5E22A 3VEQB 3RXPA 4X6OA 2HNTE 1OP8A 1IQEA 1NS3A 5T3HA 4AGJA 1BUIA 3FZDA 4ABDA 2AWXA 3BIVH 1TNIA 1TIOA 2ZC9H 1YC0A 2C4FH 2J9NA 2YTWA 1COWD 4B73A 1GHWH 5HETA 2EEGA 2W3IA 4JOKA 4JZEH 1UHBA 2PSYA 2AWUA 1ESAA 3A7TA 1PQ5A 1WCZA 3ZV9A 1C5XB 1X8SA 1V2MT 2AYWA 2DM8A 1GI8B 4E35A 1ETSH 2G52A 3UPEA 2OPGA 3EGHC 1FPCH 2Z9GA 1ZGIA 3DJ3A 1TRMA 1GM1A 1KXDA 5E0JA 2BQ7B 2A4OA 1C1SA 1CHOF 3QK1A 3UR6A 8GCHG 3L6PA 4ZHAA 4CBOA 3E91A 4K5ZA 3CS7A 2BY7X 4Y10E 1XKBC 2HVYB 2JIZD 1GPZA 3BTGE 1AVWA 3NRLA 3FP8E 2LC7A 3NGHA 1W7XH 5HF1A 1WQSA 2NU0E 4XOJA 1BTXA 1MCTA 1UEQA 5E8EH 3GGEA 1PPHE 1AKSA 4LZ4B 2WL7A 4M7GA 3D65E 3AW1A 2V3MA 1P2KA 3NFLA 2FTLE 1V2NT 2AGEX 3O8DA 3TK5A 3SN8A 2WPLS 5KEDA 2XNIA 1K1NA 2WPHS 4HTCH 4WWYA 1UMAH 3GCOA 4BAMB 2A2XH 1CU1A 1OYQA 5E0HA 1JOUB 4Y79A 2AEIH 5HFCA 2Q6FA 1MKXH 1GHXH 1ZSKA 1GHBG 5DP6A 1BRUP 1EFRD 1NU9A 1T8NA 3F2GA 2ZI2H 1W7GH 4CH2B 4IW4E 2OLGA 3LGYA 1LCYA 4ISIH 1GMDF 3GCHB 3RMOH 2VIQA 3JXTA 2BYGA 1TQ0B 1UHPA 3V3MA 3I18A 1HYLA 5CHBA 5AF9H 1AY6H 3CH8A 2ZU1A 1AI8H 1KTSB 2ZIQH 2FPZA 1EASA 5E1YA 3GDSA 5EYZA 1EQ9A 2HPQH 4XFQA 1VB7A 2PLXA 2QE7D 3U1JB 5EGMA 1G30B 2H6MA 4Q7XA 2G5NA 4FGMA 3F68H 5DJ7A 1P01A 1C2DA 3BEFB 2ODPA 3TJNA 2Q1JA 1RRKA 1RIWB 1QJ7B 1AIXH 2QIQA 1UK2A 2W6ID 1NBMD 1KWAA 1WAYB 1MQ6A 2ZHDA 3ZRTA 1ZOKA 1C1OA 1LHFH 3HK6B 1L1NA 1TYNA 1YLNA 3T28A 2OK5A 2LUIA
chains in the Genus database with same CATH topology
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 1Q3PA 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 3NKKA 4XHVA 3ZYDA 4NXPA 3TMHA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 2KBSA 3PTNA 1Z86A 1O35A 3SUDA 3FFGA 1GBFA 1HJ8A 4Z33A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2VZ5A 2A1DB 2QC2A 4R8TB 2DLUA 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 2LA8A 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 3RLEA 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 2CSSA 3HK3B 2BOKA 1ORFA 2YT8A 1P9SA 3Q77A 5JB8S 1WI4A 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 1R6JA 3VB5A 1ZMLA 2RA3A 1C5UA 2H3LA 1IQFA 4DT7B 1D3PB 3UY9A 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 1X5RA 3MH5A 5GJ4B 2X7ZA 2YUYA 1CQQA 2UWOA 2ZCKP 3SNBA 1BE9A 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 4NMRA 1UTNA 1HRTH 3E17A 2GEFA 4GPGA 1ZJDA 2IOTA 2HE4A 4OS4A 3VB3A 5F8TA 1F5RA 5LPEA 3NFKA 1ZOMA 4RKOB 2CSJA 3RXQA 3S7KB 1RY4A 1Y3UA 1WF7A 1MAXA 3HVQC 1J16A 3K6ZA 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2DE8A 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 4Q2PA 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 3VQGA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 3STJA 1B7XB 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 4K6YA 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 2G8TA 5ESBA 2REYA 3ZVDA 2M3MA 4E34A 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 1Q31A 2RRMA 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 3GDVA 5E0GA 1TABE 3KCGH 1HV7A 4MLFB 2DUCA 2M5TA 4HGCA 3SNCA 3T5FH 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2EGKA 2UZCA 2FOMB 4WF8A 4Z8JA 4N6XA 2OBQA 2Z9KA 2KV8A 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 2EGNA 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 5HFEA