1LCYA

Crystal structure of the mitochondrial serine protease htra2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
320
structure length
296
Chain Sequence
PPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HtrA2 serine protease
publication title Structural insights into the pro-apoptotic function of mitochondrial serine protease HtrA2/Omi.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 296
sequence length 320
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1lcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA02
3BTQE 2JINA 4NMOA 3MNXA 4YOIA 1C5YB 1WUNH 4INLA 1WI2A 3UUZA 1OP2A 3U1JB 3ODFA 1UVSH 1V2KT 2VVUA 4GVCA 3UOPA 4X8TH 3FFGA 2HPPH 1NRSH 2FI5E 2GMTB 5HFBA 2NWNA 4BAHB 4X1SU 4E7NA 3SQEE 3QGNB 1O5EH 3GY3A 2WINI 2H3MA 2C3SA 2F5YA 1WU1A 1CQQA 1C2LA 1FMGA 4ZMAH 1P11E 2GZ8A 1RTKA 1Z8GA 4FUBA 3HK6B 1O3MA 4KTSA 3KN2A 3NPSA 7GCHG 4VGCC 1P12E 1LVOA 5GNDA 3RL8A 1N6DA 4NSVA 4TPYA 3MH4A 1NRPH 3P6ZB 1G3DA 3H7OA 4FVDA 1GVLA 2VIVA 3T29A 1ELBA 1SR5C 1PQ5A 2XBXA 3L4FD 4Y8XA 2B0FA 2J38A 2Z3CA 1L6OA 3LGVA 4BXWA 2STBE 1ANBA 3U8TH 1ANCA 2A4GA 4Q2OA 1LHGH 1ETSH 2ZCKP 3GCTF 4K2YA 3DJ1A 3K65B 3SU3A 2V6NA 4CR5A 2PLXA 2DC2A 2F9UA 2BDIA 1QBNA 4A7IB 1TBZH 3SN8A 3PTNA 1YBWA 2GCHF 3TSWA 3MMGA 1YLDA 2SNVA 4YOJA 1KEFA 1C5VA 3QGJA 4MVNA 2G55A 3TIUA 1UHPA 1ARBA 2ZGCA 2F3CE 2HLCA 2BX3A 5E8EH 2ZPLA 1P1EA 4X6NA 3MH7A 3A80A 2FX6A 1A3BH 2DE8A 1HPGA 5HFFA 3A87A 2KQFA 1GI6A 2I6SA 1PYTD 3K6YA 5L2ZH 4YM9A 3PDZA 1DWDH 2VZ5A 1GHBF 2G8TA 3DIWA 2STAE 4KTCA 2OZFA 4Q80A 2FOEA 1KXFA 2JETC 5F8TA 2Z3EA 3ZZ9A 1X45A 1WQVH 2BY7X 3SUGA 3F9HA 4INKA 1UJVA 1B0EA 3LIWA 5JYIA 1MMJN 4CH8B 2ODYB 3BTKE 3HK3B 1ZHRA 3MU4A 1ZGIA 4MG3A 3QZQA 1SLUB 3E0PB 2JWEA 3CENA 4NXQA 1K1OA 4GHTA 4OS5A 1Y5UT 1C4U2 2P3WA 5A2MH 5T6DA 4GSOA 5CHAB 2FS8A 1O2MA 2AINA 1IQLA 5TCCA 2I1NA 1XUGA 3SNBA 5JB8S 2OC8A 3G01A 1UVPA 2D90A 2XBWA 1YPGH 5FX5A 5E6PB 2KRGA 1Y3XA 1A5GH 3K82A 4WJG2 3TK6A 2ZTXA 4NIYA 3ZVAA 1VCWA 1H8IH 7KMEH 1HIAA 1P02A 5AF9H 2EDVA 3WY8A 2TGDA 2FZZA 3TK9A 1MKXH 1UHBB 2FNEA 2WPMS 1P3EA 1T8MA 3T62A 1WFVA 2BQWB 3RU4E 2QG1A 1G3CA 1UTOA 2BHGA 6CHAC 1J9CH 2O8MA 1QRXA 1Y8TA 1O2HA 4NIWA 2BVXH 2YNAA 2ZDNA 2MHOA 5HEBA 1OKXA 2YUBA 5CMXH 2BDBA 1CGHA 4ABEA 3U98H 3SI4H 4UFGH 3RXTA 3E91A 2ODQA 3QN7A 1FY1A 1FIWA 3H7TA 4Q2NA 4MPWA 2DB5A 1DSTA 3F9FA 3MI4A 1SQTA 3S69A 1Z1IA 3QIKA 1A0HB 1TGNA 1XM1A 3LH1A 3PMJA 5EQQA 3RU4D 4KFWA 1TPAE 4D7GA 2PTCE 1TX8A 1C1QA 4ZH8A 3MNBA 1K1JA 4PROA 1HB0B 1IOEA 1G36A 2VRFA 5DJ7A 5I25A 4ZAEA 2BOKA 5DKMA 4Q2PA 3GCOA 1GI2A 4K3JA 1O2TA 1ZSLA 5GPIB 4Z33A 5E1YA 1HXEH 2Y81A 1TALA 1V2VT 5HEDA 1BIOA 5JDUB 1WV7H 4WYUA 5FBEA 1VR1H 1YYY1 1UF1A 2J2UA 1UM1A 1D6WA 1P2JA 1HGTH 3PMAB 3TSVA 1WYKA 1Y5AT 3RXHA 1TRYA 6ESTA 2FTLE 1TRNA 5DP3A 1EX3A 1FCFA 1DWEH 2ZCLP 5DP9A 1GBFA 3BG4B 5F3XA 5G1DA 3HKIB 1TX7A 2H2CA 1KXDA 1UCYE 2UUKB 4QT8C 4AGKA 3ZYEA 4ABFA 1HDTH 5PTPA 4I8LA 1WI4A 1B8QA 1MBMA 3LJOA 3MNSA 2KPLA 4ZKRU 8GCHG 1GHAG 4D9RA 3VXFH 1WOFA 2SGDE 1LCYA 3SHWA 3HPTB 3DFLA 1KIGH 1SG8B 1DANH 3MH5A 3QE1A 4O97A 1G2MA 3R68A 3M36A 2BQ7B 3RXSA 1ZRKA 1N8OC 3PS4A 3NCLA 4NMSA 2XWAA 4LMMA 1OOKB 1Z6EA 1VZQH 4NFFA 1ZR0A 1J14A 4ABIA 1XKBC 1YPHC 3E17A 3SV7A 2CHAC 2G52A 4O3TA 2A4OA 4GHNA 5FPTA 1FNIA 1SHHB 1UK2A 1DM4B 1LKAA 2QF3A 1UEQA 2A4QA 1MKWH 3LC5A 1AB9C 2BXUH 3BIUH 4F49A 2A5KA 4BAQB 4X6PA 3QUMP 1K1PA 3GY4A 3TPIZ 2W7UA 3TITA 4BAMB 2ZTYA 3KCGH 1LPZB 2DKRA 1L1GA 3BTHE 1TBRH 1LPGB 3R0FA 2KJDA 5ETXA 3ENSB 1A4WH 1SGRE 4OS6A 2ZDVH 5J4QA 1FY3A 4BXSA 2V35A 3IG6B 5HETA 3BTTE 3ZV8A 2ZFQH 4ISNA 4JZFH 1PPGE 3W95A 2PUQH 2H5DA 3QZRA 2A2XH 3BG8A 2R2WU 3PMBB 4DOQA 3BF6H 4X8UH 3ZZAA 1Y7NA 3RXMA 3NGHA 1YCPH 3PV5A 1GI0A 2BDAA 1QL7A 2W7RA 1RGWA 2RRMA 2ZG0H 5GJ4B 2Z9LA 2YT8A 2PR3A 1W13U 1SSXA 4N6XA 3V3MA 2RA0A 1QNJA 2J9NA 2M5TA 2IWOA 4Y6DA 5DP7A 1OWHA 1PQ8A 4DVAU 2HE4A 1C5NH 1RS0A 1W7GH 1DWCH 3ATWA 3A84A 1OBXA 2ZIQH 5LPFA 3ATMA 2VWOA 1S6HA 3TNTA 1YPJH 3BTME 1P05A 4CRBA 1NZQH 3HVQC 3Q3KA 1ZPCA 2VU8E 1C4V2 1MKXK 3M5NA 2W4FA 1UVUH 1XUHA 1GG6B 1UHBA 2FOAA 2Z9KA 4ZHAA 3TH4H 2H1UA 2X7ZA 4E35A 1P2OA 3NXPA 3SJOA 1ABIH 1GI4A 2A2QH 2FOGA 4AFQA 1MTSA 1QAVA 1CSOE 4Y79A 3VB4A 2JH5D 3D65E 3SU1A 4X2XA 3RXVA 1DDJA 2KPKA 4YLQH 4INHA 1FXYA 2VIPA 3PM3A 2LA8A 1PYTC 1VJAU 3P92A 3RXUA 3OTJE 8ESTE 4GPGA 2ZU1A 4Y11E 4KTUA 1PJPA 1HFDA 4JYUH 2H2ZA 4XFQA 3PV4A 3E6PH 2ZO3H 2OMJA 1DX5M 3PMHB 2IWPA 1FZZA 4WVPE 1GDUA 3OSYA 2PKUA 4ISOA 1O2ZA 1LHEH 3ATIA 3T27A 3ZZ5A 4UFDH 3FANA 1C5PA 3BEUA 1K9OE 5K7RA 1GM1A 4X2VA 3RDZA 1F5LA 5FXLA 1ANEA 1GI3A 1Z6JH 2LC7A 3URDA 2P93A 2OPGA 1LDTT 3P8GA 3K1RA 3UNRA 2MX6A 1NU7B 1NRRH 4XBBA 1W0ZU 1O5BB 2VH6A 1CBWC 4K1TA 1WCZA 4SGAE 2H9EH 3SHUA 1TNIA 2Z3DA 1Q3PA 4CBOA 1NTPA 5T6FA 1L2EA 2TGTA 2FXRA 3S7KB 2K20A 4O03A 3ZZ8A 5L2YH 1W3CA 3U9AH 1BUIA 1E36B 2Q6FA 4DIHH 2YT7A 3RMNH 3T25A 1C1TA 2O8WA 1INCA 5DO4H 3LU9B 2TGPZ 1VITG 1NY22 1BHXF 4U2WA 3V7TA 4CRDA 2I04A 2RCZA 1UTPA 1RRKA 1PPBH 2GZ9A 5DTHA 1W9EA 3L33A 4JMYA 4MPXA 2ANKH 1LQDB 4YYXA 3CS0A 1LHDH 2A31A 2L4TA 4H6SB 4JK5A 4GVDA 2FCFA 2J94A 2XWBI 4JZIA 1FIZA 1ZOKA 3WKLA 1C5RA 5HFCA 3MO9A 2ZGHA 4UFEH 1AKSB 1O3AA 4ZHMU 3EQ0H 1SLXB 1MC7A 2OP9A 2EEJA 2BLWA 2QC2A 3SGAE 2ZHDA 4X1PU 1P2KA 2Z94A 2KV8A 2ZFTA 1P2MA 3DD2H 1FAXA 5I7ZA 3SJ9A 3D49H 1IQKA 1N7EA 4Q7XA 5H4IB 2GCHG 4JYVH 1UJUA 2R4HA 1Z71A 4HOPA 1UTJA 1AE5A 2ZQ1A 4MLFB 2ZP0H 1CGIE 1QLCA 1FY4A 2CS5A 1SOZA 1T31A 2ZDAH 4OEOA 5SGAE 2FI3E 3FAOA 5T3HA 3UQOA 3TGIE 5C20A 4AYVB 1KLIH 4Q2QA 2VGCB 1GI7B 1Z8IB 1HXFH 3KZEA 2OSGA 2WPKS 2Y5FA 3QK1A 1V2JT 2BD2A 1WBGB 2PGBB 1U3BA 3O5NA 1GHBG 4GCHF 4U32A 4GLYA 1JMOH 2F9NA 1FN6A 1RIWB 2OGPA 2BXTH 1P04A 4J1YA 1HAZB 1GQ4A 1HRTH 3ZV9A 4NCYA 2I4SA 2BD7A 4E7RG 5B6OA 2BD8A 2QIQA 2QYIA 1CA0C 3Q76A 2L97A 5GXPA 3VB6A 1YCPK 1ACBE 1DS2E 1O2OA 1TPPA 5DPAA 1BTZA 1DLKB 4BTUB 4PQWA 1YF4A 1BOQA 3PB1E 4ABDA 2P16A 5JBCS 2KAIA 3C1KA 1MFGA 4YTAA 4UDWH 2F9VA 3EA8A 3FP7E 2P59A 4Q7YA 2GV6A 1OBYA 4BNRA 1ZOMA 1GMCF 3ITIA 5ESBA 3ID1A 2V3HH 1SVPA 1BTYA 4A1XA 5C3NA 3HPKA 1C1SA 1PPHE 1PPZA 1YM0A 1SGPE 2XCFA 3M7UA 3TVJB 1CHOG 1NRNH 3SGBE 2NU0E 4Z0KA 2W3KA 1J15A 2DAZA 3M3VA 1TNJA 2CN0H 4CRFA 2A45B 2ZU2A 1C2HA 2BMGB 1GJBB 1NFUA 3UNSA 2G5MB 1RY4A 1BA8B 1W14U 2WYJA 5L6NH 1AVGH 2R0KA 2C4FH 4CREA 4OGXA 2ZTZA 2EV8A 1LO6A 3ID3A 1TP5A 2QKTA 3EGHC 5B6LA 1LKBA 1LVBA 2GMTC 3LONA 2ZFFH 3M7TA 3SFJA 3MU1A 3AXAA 4AYYB 1XMNB 4CR9A 1O2GH 1BMLA 5FCRA 5HXFA 4WMDA 5FBIA 5C5OA 3ELAH 1TNGA 3GSLA 1GBJA 5JPMH 5EXNA 1F2SE 4MTBA 2FESH 1BMAA 3ESTA 4DGJA 5EG4A 4XBDA 1MQ6A 3SU4A 5TCAA 4E3BA 2BM2A 1O2VA 1B5GH 4NIXA 4ZKSU 2F83A 2C93B 2BVSH 2P8OB 2Z17A 1O39A 3A7VA 1OBZA 1GHZA 3ZZ3A 3URCA 1ZHMA 2SGEE 1OP8A 2SGFE 1ELVA 3LOXA 1MTVA 3UQVA 3EA7A 1IHTH 1LVMA 4Y0ZE 4DT7B 3QTOH 2HPQH 4MNYA 2V90A 2BDYA 1XX9A 1O2SA 1QL8A 1I16A 1GHYH 1L4ZA 3RXAA 3QDOA 2CJIA 2ZHFH 2OS6A 3AAUA 3A8DA 5A09A 1OWEA 1GBBA 1C2FA 5F03A 3SU5A 2QKVA 2AIQA 4X2YA 5HGGA 4K1EA 2M0TA 1HYLA 2B9LA 3EA9A 3MU5A 2ZDKA 1O3LA 4FGMA 1G2LA 4RN6A 1OPHB 3RXLA 2BB4A 3HGPA 3JZ2B 3RUOA 2EGOA 4UU6A 2YUYA 2Y5GA 1ZTJA 1UTLM 8LPRA 4YOGA 1FQ3A 1IU2A 4I8GA 3SHCH 1TQ0B 2CXVA 2YNBA 1WG6A 3SU6A 2WV4A 1X5RA 1HCGA 2FX4A 5E11A 2ZFSA 3V12A 5A0CA 2DJTA 2F91A 2ZCHP 1YPKH 1BJVA 2C8ZB 1PPCE 1EB2A 5EW2H 1K32A 1O2LA 1MD8A 1TBQH 3RC6A 2ANMH 1BB0B 1A5IA 2XRCA 4JYTA 1O5DH 3MTYA 4O9VA 1AKSA 2BX4A 1QBVH 3SJ8A 2DE9A 2FS9A 1SOTA 3M61U 1ARCA 3LGWA 4RKOB 1SC8U 2F9PA 1DFPA 1GCTB 1OWKA 5CHAC 1QAUA 1GL1A 2EI8A 1D3DB 2FLBH 3H5CB 2BD4A 3RLWH 2EEGA 2VWNA 4D8NA 3E8LA 1TIOA 1OWDA 1O3OA 2QV1A 3OY6U 1DWBH 1OZIA 2ZWLH 1QBOA 1EZQA 1EP5A 2FIRH 3PDVA 4JOHA 1RTLA 4K8YA 3MH6A 2FPZA 3MOCA 3RLYH 2O9QA 2OXSA 4IN2A 2RA3A 2AS9A 5E2PA 2JREA 1AQ7A 1GBHA 4NA9H 5AVDA 4OS2A 1O3PB 3SUFA 2GCTB 3BTEE 1SGFA 1YCPM 4ZROA 5D13A 2I6VA 3F9GA 2P3FH 4O06A 3UWIA 1DUEA 5DP5A 2FE5A 3E0NB 4NIVA 4Z6AH 1TGTA 3PYHA 2NU1E 1CVWH 4NMTA 5JXBA 1MQ5A 1DXPA 1TPOA 2YTWA 4MDSA 1ZMNA 4ZXYH 4HTCH 2G51A 1XVMA 1C5XB 1ESAA 3RXPA 4G69A 1QHRB 1P9UA 1OSSA 3TNSA 4ZKOU 2GDEH 2PUXB 3TJNA 4HI3A 1N7TA 4WWYA 1TNKA 1NN6A 3RC5A 3CBZA 1BZXE 1M9UA 2OLGA 5CE1A 2THFB 1UJDA 2VNTA 4NSYA 2LOBA 2FYRA 4LK4A 3GCHC 4WMEA 1BTUA 2NU2E 2ZKSA 3EAJA 5EU8A 2ZZUH 3TH2H 2Q1JA 1CHGA 1DSUA 3GYLB 2F9OA 1KXEA 3T26A 2J34A 4H4FA 3I18A 5E0JA 1YPMH 3A8AA 2AERH 1D3PB 1BDAA 1OWIA 1ZSJA 1TQ3A 1UFXA 3ZVFA 3GY7A 3BG4C 5GLJA 1QAVB 4XOJA 4JOFA 4K75A 1N6XA 1DUAA 1QGFA 1GBAA 3O46A 2XXLA 1W11U 1C1NA 4AMHA 2XCNA 4B2BA 1B0FA 3VXEH 1HAXB 4KELA 2FI4E 4X6OA 3P95A 3A82A 1ETTH 2TBSA 5EOKA 1IQJA 1CO7E 1ZMLA 1UK4A 2PTNA 1MU6B 3SU0A 1LPKB 2H5CA 1FLEE 1XXFA 1NF3C 1P3CA 4JZ1A 4BAOB 1ZTKA 1T8NA 2GVFA 1GI9B 2FODA 7ESTE 4H11A 1A5HA 2F9BH 1NT1A 4RKJB 1CT2E 1GPZA 2PKAB 1UTQA 1Y59T 1T4VH 1HJ9A 1RJXB 3A83A 4TWYA 2LC6A 1KWAA 1P2IA 4OGYA 3RXIA 1CT4E 3TU7H 2A5IA 1ZPBA 3PLPA 1HLTH 1HV7A 1IHSH 1VITH 1G3BA 3GCHB 3TH3H 1TONA 3I78A 3K6ZA 1BHXB 4Q6SA 3A7YA 1P01A 1Z87A 4AFUA 1Y5BT 1FC7A 1NO9H 3M3TA 2PFEA 4DG4A 5JBBS 4OAJA 2P94A 1F0UA 3ID2A 4NNMA 3P17H 4FU8A 4BTTB 2PNTA 1AY6H 2AMDA 3IWMA 2ZQ2A 1S81A 3GDVA 1BMMH 1O3KA 2GZ7A 3TGJE 1C5QA 5G1EA 1X8SA 2I0LA 4ABBA 2REYA 4OS4A 1UEWA 1Q3XA 2V0BA 1AD8H 4FUDA 3S9AA 5EW1H 4Y7AA 1F5KU 4CRAA 1BMNH 5E2OA 1C5MD 2ZEBA 5E0GA 3UIRA 4RI0A 3VFEA 1VGCB 4P2AB 4IC6A 1K1LA 2W7SA 4YDPA 4AB8A 2QXHA 4AG1A 2IN2A 2KL1A 4X0WU 4NNLA 1YP9A 3SHAH 1AE8H 3UNQA 1GI8B 2BQ6B 1W9OA 1K2I1 5EQRA 3BTDE 2EXGA 5JBTA 4IBLH 3UTUH 2UUFB 1YGCH 3MO3A 2J92A 2CF9H 4NA7A 1UTNA 7GCHF 3A7TA 4B76A 4NWKA 1S82A 4SGBE 4HOPB 2HVXA 2G4TA 1FONA 4UU5A 3RP2A 2AGEX 3MFJA 1NPMA 1RTFB 1O3HA 2QXJA 3BSQA 2A7JA 9ESTA 2AH4X 2IWNA 2KBSA 4Y8YA 4K6YA 2HGTH 4GCHG 1GG6C 1EPTB 1ELEE 4WMFA 4LOYH 2B5TB 1TGCA 3M35A 5EODA 4AZ2B 2GT8A 1THRH 4REYA 4WF8A 3F6UH 1D5GA 1QA0A 3D23A 4NGAH 4O3UA 2HNTF 3KQEA 1B7XB 4K8BA 4OS7A 4ISIH 3PO1B 2HNTE 3SO3A 4ABHA 1QB1A 3M37A 1GJAB 4LXBH 4X1RU 4CRCA 1AZ8A 4Q7ZA 1GGDB 1SGCA 3GDSA 1T8LA 4M7GA 2EAQA 1ZJKA 2EI6A 1FC9A 2QN5T 5C1XA 5BPEA 3CS7A 1NS3A 1EZSC 5FHTA 1C2IA 1C5WB 5C67A 3HATH 1D9IA 1X7AC 3KZDA 1FV9A 1JRSA 1TMBH 2KAIB 1DLEA 2ASUB 2CMYA 2WPHS 1AUTC 1QL9A 1HNEE 2ZI2H 2ZPSA 1XXDA 1ESTA 2BDGA 2ZHQH 1V3XA 3KGPA 1UVTH 3JXTA 1V5QA 3CBXA 1IQHA 1GJ9B 1ZGVA 1V5LA 1SLVB 4YESB 1GMDG 1A46H 1K22H 1K1MA 2G5NA 2VIWA 4FU7A 1SFQB 1TP3A 4JOKA 2PWXA 2HGAA 1O5AB 2BZAA 2FO9A 3ZZ4A 2C8XB 2ESTE 1C1OA 5FPYA 3DJ3A 3UY9A 1L0ZA 5F67A 2UUJB 1IQIA 1H9IE 3RXRA 3VB7A 3ID4A 1H4WA 5HYOA 1GBIA 1EP6A 1XUFA 5EZ0A 3SZNA 1AHTH 1QR3E 3EE0B 1V62A 2AWXA 5ESTE 3ODDA 4BANB 1GBEA 1NU9A 1T7CA 1NFYA 2PW8H 1UM7A 4JOEA 2ZFPH 1DXWA 3M7QA 2C8YB 4NA8A 1HAPH 1F7ZA 1QTFA 5FCKA 1HAYB 3LPRA 4D7FA 3CP7A 2ZDMA 4UD9H 4X8SH 1BTHH 1AWFH 3QO6A 3Q3XA 1S83A 5L30H 2HALA 3EDXB 4THNH 3SV6A 2GP9B 2NU3E 3E16B 2XNIA 3BV9B 2KG2A 3PV2A 1ELCA 1GJ6A 4CHAB 2AIPA 1QJ7B 4JZDH 2PKAA 4WYTA 4EDJA 4A92A 3AVZA 1P8VC 1MCVA 2EHRA 3L3TA 4Q3HA 1EJAA 2ANYA 2Z9GA 3QJMA 4Z8JA 4F4OC 1BTWA 1ZSKA 4I33A 4JOGA 5FAHA 1QFKH 1RXPA 2WPIS 1N99A 2QKUA 1GVKB 4HGCA 2BY9X 1VCPA 1GJ8B 2KJKA 1O34A 2OBQA 3NK8A 4NWLA 3UREA 6GCHF 1GWAA 2BD3A 3FZDA 1V2ST 2VGCC 3S9CA 4B71A 4ABJA 1UVOA 5H3JA 1O2QA 3ZZCA 4FUIA 3S0NA 3A81A 2Z9IA 1LHFH 1SL3A 3U69H 1IQGA 3F1SB 1GJDB 1RIWC 1E38B 3UR9A 4D9QA 3FP8E 2RG3A 2ZDLA 3B76A 2WV5A 4KKDA 3AW0A 4AGJA 1A7SA 1W2KH 3SQHE 2CF8H 2OQSA 3QTVH 5GCHF 1ZYOA 2QF0A 4P0CA 1GBKA 4E34A 3GISB 1K28D 1IQFA 1KLJH 1EAXA 1UO6A 1G3EA 2FM2A 3A7ZA 2VB0A 3GCTG 3P8NA 1KDQB 5EXMA 2ULLA 1DITH 2Z6BD 3RXKA 3RXQA 3ZRTA 1JOUB 4FXGH 3BTWE 1C1MA 1OP0A 2D2DA 4B75A 1AVWA 1W12U 5DP4A 1JWTA 4KP0A 5ABWA 3ZZDA 2DMZA 3LJJA 5GDSH 2GTBA 1GHAF 2ZF0H 1L1JA 2NU4E 2WPLS 1MKWK 2FWWA 1IQEA 1HAIH 1KTSB 3A7XA 1FY5A 3ATKA 1XUJA 1HJAB 5BRRE 1QCPA 3VGCB 1EPTA 3LT3A 4GAWA 2EI7A 5AFYH 1O3CA 3ZVBA 1P57B 4K72A 2I0IA 3DA9B 2ZU3A 2J95A 5E21A 4K76A 1NTEA 2AMPA 1XKAC 1SGIB 2PSYA 5AFZH 1PFXC 2KJPA 1UTMA 2ZC9H 4DCDA 1DY8A 4Q6HA 2IWQA 1ELTA 3NZIA 4NMRA 1WAYB 2KOJA 2H2BA 1C5UA 1SGFG 4Y8ZA 3E3TA 2AWWA 2ZU5A 2P8OC 2I6QA 2QXGA 1PQ7A 2JXOA 1O5GH 1UJ1A 2B7DH 1V1TA 4X8VH 1KY9A 3R0HA 2SNWA 3RXJA 3BPUA 1TLDA 1ANDA 3SV2H 2SGAA 5E0HA 2R2MB 3V13A 1UMAH 4NMQA 1BTPA 2EGNA 2TRMA 3SJKA 2JIKA 5A8XA 2Q3GA 1QQUA 1EASA 1X5QA 2W5EA 3HKJB 3Q3YA 1O2NA 2KOMA 4YLUA 4IC5A 3DFJA 5A0BA 1Y3YA 1THSH 1A1RA 2PV9B 3GY2A 5GWZA 1F5RA 3SOEA 4I8KA 2KYLA 1EOLA 2C8WB 2UZCA 1TQ7B 1Y3VA 1DICA 2D1JA 4TY6A 3MNCA 2Q6GA 3BEFB 2PZDA 3LNYA 1P2QA 1TE0A 2EEIA 3DJAA 1Q2WA 4X1NU 3JZ1B 3W94A 1O3FA 1HAGE 1AUJA 1QB6A 5DK1A 1TNHA 1C5OH 1C1RA 1NROH 1BRAA 4E06H 1T4UH 1GVZA 4JZEH 4WH8A 1QB9A 1BJUA 3UWJH 3S9BA 1O2JA 4IN1A 4B2CA 1TMUH 1C2DA 4Y0YE 1ELDE 1Z7KA 3P8FA 3ATLA 1YPHE 2R0LA 2VWMA 3Q77A 2EA3A 2OC0A 2W3IA 1L1NA 1N1LA 1YKTA 2LUIA 2R9PA 4AOQA 2WYGA 3M5LA 3FVFB 3SUZA 1F0TA 4CBNA 4MNXA 5EGMA 1GCTC 1O37A 5F8ZA 2GX4A 1IHJA 4WXIA 3QDZB 2P95A 1C2EA 2EDPA 2QBWA 1AZZA 5FB8C 1OYQA 2BDCA 4NZLA 1S6FA 3O8RA 5C1YA 3Q00A 1TMTH 2OBOA 1RGQA 2JILA 1FPHH 2ENOA 1T32A 1TA6A 2IOTA 4MNWA 2R3YA 1KYNA 4MPVA 3K50A 3NFLA 2BOHB 2PKSB 3SJIA 4HZHA 4DIIH 2JOAA 1TFXA 4F8KA 1SB1H 3ZVDA 5T6GA 2GCTC 4ZKNU 1Y3WA 1SGQE 1C9TA 3NFKA 1AFQB 1OWJA 3CBYA 1O2RA 2FOHA 3TSZA 2OCVB 9LPRA 1VAEA 1MCTA 2Y80A 4IMQA 1O2UA 1NRQH 1P06A 5AHGH 1HAOH 3GGEA 4K78A 5C1UA 2A1DB 2IPHA 3BEIB 2BLOA 2ZHEH 1SGEE 1GBCA 2FYQA 2ZNKH 1RFNA 3O8DA 1UEZA 4AFSA 1SGNE 2WPJS 3GY8A 2SFAA 2M10A 2CSSA 1O2XA 5K0HA 2C90B 1FPCH 3KHVA 2OUAA 1GHVH 4I8JA 3M5MA 3NKKA 1X5NA 1EAUA 4B1TA 1FJSA 1SBWA 3RM2H 1KDQA 1TPSA 1P9SA 2WUCA 1J16A 1BFEA 5HEYA 1H8DH 2L4SA 5HDYA 3RL7A 1VITF 1BBRE 1NM6A 1V2TT 2AWUA 1J8AA 1P03A 1XUIA 1KTTB 2CGAA 4NXRA 1V6DA 2XW9A 1HAHH 1XUKA 1AU8A 1C5ZB 1H1BA 5F8XA 2D92A 1UTKA 1FY8E 1V2NT 3KNXA 3VB3A 1GQ5A 3DT0H 1MTUA 2BY6X 1MTNB 1SQAA 2TPIZ 4JOPA 1SPJA 2VJ1A 1UEPA 2UUYA 4K69A 2UWOA 3E1XB 1ZUBA 2FN5A 2K1QA 3I4WA 2ODPA 5DP6A 1WJLA 3TGKE 3B9FH 5IYTA 3O8CA 4UFFH 1SI5H 4DJZB 3RXGA 2VPHA 4A1VA 1HAVB 2XC0A 5EPYA 4AX9H 2Y7ZA 2AEIH 3MWIU 4GUXA 2LPRA 5HJ1A 1G32B 1NC6A 1LVYA 1AN1E 1GJ5H 2KOHA 1IU0A 2QCYA 2XBYA 2M0ZA 1A61H 4YO9A 3ZZ7A 1O2IA 1MTWA 4VGCB 1Q3OA 2ZFRH 1LQEA 3LGTA 1O2WA 1S0QA 4Y10E 1ZRBA 3EGKH 5EQSA 1GDQA 1ELGA 1THPB 2FOCA 1U39A 2BY5X 1T8OA 3OX7U 1AIXH 1R6JA 1A0JA 1QJ1B 4X6MA 3WKMA 1OXGA 1Q7XA 3SI3H 5HMAA 1MU8B 4TY7A 4CRGA 1W7XH 2DLSA 3PWBA 1L4DA 2Q6DA 1ESBA 2AYWA 3A8CA 1KXCA 1NFXA 2VVCA 2VH0A 1CGJE 3TK5A 3OYPA 5JB9S 1C1UH 3I1EA 3SUEA 1O30A 4E05H 3BN9A 2Y6TA 4K1SA 1PPFE 1EOJA 4ZXXH 1CHOF 1TAWA 1G9OA 1JIRA 4L8NA 3TLOA 5HFEA 3R69A 1H9HE 2FDAA 1TA2A 3E90B 2PDZA 4ZUHA 1VGCC 4I32A 1LHCH 1EB1H 4WXVA 5HM9A 1H9LB 1D3TB 2VWRA 1UITA 3STJA 1QJ6B 4A1TA 1WSSH 4LZ4B 2BTCE 2VIDA 1O3BA 1AO5A 1FUJA 1SLWB 1U38A 1MUEB 5HFDA 1EZXC 1BRUP 3SBKA 4WY3A 2O8LA 4OEPA 4I31A 2QGRA 3A85A 2DLUA 2JETB 2O8UA 1UK3A 1HUTH 1PDRA 1G37A 1BBRH 2JH0D 2QXIA 3QGLA 2GV7A 5HF4A 6GCHG 2BZ6H 4JK6A 1TOMH 2GDDA 3DORA 1BITA 2A4RA 4H42U 4Q2KA 1GI1A 1ELAA 2D8IA 2FOMB 1JBUH 4ISLA 3I77A 4A6LA 4YT7H 2OC7A 4JORA 1EPTC 4FUFA 1DVAH 2IJOB 4KGAA 3LKWA 3VQFA 1HBTH 1X6DA 3R3GB 2DM8A 1GMHF 2FOBA 2VVVA 2H9HA 3PO1C 4ASHA 3LC3A 1C5SA 4K5ZA 3K9XB 3MO6A 3QLPH 5GCHG 5JBAS 2TGAA 3A7WA 3RMLH 1VB7A 3RXDA 4B2AA 1WF8A 1F0SA 1S85A 2JKHA 2SGPE 1PQAA 1O5FH 1KSNA 3RXBA 1T2MA 3EGGC 1D6RA 1GGDC 2OTVA 2P3TB 2RCEA 5G4BA 4XHVA 2A7HA 1YC0A 4JCNA 4TPIZ 3LGUA 6CHAB 4MPUA 1LTOA 1OS8A 1O3JA 2M0UA 2VIQA 1KXAA 3KIDU 2O2TA 1O35A 3VB5A 4IMZA 2OQUA 4U30A 2H6MA 3MU8A 1EJNA 4B74A 3F9EA 2ZECA 5LPRA 4HFPB 2GD4B 4H6TA 1EAWA 1K21H 3SW2B 1ZZZA 3K2UA 2BYGA 2QT5A 1MBQA 1OYTH 5HF1A 2LNCA 4BTIB 1VJ9U 4XBCA 1W9QA 5A2PA 1A2CH 1GJ4H 2VSVA 3SOSA 3TJOA 3SV8A 1S84A 2GT7A 1F0RA 5A8YA 3QJNA 1BQYA 2XTTB 3B23B 2ZA5A 4FUHA 2A32A 2EGKA 3NUMA 2OCSA 4MPAA 1TRMA 1JRTA 3U8OH 1C5TA 3T28A 2EC9H 2FLRH 3SNAA 2G81E 1Z8JB 7LPRA 3HGNA 5EYZA 1N6FA 3MHWU 1WF7A 3V0XA 2EEHA 1G30B 1MZAA 3RMOH 2W26A 2G4UA 3AW1A 1O38A 4LZ1H 1E0FD 2EDZA 1ELFA 1ZMJA 4DY7B 1EKBB 1VJ6A 1C1VH 1SGTA 1YBOA 3EYDA 3TMHA 1HAVA 4NMVA 1EJMA 4MNVA 2BDHA 4AB9A 1RGRA 1MFLA 1SGYE 3IITA 1IAUA 3SORA 3A86A 1XZ9A 1QIXB 3KQCA 3LDXH 3GY5A 3ZVEA 1GMCG 1ETRH 4CHAC 1O32A 1QQ4A 3PTBA 3I29A 1N6YA 1AFEH 1P0SH 1C4Y2 1DT2A 1GHWH 4X2WA 1QY6A 1SFIA 4UE7H 2OQ5A 3BIVH 1BRBE 3GJ9A 3MU0A 3U1IB 3RXCA 5E22A 1AMHA 1WH1A 3RC4A 1N8OB 2VINA 1I92A 2OD3B 5DGJA 2H3LA 4GHQA 3A8BA 3DUXH 1IQNA 1TABE 4AG2A 3RMMH 2BD5A 3GDUA 1IQMA 1O3EA 3A88A 2GKVE 3VPKA 1V2QT 1A3EH 2PSXA 5J4SA 4I8HA 2CHAB 3PWCA 5LGOA 2ZGBH 1WQSA 4IS5A 2YOLA 4MQAA 3TJVA 4WH6A 3ZVGA 3A89A 1V2WT 4B73A 1CE5A 2F0AA 1AWHB 3P70B 3VQGA 1MAXA 2Q9VA 2AMQA 3AAVA 3MYWA 1DPOA 2HE2A 1AB9B 1GL0E 1V2LT 4CH2B 3VEQB 4J2YB 4FUGA 2DUCA 1E34B 1O0DH 2AFQB 3LGYA 2G2LA 1E37B 6LPRA 2HOBA 2M0VA 2PKTA 2B8OH 3UFAA 2G00A 2AGGX 2AGIX 1GCDA 2BLQA 4UEHH 2M3MA 2BY8X 1OX1A 2WL7A 1C5LH 1WIFA 4NG9H 3KEEA 1ZTLA 1C2MA 1UCYH 2ALVA 3QWCH 1XVOA 2V3OH 1P2NA 1WTGH 2FOFA 3ZYDA 3OU0A 4KFVA 2ALPA 1BCUH 4BAKB 2XYAA 1VA8A 4X1QU 1O3NA 5EPNA 2PGQB 1JIMA 1N6EA 1BBRK 1TGBA 1N7FA 1DY9A 2ZGJA 1ZJDA 1O2KA 1WHAA 4A5TS 4D76A 5HM2A 3ZVCA 1VCQA 1YPLH 4OS1A 3KHFA 3B8JA 2Y82A 1FN8A 1HJAC 1YPEH 2QA9E 3CH8A 4FUCA 2ZU4A 1C9PA 2TIOA 1W0YH 3VGCC 4IGDA 1GJCB 1FC6A 3QX5H 3ZZBA 1V2MT 2OINA 3FP6E 2Y5HA 2ZPRA 1JXPA 2D26C 3SV9A 1D4PB 1ID5H 1TB6H 2ZGXH 3KQBA 4NZQA 4TWWA 4XDEA 2XC5A 5C5NA 3KF2A 2G5VA 3GCNA 1KXBA 2E7KA 1V2OT 2EJYA 4UONA 3M5OA 2FP7B 4DURA 5DP8A 1C2JA 4U01A 4FUEA 3TJUA 1C1WH 2VIOA 2FEQH 1U37A 2EEKA 2BVRH 2RDLA 1G9IE 3BTGE 1TOCB 5FPSA 1QURH 3OY5U 4ZHLU 5IDKA 1O3DA 2XBVA 2GZVA 1TYNA 1MAYA 5A0AE 1EZUC 4FUJA 3OTPA 2K1ZA 1GBMA 4Y76A 1WFGA 4JL7A 2CV3A 1WHDA 8GCHF 2BLVA 5LPEA 3GY6A 5DG6A 4ISHH 4FU9A 2A7CA 1GBLA 1S0RA 2XC4A 3F68H 4FVBA 4R8TB 1WTHD 3O8BA 1W8BH 1MD7A 1AVXA 1CT0E 3N7OA 1O3IA 3UPEA 3CYYA 1GHXH 2A0QB 2Y7XA 2KAWA 1A0LA 1ORFA 1NFWA 1Z8RA 1ZLRA 3D62A 1BT7A 3KQDA 3GOVB 2OC1A 2PA1A 2PHBA 1CBWB 1Q31A 1BRCE 4ABGA 1FI8A 4NMPA 3NWUA 5A8ZA 1EQ9A 1EAIA 1EUFA 3ZZ6A 1BTXA 1O2YA 3PLBA 3BTFE 4XE4A 1O33A 3UOUA 3LNXA 8KME2 1S5SA 1TWXB 2A5AA 3FZZA 4BOHA 1GDNA 1Y3UA 1E35B 2ILNA 2QY0B 3SNEA 3CC0A 1TX6A 1PPEE 2SGQE 2FTMA 2ZHWH 4NFEA 4NXPA 4Y71A 2JH6D 3SU2A 1P09A 5LH8A 1ABJH 1CU1A 1O3GA 2ZPQA 3S7HB 4JOJA 1K1NA 3RXEA 4Y7BA 2Z9JA 3UR6A 1C2KA 1J17T 4YZUA 2HRVA 3GICB 3FY5A 1Z1JA 2KA9A 1SQOA 3SGQE 1ZPZA 2GGVB 1QA7A 1V2UT 4ABAA 1TGSZ 1MZDA 3RM0H 4YT6H 1HJ8A 1EATA 3PLKA 3SNCA 1SMFE 5TJXA 1GBDA 4GVUA 3RXFA 3RU4T 2PKSC 3L6PA 4K60A 2Z7FE 1C2GA 2ANWA 2QAAA 1O31A 2WUBA 3DHKH 4RSPA 1GBTA 4R2ZA 3PROA 1GJ7B 2UWLA 1AFQC 1SGDE 1LMWB 1QRZA 4IW4E 4AFZA 4AN7A 5C2ZA 2BYAX 1HIAB 1ZHPA 4DW2U 2VSPA 1O5CB 1GMDF 1EXFA 3P8OA 5F6MA 3SUDA 3RXOA 2VWLA 2D8WA 2J4IA 1Z86A 1O36A 1DOJA 1GI5A 1W10U 4I7YH 3T2NA 1FDPA 4XSKU 1UCYK 1QRWA 5GIBA 2H9TH 3GYMA 3LH3A 2UWPA 4AORA 3RLEA 1AI8H 4ESTE 1C1PA 5I46H 2P3UB 1FAKH 2O8TA 1SHYA 5FX6A 1CA0B 3SNDA 1CA8B 2ZPMA 1MH0A 2HNTC 4R0IA 2BD9A 1RZXA 2FMJA 4TYDA 3HPMA 3STIA 1KLTA 1RD3B 2CSJA 1V2RT 1F92A 3M3SA 1V6BA 3U8RH 1P10A 3T5FH 1O2PA 1TNLA 5EXLA 1BE9A 1GMHG 1MTNC 1U6QA 1DE7H 1M5ZA 1P1DA 3KL6A 3LGIA 2HWLB 1AGJA 3AASA 1YLCA 1K1IA 1NESE 3C27B 1D3QB 1V2PT 2R3UA 2V1WA
chains in the Genus database with same CATH superfamily
3BTQE 2JINA 4NMOA 3MNXA 4YOIA 1C5YB 1WUNH 4INLA 1WI2A 3UUZA 1OP2A 3U1JB 3ODFA 1UVSH 1YLNA 1V2KT 2VVUA 4GVCA 3UOPA 5CDFE 4X8TH 3FFGA 2HPPH 1NRSH 2FI5E 2GMTB 5HFBA 2NWNA 4BAHB 4X1SU 4P00A 4E7NA 3SQEE 3QGNB 1O5EH 3GY3A 2WINI 2H3MA 2C3SA 2F5YA 1WU1A 1CQQA 1C2LA 1FMGA 4ZMAH 1P11E 2GZ8A 1RTKA 1Z8GA 4FUBA 3HK6B 3OEHD 1O3MA 4KTSA 3KN2A 3NPSA 7GCHG 4VGCC 1P12E 2L6OA 2JIZD 1LVOA 5GNDA 3RL8A 1N6DA 4NSVA 4TPYA 3MH4A 1NRPH 3P6ZB 1G3DA 3H7OA 4FVDA 1GVLA 2VIVA 3T29A 3F3BA 1ELBA 1SR5C 5EIYA 1PQ5A 2XBXA 3L4FD 4Y8XA 2B0FA 2J38A 2Z3CA 1L6OA 3LGVA 4XRNA 4BXWA 2STBE 1ANBA 3U8TH 1ANCA 2A4GA 4Q2OA 1LHGH 1ETSH 2ZCKP 3GCTF 4K2YA 3DJ1A 3K65B 3SU3A 5C0UA 2V6NA 4CR5A 2PLXA 2DC2A 2F9UA 3WW7A 2BDIA 1QBNA 4A7IB 1TBZH 3SN8A 3PTNA 1YBWA 2GCHF 3TSWA 3MMGA 1YLDA 2SNVA 4YOJA 1KEFA 1C5VA 3QGJA 4MVNA 2G55A 3TIUA 1UHPA 1ARBA 2ZGCA 2F3CE 2HLCA 2BX3A 5E8EH 2ZPLA 1P1EA 4X6NA 3MH7A 3A80A 1UW7A 2FX6A 1A3BH 2DE8A 1HPGA 5HFFA 3A87A 5CHBA 2KQFA 1GI6A 2I6SA 1PYTD 3K6YA 5L2ZH 4YM9A 3PDZA 1DWDH 4Q4LA 2VZ5A 1GHBF 2G8TA 3DIWA 2STAE 4KTCA 2OZFA 4Q80A 2FOEA 1KXFA 2JETC 5F8TA 2Z3EA 3ZZ9A 2WPDD 1X45A 4ACBA 4ZCNA 1WQVH 2BY7X 2WV9A 3F9HA 4INKA 1UJVA 1B0EA 3LIWA 3SUGA 5JYIA 1MMJN 4CH8B 2ODYB 3BTKE 3HK3B 1ZHRA 3MU4A 1ZGIA 4MG3A 3QZQA 1SLUB 3E0PB 2JWEA 3CENA 4NXQA 1K1OA 4GHTA 4OS5A 1Y5UT 1C4U2 2P3WA 5A2MH 2XOKD 5T6DA 4GSOA 5CHAB 2FS8A 1O2MA 2AINA 1IQLA 5TCCA 2I1NA 1XUGA 3SNBA 5JB8S 2OC8A 3G01A 1UVPA 2D90A 2XBWA 1YPGH 3F0PA 5FX5A 5E6PB 2KRGA 1Y3XA 1A5GH 3K82A 4WJG2 3TK6A 2ZTXA 4NIYA 3ZVAA 1VCWA 1H8IH 7KMEH 1HIAA 1P02A 5AF9H 2EDVA 3WY8A 2TGDA 2FZZA 3TK9A 1MKXH 1UHBB 2FNEA 2WPMS 1P3EA 1T8MA 4TSFD 3T62A 1WFVA 2BQWB 3RU4E 2QG1A 1G3CA 1UTOA 2BHGA 6CHAC 1J9CH 2O8MA 1QRXA 1Y8TA 1O2HA 4NIWA 2BVXH 2YNAA 2ZDNA 2MHOA 5HEBA 1OKXA 2YUBA 5CMXH 2BDBA 1CGHA 4ABEA 3U98H 3SI4H 4UFGH 3RXTA 4YXWD 3E91A 2ODQA 3QN7A 1FY1A 1FIWA 3H7TA 4Q2NA 4MPWA 2DB5A 1DSTA 3F9FA 3MI4A 3WWFA 1SQTA 3S69A 1Z1IA 3QIKA 1A0HB 1TGNA 1XM1A 3LH1A 3PMJA 5EQQA 3RU4D 4KFWA 1TPAE 4D7GA 2PTCE 1TX8A 1C1QA 4ZH8A 3MNBA 1K1JA 4OM9A 4PROA 1HB0B 1IOEA 1G36A 2VRFA 5DJ7A 5I25A 4ZAEA 2BOKA 5DKMA 4Q2PA 3GCOA 1GI2A 4K3JA 1O2TA 1E79D 1ZSLA 4Z33A 5GPIB 5E1YA 1HXEH 2Y81A 1TALA 1V2VT 5HEDA 1BIOA 5JDUB 2L74A 1WV7H 4WYUA 2PP6A 5FBEA 1VR1H 1YYY1 1UF1A 2J2UA 1UM1A 1D6WA 1P2JA 1HGTH 3PMAB 3TSVA 1WYKA 1Y5AT 3RXHA 1TRYA 6ESTA 2FTLE 1TRNA 5DP3A 1EX3A 1FCFA 1DWEH 2ZCLP 5DP9A 1GBFA 3BG4B 5F3XA 5G1DA 3HKIB 1TX7A 2H2CA 1KXDA 1UCYE 2UUKB 4QT8C 4AGKA 3ZYEA 4ABFA 1HDTH 5PTPA 4I8LA 1WI4A 1B8QA 1MBMA 3LJOA 3MNSA 2KPLA 4ZKRU 8GCHG 1GHAG 4D9RA 3VXFH 1WOFA 2SGDE 1LCYA 3SHWA 3HPTB 3DFLA 1KIGH 1SG8B 1DANH 3MH5A 3QE1A 4O97A 1G2MA 3R68A 2J97A 2BQ7B 3M36A 3RXSA 1ZRKA 1N8OC 3PS4A 1WDIA 3NCLA 4NMSA 2XWAA 4LMMA 1OOKB 1Z6EA 1VZQH 4NFFA 1ZR0A 1J14A 4ABIA 1XKBC 1YPHC 3E17A 2XNDD 3SV7A 2CHAC 2G52A 4O3TA 2A4OA 4GHNA 5FPTA 1FNIA 1SHHB 1UK2A 1DM4B 1LKAA 2QF3A 1UEQA 2A4QA 2IJD1 1MKWH 3LC5A 1AB9C 2BXUH 3BIUH 4F49A 2A5KA 4BAQB 4X6PA 3QUMP 4B6EA 1K1PA 3GY4A 3GS9A 3TPIZ 2W7UA 1H8ED 3TITA 4BAMB 2ZTYA 3KCGH 1LPZB 2DKRA 1L1GA 3BTHE 1TBRH 1LPGB 3R0FA 2KJDA 5ETXA 3ENSB 1A4WH 1SGRE 4OS6A 2ZDVH 5J4QA 1FY3A 4BXSA 2V35A 3IG6B 5HETA 3BTTE 3ZV8A 2ZFQH 3FOAA 4ISNA 5T1VA 4JZFH 1PPGE 3W95A 2PUQH 2H5DA 3QZRA 2A2XH 2QE7D 3BG8A 2R2WU 3PMBB 4DOQA 3BF6H 4X8UH 3ZZAA 1Y7NA 3RXMA 3NGHA 1YCPH 3PV5A 1GI0A 2BDAA 1QL7A 2W7RA 1RGWA 2RRMA 2ZG0H 5GJ4B 2Z9LA 2YT8A 2PR3A 3W1EA 1W13U 1SSXA 4N6XA 3V3MA 2RA0A 1QNJA 2J9NA 2M5TA 2IWOA 4Y6DA 5DP7A 1OWHA 1PQ8A 4DVAU 2HE4A 1C5NH 1RS0A 1W7GH 2F4LA 1DWCH 2KFWA 3ATWA 3A84A 1OBXA 2ZIQH 5LPFA 3ATMA 2VWOA 1S6HA 3TNTA 1YPJH 3BTME 1P05A 1MABB 4CRBA 1NZQH 3HVQC 2EQNA 3Q3KA 1ZPCA 2VU8E 1C4V2 1MKXK 3M5NA 2W4FA 1UVUH 1XUHA 1GG6B 2K8IA 1UHBA 2FOAA 2Z9KA 4ZHAA 3TH4H 2H1UA 2X7ZA 4E35A 1P2OA 3NXPA 3SJOA 1ABIH 1GI4A 2A2QH 2FOGA 4AFQA 1MTSA 1QAVA 1CSOE 4Y79A 3VB4A 2JH5D 3D65E 3SU1A 4X2XA 3RXVA 1DDJA 2KPKA 4YLQH 4INHA 1FXYA 2VIPA 3PM3A 2LA8A 1PYTC 5KECA 1VJAU 3P92A 3RXUA 3OTJE 8ESTE 4GPGA 2ZU1A 4Y11E 4KTUA 1PJPA 1HFDA 4JYUH 2H2ZA 4XFQA 3PV4A 3E6PH 2ZO3H 2OMJA 1DX5M 3PMHB 2IWPA 1FZZA 4WVPE 1GDUA 3OSYA 2PKUA 4ISOA 1O2ZA 1LHEH 3ATIA 3T27A 3ZZ5A 4UFDH 3FANA 1C5PA 3BEUA 1K9OE 5K7RA 1GM1A 4X2VA 3RDZA 1F5LA 5FXLA 1ANEA 1GI3A 1Z6JH 2LC7A 3URDA 2P93A 2OPGA 1LDTT 3P8GA 3K1RA 3UNRA 2MX6A 1NU7B 1NRRH 2V7QD 4XBBA 1W0ZU 1O5BB 2VH6A 1CBWC 4K1TA 1WCZA 4SGAE 2H9EH 3SHUA 1TNIA 2Z3DA 4F48B 1Q3PA 4CBOA 2YMSD 1NTPA 5T6FA 1L2EA 2TGTA 2FXRA 3S7KB 2K20A 4O03A 3ZZ8A 5L2YH 1W3CA 3U9AH 1BUIA 2KCOA 1E36B 2Q6FA 4DIHH 2YT7A 3RMNH 3T25A 1C1TA 2O8WA 1INCA 5DO4H 3LU9B 2TGPZ 1VITG 1NY22 1BHXF 4U2WA 3V7TA 4CRDA 2I04A 2RCZA 1UTPA 1RRKA 1PPBH 2GZ9A 5DTHA 1W9EA 3L33A 4JMYA 4MPXA 2ANKH 1LQDB 4YYXA 3CS0A 1LHDH 2A31A 2L4TA 4H6SB 4JK5A 4GVDA 2FCFA 2J94A 2XWBI 4JZIA 1FIZA 1ZOKA 3WKLA 1C5RA 5HFCA 3MO9A 4TT3D 2ZGHA 4UFEH 1AKSB 1O3AA 1SKYE 4ZHMU 3EQ0H 1SLXB 2WSSD 1MC7A 2OP9A 2EEJA 2BLWA 2QC2A 3SGAE 2ZHDA 4X1PU 1P2KA 2Z94A 2KV8A 2ZFTA 1P2MA 3DD2H 1FAXA 5I7ZA 5KGOA 3SJ9A 3D49H 1IQKA 1N7EA 4Q7XA 5H4IB 1FX0B 2GCHG 4JYVH 1UJUA 2R4HA 1Z71A 4HOPA 3F2HA 1UTJA 1AE5A 2ZQ1A 5B42A 4MLFB 2ZP0H 1CGIE 1QLCA 1FY4A 2CS5A 1SOZA 1T31A 2ZDAH 4OEOA 5SGAE 2FI3E 3FAOA 5T3HA 3UQOA 3TGIE 5C20A 4AYVB 1KLIH 4Q2QA 2VGCB 1GI7B 1Z8IB 1HXFH 3KZEA 2OSGA 2WPKS 2Y5FA 3QK1A 1V2JT 2BD2A 1WBGB 2PGBB 1U3BA 3O5NA 1GHBG 4GCHF 4U32A 4GLYA 1JMOH 2F9NA 2KCPA 2W6JD 1FN6A 1RIWB 3OAAD 2OGPA 2BXTH 3FN8A 1P04A 4J1YA 1HAZB 1GQ4A 1HRTH 3ZV9A 1VKYA 4NCYA 2I4SA 2BD7A 4E7RG 5B6OA 2BD8A 2QIQA 2QYIA 1CA0C 3Q76A 2L97A 5GXPA 3VB6A 1YCPK 1ACBE 1DS2E 1O2OA 1TPPA 5DPAA 1BTZA 1DLKB 4BTUB 4PQWA 1YF4A 1BOQA 3PB1E 4ABDA 2P16A 5JBCS 2KAIA 3C1KA 1MFGA 4YTAA 4UDWH 2F9VA 3EA8A 3FP7E 2P59A 4Q7YA 2GV6A 1OBYA 4BNRA 1ZOMA 1GMCF 3ITIA 5ESBA 3ID1A 2V3HH 1SVPA 1BTYA 4A1XA 5C3NA 3HPKA 1C1SA 1PPHE 1PPZA 1YM0A 1SGPE 2XCFA 3M7UA 3TVJB 1CHOG 1NRNH 3SGBE 2NU0E 4Z0KA 2W3KA 1J15A 2DAZA 3M3VA 1TNJA 2CN0H 4CRFA 2A45B 2ZU2A 1C2HA 2BMGB 1GJBB 1NFUA 3UNSA 2G5MB 1RY4A 1BA8B 1W14U 2WYJA 5L6NH 1AVGH 2R0KA 2C4FH 4CREA 2KZ4A 4OGXA 2ZTZA 2EV8A 1LO6A 1TP5A 2QKTA 3EGHC 3ID3A 5B6LA 1LKBA 1LVBA 2GMTC 3LONA 2ZFFH 3M7TA 3SFJA 3MU1A 3AXAA 4AYYB 1XMNB 4CR9A 1O2GH 1BMLA 5FCRA 5HXFA 4WMDA 5FBIA 5C5OA 3SZEA 3ELAH 1TNGA 3GSLA 1GBJA 5JPMH 5EXNA 1F2SE 4MTBA 2FESH 1BMAA 3ESTA 4DGJA 5EG4A 4XBDA 1MQ6A 3OE7D 3SU4A 3FO8D 5TCAA 5C17A 4E3BA 2BM2A 1O2VA 1B5GH 4NIXA 4ZKSU 2F83A 2C93B 2BVSH 2P8OB 2Z17A 1O39A 2W6ID 3A7VA 1OBZA 1GHZA 2F43B 3ZZ3A 3URCA 5EJLA 1ZHMA 2SGEE 1OP8A 2SGFE 1ELVA 3LOXA 1MTVA 3UQVA 3EA7A 1IHTH 1LVMA 2IPQX 4Y0ZE 4DT7B 3QTOH 2HPQH 4MNYA 2V90A 2BDYA 1XX9A 1O2SA 1QL8A 1I16A 1GHYH 1L4ZA 3RXAA 3QDOA 2CJIA 2ZHFH 2OS6A 3AAUA 3A8DA 5A09A 1OWEA 1GBBA 1C2FA 5F03A 3SU5A 2QKVA 2AIQA 4X2YA 3N7DA 5HGGA 4K1EA 2M0TA 1HYLA 2B9LA 3EA9A 3MU5A 2ZDKA 1O3LA 4FGMA 1G2LA 4RN6A 1QZ8A 1OPHB 3RXLA 2BB4A 3HGPA 3JZ2B 3RUOA 2EGOA 4UU6A 2YUYA 2Y5GA 1ZTJA 1UTLM 8LPRA 4YOGA 1FQ3A 1IU2A 4I8GA 3SHCH 1TQ0B 2CXVA 2YNBA 1WG6A 3SU6A 2WV4A 1X5RA 1HCGA 2FX4A 5E11A 2ZFSA 3V12A 5A0CA 2DJTA 2F91A 2ZCHP 1YPKH 1BJVA 2C8ZB 1PPCE 1EB2A 5EW2H 1K32A 1O2LA 1MD8A 1TBQH 3RC6A 2ANMH 1BB0B 1A5IA 2XRCA 4JYTA 1O5DH 3MTYA 4O9VA 1AKSA 1E1RD 2BX4A 1QBVH 3SJ8A 2DE9A 2FS9A 1SOTA 3OFND 3M61U 1ARCA 3LGWA 4RKOB 1SC8U 2F9PA 1DFPA 1GCTB 3SYJA 1OWKA 5CHAC 1QAUA 1GL1A 2EI8A 1D3DB 2FLBH 3H5CB 2BD4A 3RLWH 2EEGA 2VWNA 3DSPA 4D8NA 3E8LA 1TIOA 1OWDA 1O3OA 2QV1A 3OY6U 1DWBH 1OZIA 2ZWLH 1QBOA 1EZQA 1EP5A 2FIRH 3PDVA 4JOHA 1RTLA 4K8YA 3MH6A 2FPZA 3MOCA 3RLYH 2O9QA 2OXSA 4IN2A 2RA3A 2AS9A 5E2PA 2JREA 1AQ7A 1GBHA 4NA9H 5AVDA 4OS2A 1O3PB 3SUFA 2GCTB 5C94A 3BTEE 1SGFA 1YCPM 5KEDA 4ZROA 5D13A 2I6VA 3F9GA 2P3FH 4O06A 3UWIA 1DUEA 5DP5A 2FE5A 3E0NB 4NIVA 4Z6AH 1TGTA 3PYHA 2NU1E 1CVWH 4NMTA 5JXBA 1MQ5A 1DXPA 1TPOA 2YTWA 4MDSA 1ZMNA 4ZXYH 4HTCH 2G51A 1XVMA 1C5XB 1ESAA 3RXPA 4G69A 1QHRB 1P9UA 1OSSA 2KCAA 5C0TA 3TNSA 4ZKOU 2GDEH 2PUXB 3PRBA 2QF4A 3TJNA 4HI3A 1N7TA 4WWYA 1TNKA 1NN6A 3RC5A 3CBZA 1BZXE 1M9UA 2OLGA 5CE1A 2THFB 1UJDA 2VNTA 4NSYA 2LOBA 2FYRA 4LK4A 3GCHC 4WMEA 1BTUA 2NU2E 2ZKSA 3EAJA 5EU8A 2ZZUH 3TH2H 2Q1JA 1CHGA 1DSUA 3GYLB 2F9OA 1KXEA 3T26A 2J34A 4H4FA 3I18A 5E0JA 1YPMH 3A8AA 2AERH 1D3PB 1BDAA 1OWIA 1ZSJA 2YMSB 1TQ3A 1UFXA 3ZVFA 3GY7A 3BG4C 5GLJA 1QAVB 4XOJA 4JOFA 4K75A 1N6XA 1DUAA 1QGFA 4AC9A 1GBAA 3O46A 2XXLA 1W11U 1C1NA 4AMHA 1KMHB 2XCNA 4B2BA 1B0FA 3VXEH 1HAXB 4KELA 2FI4E 4X6OA 3P95A 3A82A 1ETTH 2TBSA 5EOKA 1IQJA 1CO7E 1ZMLA 1UK4A 2LELA 2PTNA 1MU6B 3SU0A 1LPKB 2H5CA 1FLEE 1XXFA 1NF3C 1P3CA 4JZ1A 4BAOB 4Q63A 1ZTKA 1T8NA 2GVFA 1GI9B 2FODA 7ESTE 4H11A 1A5HA 2F9BH 1NT1A 4RKJB 1CT2E 1GPZA 2PKAB 1UTQA 1Y59T 1T4VH 1HJ9A 1RJXB 3A83A 4TWYA 2LC6A 3AK5A 1KWAA 1P2IA 4OGYA 3RXIA 1CT4E 2KR7A 3TU7H 2AHME 2A5IA 1ZPBA 3FKSD 3PLPA 1HLTH 1HV7A 1IHSH 1VITH 1G3BA 3GCHB 3TH3H 1TONA 3I78A 3K6ZA 1BHXB 4Q6SA 3A7YA 1P01A 1Z87A 4AFUA 1Y5BT 1FC7A 1NO9H 3M3TA 2PFEA 4DG4A 5JBBS 4OAJA 2P94A 1F0UA 3ID2A 4NNMA 3P17H 4FU8A 4BTTB 4DT4A 2PNTA 1AY6H 2AMDA 3IWMA 2ZQ2A 1S81A 3GDVA 1BMMH 1O3KA 2GZ7A 3TGJE 1C5QA 5G1EA 1X8SA 2I0LA 4ABBA 2REYA 4OS4A 1UEWA 1Q3XA 2V0BA 1AD8H 4FUDA 3S9AA 5EW1H 4Y7AA 1F5KU 4CRAA 1BMNH 5E2OA 1C5MD 2JJ1D 2ZEBA 5E0GA 3UIRA 4RI0A 3VFEA 1VGCB 4P2AB 1WXRA 4IC6A 1K1LA 2W7SA 4YDPA 4AB8A 2QXHA 4AG1A 2IN2A 2KL1A 4X0WU 4NNLA 1YP9A 3SHAH 1AE8H 3UNQA 1GI8B 2BQ6B 1W9OA 1K2I1 5EQRA 3BTDE 2EXGA 3EE7A 5JBTA 4IBLH 3UTUH 2UUFB 1YGCH 3MO3A 2J92A 2CF9H 4NA7A 1UTNA 7GCHF 3A7TA 4B76A 4NWKA 1S82A 4SGBE 4HOPB 2HVXA 2G4TA 1FONA 4UU5A 3RP2A 2AGEX 3MFJA 1NPMA 2WHXA 1RTFB 1O3HA 2QXJA 3BSQA 2A7JA 9ESTA 2AH4X 2IWNA 2KBSA 4Y8YA 4K6YA 2HGTH 4GCHG 1GG6C 1EPTB 1ELEE 3N99A 4WMFA 4LOYH 2B5TB 1TGCA 3M35A 5EODA 4AZ2B 2GT8A 1THRH 4REYA 4WF8A 3F6UH 1D5GA 1QA0A 3D23A 4NGAH 4O3UA 2HNTF 2K0QA 3KQEA 1B7XB 4K8BA 4OS7A 3H09A 3PO1B 4ISIH 2HNTE 3SO3A 4ABHA 1QB1A 3M37A 1GJAB 4LXBH 3UAIC 4X1RU 4CRCA 1AZ8A 4Q7ZA 1GGDB 1SGCA 3GDSA 1T8LA 4M7GA 2EAQA 1ZJKA 2EI6A 1FC9A 2QN5T 5C1XA 5BPEA 3CS7A 1NS3A 1EZSC 5FHTA 1C2IA 1C5WB 5C67A 3HATH 1D9IA 1X7AC 3KZDA 1FV9A 1JRSA 1TMBH 2KAIB 1DLEA 2ASUB 2CMYA 2WPHS 1AUTC 3F0OA 1QL9A 1HNEE 2ZI2H 2ZPSA 1XXDA 1ESTA 2BDGA 2ZHQH 1V3XA 3KGPA 1UVTH 3JXTA 1V5QA 3CBXA 1IQHA 1GJ9B 1ZGVA 3KYGA 4FOUC 1V5LA 1SLVB 4YESB 1GMDG 1A46H 1K22H 1K1MA 2G5NA 2VIWA 4FU7A 1SFQB 1TP3A 4JOKA 2PWXA 2HGAA 1O5AB 2BZAA 2FO9A 3ZZ4A 2C8XB 2ESTE 1C1OA 5FPYA 3DJ3A 3UY9A 1L0ZA 5F67A 2UUJB 1IQIA 1H9IE 3RXRA 3VB7A 3ID4A 1H4WA 5HYOA 1GBIA 1EP6A 1XUFA 5EZ0A 3SZNA 1AHTH 1QR3E 3EE0B 1V62A 2AWXA 5ESTE 3ODDA 4BANB 1GBEA 1NU9A 1T7CA 4F55A 1NFYA 2PW8H 1UM7A 4JOEA 2ZFPH 1DXWA 3M7QA 2C8YB 4NA8A 1HAPH 1F7ZA 1QTFA 5FCKA 1HAYB 3LPRA 4D7FA 3CP7A 2ZDMA 4UD9H 4X8SH 1BTHH 1AWFH 3QO6A 3Q3XA 1S83A 5L30H 2HALA 3EDXB 4THNH 3SV6A 2GP9B 2NU3E 3E16B 2XNIA 3BV9B 2KG2A 3PV2A 1ELCA 1GJ6A 4CHAB 2AIPA 1QJ7B 4JZDH 5EJZA 2PKAA 4WYTA 4EDJA 1EFRD 4A92A 1YY3A 5IK2D 5IL9A 3AVZA 1P8VC 1MCVA 2EHRA 3L3TA 4Q3HA 1EJAA 2ANYA 2Z9GA 3QJMA 4Z8JA 4F4OC 1BTWA 1ZSKA 4RT1A 4I33A 4JOGA 5FAHA 1QFKH 1RXPA 2WPIS 1N99A 2QKUA 1GVKB 4HGCA 2BY9X 1VCPA 1GJ8B 2KJKA 1O34A 2OBQA 3NK8A 4NWLA 3UREA 6GCHF 1GWAA 2BD3A 3FZDA 1V2ST 2VGCC 3S9CA 4B71A 4ABJA 1UVOA 5H3JA 1O2QA 3ZZCA 4FUIA 3S0NA 3A81A 2Z9IA 1LHFH 1SL3A 3U69H 1IQGA 3F1SB 1GJDB 5EJ1A 1RIWC 1E38B 3UR9A 1NBME 4D9QA 3FP8E 2RG3A 2HVYB 2ZDLA 3B76A 2WV5A 4KKDA 3AW0A 4AGJA 1A7SA 1W2KH 3SQHE 2CF8H 2OQSA 3QTVH 5GCHF 1ZYOA 2QF0A 4P0CA 1GBKA 4E34A 3GISB 1K28D 1IQFA 1KLJH 1EAXA 1UO6A 1G3EA 2FM2A 3A7ZA 1W0KD 2VB0A 3GCTG 3P8NA 1KDQB 5EXMA 2ULLA 1DITH 2Z6BD 3RXKA 3RXQA 3NRLA 3ZRTA 1JOUB 4FXGH 3BTWE 1C1MA 1OP0A 2D2DA 5FL7D 4B75A 1AVWA 1W12U 5DP4A 1JWTA 4KP0A 5ABWA 1NBMD 3ZZDA 2DMZA 3LJJA 5GDSH 2GTBA 1GHAF 2ZF0H 1L1JA 2NU4E 2WPLS 1MKWK 2FWWA 1IQEA 1HAIH 1KTSB 3A7XA 1FY5A 3ATKA 3F2FA 1XUJA 1HJAB 5BRRE 1QCPA 3VGCB 1EPTA 3LT3A 4GAWA 2EI7A 5AFYH 1O3CA 3ZVBA 1P57B 4K72A 4Z1MD 2I0IA 3DA9B 2ZU3A 2J95A 3U28C 5E21A 4K76A 1NTEA 2AMPA 1XKAC 1SGIB 2PSYA 5AFZH 1PFXC 2KJPA 1UTMA 2ZC9H 4DCDA 1DY8A 4Q6HA 2IWQA 1ELTA 3NZIA 4NMRA 1WAYB 2KOJA 2H2BA 1C5UA 1SGFG 4Y8ZA 3E3TA 2AWWA 2ZU5A 2P8OC 2I6QA 2RDEA 2QXGA 1PQ7A 2JXOA 1O5GH 1UJ1A 2B7DH 1V1TA 4X8VH 1KY9A 3R0HA 2SNWA 3RXJA 3BPUA 1TLDA 1ANDA 3SV2H 2SGAA 2QF5A 5E0HA 2R2MB 3V13A 1UMAH 4NMQA 1BTPA 2EGNA 2TRMA 3SJKA 3KYFA 2JIKA 4ASUD 5A8XA 2Q3GA 1QQUA 1EASA 1X5QA 2W5EA 3HKJB 3DCLA 1O2NA 2KOMA 3Q3YA 4YLUA 4IC5A 1YWUA 3DFJA 5A0BA 1Y3YA 1THSH 1A1RA 3UB0A 2HLDD 2PV9B 3GY2A 5HIYA 5GWZA 1F5RA 3SOEA 4I8KA 2KYLA 1EOLA 2C8WB 2UZCA 1TQ7B 1Y3VA 1DICA 2D1JA 4TY6A 3MNCA 2Q6GA 3BEFB 2PZDA 3LNYA 1P2QA 1TE0A 2EEIA 3DJAA 1Q2WA 4X1NU 3JZ1B 3W94A 1O3FA 1HAGE 1AUJA 1QB6A 5DK1A 1TNHA 1C5OH 1C1RA 1NROH 1BRAA 4E06H 1T4UH 1GVZA 4JZEH 4WH8A 1QB9A 1BJUA 2GJGA 3UWJH 1O2JA 4IN1A 4B2CA 3S9BA 1TMUH 1C2DA 4Y0YE 1ELDE 1Z7KA 3P8FA 3ATLA 1YPHE 2R0LA 2VWMA 3Q77A 2EA3A 2OC0A 2W3IA 1L1NA 1N1LA 1YKTA 2LUIA 2R9PA 4AOQA 2WYGA 3M5LA 3FVFB 3SUZA 1F0TA 4CBNA 4MNXA 2KCYA 5EGMA 1GCTC 1OHHD 1O37A 5F8ZA 2GX4A 1IHJA 4WXIA 3QDZB 2P95A 1C2EA 2EDPA 2QBWA 1AZZA 5FB8C 5ILBA 1OYQA 2BDCA 4NZLA 1S6FA 3O8RA 5C1YA 3Q00A 1TMTH 2OBOA 1RGQA 2JILA 1FPHH 2ENOA 1T32A 1TA6A 2IOTA 4ACAA 4MNWA 2R3YA 1KYNA 4MPVA 3K50A 3NFLA 2BOHB 2PKSB 3SJIA 4HZHA 4DIIH 2JOAA 1TFXA 4F8KA 1SB1H 3ZVDA 5T6GA 2GCTC 4ZKNU 1Y3WA 1SGQE 1C9TA 3NFKA 1AFQB 1OWJA 3NCVA 3CBYA 1O2RA 2FOHA 3TSZA 2OCVB 9LPRA 1VAEA 1MCTA 2Y80A 4IMQA 1O2UA 1NRQH 1P06A 5AHGH 1HAOH 3GGEA 4K78A 5C1UA 2A1DB 2IPHA 3BEIB 3KDKA 2BLOA 2ZHEH 1SGEE 1GBCA 2FYQA 2ZNKH 1RFNA 3O8DA 1UEZA 4AFSA 1SGNE 2WPJS 3GY8A 2SFAA 2M10A 2CSSA 1O2XA 5K0HA 2C90B 1FPCH 3KHVA 2OUAA 1GHVH 4I8JA 3M5MA 3NKKA 1X5NA 1EAUA 4B1TA 1FJSA 1SBWA 1K0HA 3RM2H 4B6FA 1KDQA 1TPSA 1P9SA 2WUCA 1J16A 1BFEA 5HEYA 1H8DH 2L4SA 5F53A 2JSNA 5HDYA 3RL7A 1VITF 1BBRE 1NM6A 1V2TT 2AWUA 2LP6A 1J8AA 1P03A 1XUIA 1KTTB 2CGAA 4NXRA 1V6DA 2XW9A 1HAHH 1XUKA 1AU8A 1C5ZB 1H1BA 5F8XA 2D92A 1UTKA 1FY8E 1V2NT 3KNXA 3VB3A 1GQ5A 3DT0H 1MTUA 2BY6X 1MTNB 1SQAA 2TPIZ 2YMSC 4JOPA 1SPJA 2VBCA 2VJ1A 1UEPA 2UUYA 4K69A 2UWOA 3E1XB 1ZUBA 2FN5A 2K1QA 3I4WA 2ODPA 5DP6A 1WJLA 3TGKE 3B9FH 5IYTA 4RT0A 3O8CA 2V3MA 4UFFH 4FLNA 1SI5H 4DJZB 3RXGA 2VPHA 4A1VA 1HAVB 2XC0A 3PRDA 5EPYA 4AX9H 3KDGA 2Y7ZA 3WWBA 2AEIH 3MWIU 4GUXA 2LPRA 5HJ1A 1G32B 1NC6A 1LVYA 1AN1E 1GJ5H 2KOHA 1IU0A 2QCYA 2XBYA 2M0ZA 1A61H 4YO9A 3ZZ7A 1O2IA 1MTWA 4VGCB 1Q3OA 2ZFRH 1LQEA 3LGTA 1O2WA 1S0QA 4Y10E 1ZRBA 3EGKH 5EQSA 1GDQA 1ELGA 1THPB 2FOCA 1U39A 2BY5X 1T8OA 3OX7U 1AIXH 1R6JA 1A0JA 1QJ1B 4X6MA 3WKMA 1OXGA 1Q7XA 3SI3H 5HMAA 1MU8B 4TY7A 4CRGA 1W7XH 2DLSA 3PWBA 1L4DA 2Q6DA 1ESBA 2AYWA 3A8CA 1KXCA 1NFXA 2VVCA 2VH0A 1CGJE 3TK5A 3OYPA 2J98B 5JB9S 1C1UH 3I1EA 3SUEA 1O30A 4E05H 3BN9A 2Y6TA 4K1SA 1PPFE 1EOJA 4ZXXH 1CHOF 1TAWA 1G9OA 1JIRA 4L8NA 3TLOA 5HFEA 2GEFA 3R69A 1H9HE 2FDAA 1TA2A 3E90B 2PDZA 4ZUHA 1VGCC 5DN6D 4I32A 1LHCH 1EB1H 4WXVA 5HM9A 1H9LB 1D3TB 2VWRA 1UITA 3STJA 1E1QD 1QJ6B 4A1TA 1WSSH 4LZ4B 2BTCE 2VIDA 1O3BA 1AO5A 1FUJA 1SLWB 1U38A 1MUEB 5HFDA 1EZXC 1BRUP 3SBKA 4WY3A 2O8LA 4OEPA 4I31A 2QGRA 3A85A 2DLUA 2JETB 2O8UA 1UK3A 1HUTH 1PDRA 1G37A 1BBRH 2JH0D 2QXIA 3QGLA 2GV7A 5HF4A 6GCHG 2BZ6H 5HKKD 4JK6A 1TOMH 2GDDA 3DORA 1BITA 2A4RA 4H42U 4Q2KA 1GI1A 1ELAA 2D8IA 2FOMB 1JBUH 4ISLA 3I77A 4A6LA 4YT7H 2OC7A 4JORA 1EPTC 4FUFA 1DVAH 2IJOB 4KGAA 3LKWA 3VQFA 4M9FA 1HBTH 1X6DA 3R3GB 2DM8A 1GMHF 2FOBA 2VVVA 2H9HA 3PO1C 4ASHA 3LC3A 1C5SA 4K5ZA 3K9XB 3MO6A 3QLPH 5GCHG 5JBAS 2TGAA 3A7WA 3RMLH 1VB7A 3RXDA 4B2AA 1WF8A 1F0SA 1S85A 2JKHA 2SGPE 1PQAA 1O5FH 1KSNA 3RXBA 1T2MA 3EGGC 1D6RA 1GGDC 2OTVA 2P3TB 2RCEA 5G4BA 4XHVA 2A7HA 1YC0A 4JCNA 4TPIZ 3LGUA 6CHAB 4MPUA 1LTOA 1OS8A 1O3JA 2M0UA 2VIQA 1KXAA 3KIDU 2O2TA 1O35A 3VB5A 4IMZA 2OQUA 4U30A 2H6MA 3MU8A 1EJNA 4B74A 3F9EA 2ZECA 5LPRA 4HFPB 2GD4B 4H6TA 1EAWA 1K21H 3SW2B 1ZZZA 3K2UA 2BYGA 2QT5A 1MBQA 1OYTH 5HF1A 2LNCA 4BTIB 1VJ9U 4XBCA 1W9QA 5A2PA 1A2CH 1GJ4H 2VSVA 3SOSA 3TJOA 3SV8A 1S84A 2GT7A 1F0RA 5A8YA 3QJNA 1BQYA 2XTTB 3B23B 2ZA5A 4FUHA 2A32A 1X9ZA 2EGKA 3N7EA 3NUMA 1W0JD 2OCSA 4MPAA 3DSOA 1TRMA 1JRTA 3U8OH 1C5TA 3T28A 2EC9H 2FLRH 3SNAA 2G81E 1Z8JB 7LPRA 3HGNA 5EYZA 1N6FA 3MHWU 1WF7A 3V0XA 2EEHA 1G30B 1MZAA 3RMOH 2W26A 2G4UA 3AW1A 1O38A 4LZ1H 1E0FD 2EDZA 1ELFA 1ZMJA 4DY7B 1EKBB 1VJ6A 1C1VH 2J5UA 1SGTA 1YBOA 3EYDA 3TMHA 1HAVA 4NMVA 3DSGA 1EJMA 4MNVA 2BDHA 4AB9A 1RGRA 1MFLA 1SGYE 3IITA 1IAUA 3SORA 3A86A 1XZ9A 1QIXB 3KQCA 3LDXH 3GY5A 3ZVEA 1GMCG 1ETRH 4CHAC 1O32A 1QQ4A 3PTBA 3I29A 1N6YA 1AFEH 1P0SH 1C4Y2 1DT2A 1GHWH 2JJ2D 4X2WA 1QY6A 1SFIA 4UE7H 2OQ5A 3BIVH 1BRBE 3GJ9A 3MU0A 3U1IB 3RXCA 5E22A 1AMHA 1WH1A 3RC4A 1N8OB 2KX4A 2VINA 1I92A 2OD3B 5DGJA 4JJ3A 2H3LA 4GHQA 3A8BA 3DUXH 1IQNA 1TABE 4AG2A 3RMMH 2BD5A 3GDUA 1IQMA 1O3EA 3A88A 2GKVE 4I86A 1V2QT 1A3EH 2PSXA 3VPKA 5J4SA 4I8HA 2CHAB 3PWCA 5LGOA 2ZGBH 1WQSA 4IS5A 2YOLA 4MQAA 3TJVA 4WH6A 3ZVGA 3A89A 1V2WT 4B73A 4JJ0A 2J98A 1CE5A 2F0AA 1AWHB 3P70B 3VQGA 1MAXA 4P02A 2Q9VA 2AMQA 3AAVA 3MYWA 1DPOA 2HE2A 1AB9B 1GL0E 1V2LT 4CH2B 3VEQB 4J2YB 4FUGA 2DUCA 1E34B 1O0DH 1S6LA 2AFQB 3LGYA 2G2LA 1E37B 6LPRA 2HOBA 2M0VA 2PKTA 2B8OH 3UFAA 2G00A 2AGGX 2AGIX 1GCDA 2BLQA 2KM0A 4UEHH 2M3MA 2BY8X 1OX1A 2WL7A 1C5LH 1WIFA 4NG9H 3KEEA 1ZTLA 1C2MA 1UCYH 2ALVA 3QWCH 1XVOA 2V3OH 1P2NA 1WTGH 2FOFA 3ZYDA 3OU0A 4KFVA 2ALPA 1BCUH 4BAKB 2XYAA 1VA8A 4X1QU 1O3NA 5EPNA 2PGQB 1JIMA 1N6EA 1BBRK 1DY9A 1N7FA 1TGBA 2ZGJA 1ZJDA 1O2KA 1WHAA 4A5TS 4D76A 5HM2A 3ZVCA 1VCQA 1YPLH 4OS1A 3KHFA 3B8JA 2Y82A 4FETA 1FN8A 1HJAC 1YPEH 2QA9E 3CH8A 4FUCA 2ZU4A 1C9PA 2TIOA 1W0YH 3VGCC 4IGDA 1GJCB 1FC6A 3QX5H 3ZZBA 1V2MT 2OINA 3FP6E 2Y5HA 2ZPRA 1JXPA 2D26C 3SV9A 1D4PB 1ID5H 1TB6H 2ZGXH 3KQBA 4NZQA 4TWWA 4XDEA 2XC5A 5C5NA 3KF2A 2G5VA 3GCNA 1KXBA 2E7KA 1V2OT 2EJYA 4UONA 3M5OA 1BMFD 2FP7B 4DURA 5DP8A 1C2JA 4U01A 4FUEA 3TJUA 1C1WH 2VIOA 2FEQH 1U37A 2EEKA 2OK5A 2BVRH 2RDLA 1G9IE 3BTGE 1TOCB 5FPSA 1QURH 3OY5U 4ZHLU 5IDKA 1O3DA 2XBVA 2GZVA 1TYNA 1MAYA 3F2GA 5A0AE 1EZUC 2WZQA 4FUJA 3OTPA 2K1ZA 1GBMA 4Y76A 1WFGA 4JL7A 2CV3A 1WHDA 8GCHF 2BLVA 5LPEA 3GY6A 3OEED 5DG6A 4ISHH 4FU9A 2A7CA 5DSFA 5HIZA 1GBLA 1S0RA 2XC4A 3F68H 4FVBA 4R8TB 1WTHD 3O8BA 1W8BH 1MD7A 1AVXA 1CT0E 3N7OA 1O3IA 3UPEA 3CYYA 1GHXH 2A0QB 2Y7XA 2KAWA 1A0LA 1ORFA 1NFWA 1Z8RA 1ZLRA 3D62A 1BT7A 3KQDA 3GOVB 2OC1A 2PA1A 2PHBA 1CBWB 1Q31A 1BRCE 4ABGA 1FI8A 4NMPA 3ZIAD 4XD7D 3NWUA 5A8ZA 1EQ9A 1EAIA 1EUFA 3ZZ6A 1BTXA 1O2YA 3PLBA 3BTFE 4XE4A 1O33A 3UOUA 3LNXA 8KME2 1S5SA 1TWXB 2A5AA 2M2AA 3FZZA 4BOHA 1GDNA 1Y3UA 1E35B 2ILNA 2QY0B 3SNEA 3CC0A 1TX6A 1PPEE 2SGQE 2FTMA 2ZHWH 4NFEA 4NXPA 1SQRA 1COWD 4Y71A 2JH6D 3SU2A 1P09A 5LH8A 1ABJH 1CU1A 1O3GA 2ZPQA 3S7HB 4JOJA 1K1NA 3RXEA 4Y7BA 2Z9JA 3UR6A 1C2KA 1J17T 4YZUA 2HRVA 3GICB 3FY5A 1Z1JA 2KA9A 1SQOA 3SGQE 1ZPZA 2GGVB 1QA7A 1V2UT 4ABAA 1TGSZ 1MZDA 3RM0H 4YT6H 1HJ8A 1EATA 3PLKA 3SNCA 1SMFE 5TJXA 1GBDA 4GVUA 3RXFA 3RU4T 2PKSC 3L6PA 4K60A 2Z7FE 1C2GA 2ANWA 2QAAA 1O31A 2WUBA 3MQKC 3DHKH 4RSPA 1GBTA 4R2ZA 3PROA 1GJ7B 2UWLA 1AFQC 1SGDE 1LMWB 1QRZA 4IW4E 3KQ5A 4AFZA 4AN7A 5C2ZA 2BYAX 1HIAB 1ZHPA 4DW2U 2VSPA 1O5CB 1GMDF 1EXFA 3P8OA 5F6MA 3SUDA 3RXOA 2VWLA 2D8WA 2J4IA 1Z86A 1O36A 1DOJA 1GI5A 1W10U 4I7YH 3T2NA 1FDPA 4XSKU 1UCYK 1QRWA 5GIBA 3GABA 2H9TH 3GYMA 3LH3A 1H8HD 2UWPA 2RFKC 4AORA 3RLEA 1AI8H 4ESTE 1C1PA 2EY4C 5I46H 2P3UB 3VG8A 1FAKH 2O8TA 1SHYA 5FX6A 1CA0B 3SNDA 1CA8B 2ZPMA 1MH0A 2HNTC 4R0IA 2BD9A 1RZXA 2FMJA 4TYDA 3HPMA 3STIA 1KLTA 1RD3B 2CSJA 1V2RT 1F92A 3M3SA 1V6BA 3U8RH 1P10A 3T5FH 1O2PA 1TNLA 5EXLA 1BE9A 1GMHG 3CNRA 1MTNC 1U6QA 1DE7H 1M5ZA 1P1DA 3KL6A 3LGIA 2HWLB 1AGJA 3AASA 2JDID 1YLCA 1K1IA 1NESE 3C27B 1D3QB 1V2PT 2CK3D 4HG6A 2R3UA 2V1WA
chains in the Genus database with same CATH topology
3BTQE 2JINA 4NMOA 3MNXA 4YOIA 1C5YB 1WUNH 4INLA 1WI2A 3UUZA 1OP2A 3U1JB 3ODFA 1UVSH 1V2KT 2VVUA 4GVCA 3UOPA 4X8TH 3FFGA 2HPPH 1NRSH 2FI5E 2GMTB 5HFBA 2NWNA 4BAHB 4X1SU 4E7NA 3SQEE 3QGNB 1O5EH 3GY3A 2WINI 2H3MA 2C3SA 2F5YA 1WU1A 1CQQA 1C2LA 1FMGA 4ZMAH 1P11E 2GZ8A 1RTKA 1Z8GA 4FUBA 3HK6B 1O3MA 4KTSA 3KN2A 3NPSA 7GCHG 4VGCC 1P12E 1LVOA 5GNDA 3RL8A 1N6DA 4NSVA 4TPYA 3MH4A 1NRPH 3P6ZB 1G3DA 3H7OA 4FVDA 1GVLA 2VIVA 3T29A 1ELBA 1SR5C 1PQ5A 2XBXA 3L4FD 4Y8XA 2B0FA 2J38A 2Z3CA 1L6OA 3LGVA 4BXWA 2STBE 1ANBA 3U8TH 1ANCA 2A4GA 4Q2OA 1LHGH 1ETSH 2ZCKP 3GCTF 4K2YA 3DJ1A 3K65B 3SU3A 2V6NA 4CR5A 2PLXA 2DC2A 2F9UA 2BDIA 1QBNA 4A7IB 1TBZH 3SN8A 3PTNA 1YBWA 2GCHF 3TSWA 3MMGA 1YLDA 2SNVA 4YOJA 1KEFA 1C5VA 3QGJA 4MVNA 2G55A 3TIUA 1UHPA 1ARBA 2ZGCA 2F3CE 2HLCA 2BX3A 5E8EH 2ZPLA 1P1EA 4X6NA 3MH7A 3A80A 2FX6A 1A3BH 2DE8A 1HPGA 5HFFA 3A87A 2KQFA 1GI6A 2I6SA 1PYTD 3K6YA 5L2ZH 4YM9A 3PDZA 1DWDH 2VZ5A 1GHBF 2G8TA 3DIWA 2STAE 4KTCA 2OZFA 4Q80A 2FOEA 1KXFA 2JETC 5F8TA 2Z3EA 3ZZ9A 1X45A 1WQVH 2BY7X 3SUGA 3F9HA 4INKA 1UJVA 1B0EA 3LIWA 5JYIA 1MMJN 4CH8B 2ODYB 3BTKE 3HK3B 1ZHRA 3MU4A 1ZGIA 4MG3A 3QZQA 1SLUB 3E0PB 2JWEA 3CENA 4NXQA 1K1OA 4GHTA 4OS5A 1Y5UT 1C4U2 2P3WA 5A2MH 5T6DA 4GSOA 5CHAB 2FS8A 1O2MA 2AINA 1IQLA 5TCCA 2I1NA 1XUGA 3SNBA 5JB8S 2OC8A 3G01A 1UVPA 2D90A 2XBWA 1YPGH 5FX5A 5E6PB 2KRGA 1Y3XA 1A5GH 3K82A 4WJG2 3TK6A 2ZTXA 4NIYA 3ZVAA 1VCWA 1H8IH 7KMEH 1HIAA 1P02A 5AF9H 2EDVA 3WY8A 2TGDA 2FZZA 3TK9A 1MKXH 1UHBB 2FNEA 2WPMS 1P3EA 1T8MA 3T62A 1WFVA 2BQWB 3RU4E 2QG1A 1G3CA 1UTOA 2BHGA 6CHAC 1J9CH 2O8MA 1QRXA 1Y8TA 1O2HA 4NIWA 2BVXH 2YNAA 2ZDNA 2MHOA 5HEBA 1OKXA 2YUBA 5CMXH 2BDBA 1CGHA 4ABEA 3U98H 3SI4H 4UFGH 3RXTA 3E91A 2ODQA 3QN7A 1FY1A 1FIWA 3H7TA 4Q2NA 4MPWA 2DB5A 1DSTA 3F9FA 3MI4A 1SQTA 3S69A 1Z1IA 3QIKA 1A0HB 1TGNA 1XM1A 3LH1A 3PMJA 5EQQA 3RU4D 4KFWA 1TPAE 4D7GA 2PTCE 1TX8A 1C1QA 4ZH8A 3MNBA 1K1JA 4PROA 1HB0B 1IOEA 1G36A 2VRFA 5DJ7A 5I25A 4ZAEA 2BOKA 5DKMA 4Q2PA 3GCOA 1GI2A 4K3JA 1O2TA 1ZSLA 5GPIB 4Z33A 5E1YA 1HXEH 2Y81A 1TALA 1V2VT 5HEDA 1BIOA 5JDUB 1WV7H 4WYUA 5FBEA 1VR1H 1YYY1 1UF1A 2J2UA 1UM1A 1D6WA 1P2JA 1HGTH </