1LCYA

Crystal structure of the mitochondrial serine protease htra2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
320
structure length
296
Chain Sequence
PPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HtrA2 serine protease
publication title Structural insights into the pro-apoptotic function of mitochondrial serine protease HtrA2/Omi.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 296
sequence length 320
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1lcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lcyA02
3PDVA 2FE5A 1FCFA 4JOKA 2PTCE 3QGLA 5DPAA 2ILNA 2OXSA 4B71A 3RXQA 2SGAA 2ZCHP 1HPGA 2BD4A 1SB1H 2ZP0H 4K69A 3T25A 1NFUA 2VVVA 4YOGA 3ZV9A 4D7FA 2QAAA 1Q3OA 1CQQA 1HAYB 1BUIA 1P12E 2EEKA 2DKRA 5AVDA 3CH8A 5DP7A 2DE8A 3DT0H 2A45B 2V90A 3O5NA 3GCHC 1FC6A 2ZZUH 1MBQA 4FUCA 2JETB 3P6ZB 3GDSA 1C2MA 2KAIB 4NIWA 4YDPA 4E06H 3M36A 2Z6BD 3SORA 4ZKSU 4YT7H 1YPKH 4MNYA 3S9BA 2PKAB 2TPIZ 1P06A 4MQAA 1LCYA 1U6QA 3JZ2B 1CT0E 4INKA 5F03A 1OBZA 1G32B 3KZEA 3O8CA 1TNGA 4IC6A 3PV2A 3P95A 5FPTA 3LONA 1SQAA 2QXHA 4X0WU 1ZRKA 4Q2OA 1JIRA 1Z86A 1LHEH 1XKBC 2F91A 1ZZZA 5ESBA 1INCA 1O3IA 4FUHA 3H7OA 2ZPRA 1VCQA 1GHXH 3BEUA 5HFBA 3QTOH 3LNYA 4BOHA 4K6YA 5GWZA 1FY3A 1Z71A 4X6NA 2FS9A 1WUNH 1SPJA 4CR9A 2H3MA 1A0JA 3RC5A 4AORA 2PR3A 3K1RA 1AN1E 5LH8A 4NMTA 4TWWA 1OOKB 2ZGBH 1MKXK 4ZKRU 3SJ8A 1DICA 1P1EA 4DIIH 1A5GH 3NK8A 4X6PA 7GCHF 3F68H 3D23A 4WF8A 3ZZBA 2D8WA 3RXJA 2H2ZA 2Y6TA 4AFSA 1G3EA 3K6YA 1KWAA 1F5KU 2FPZA 1E0FD 3RXAA 1MD7A 1QR3E 1V2ST 4KELA 1GBKA 4GAWA 2AEIH 1L1JA 1LQDB 1KXDA 1P1DA 1P0SH 3MU5A 1PQ8A 1OYQA 3U9AH 4Q6HA 5HF1A 1VJAU 4INLA 1YCPH 2Q6FA 1MTVA 1GMDG 3E3TA 4MNWA 4IN2A 4ISHH 3E17A 3B9FH 1MH0A 2DM8A 2D8IA 4A1TA 2BD9A 4WYTA 1Z6EA 2EI6A 2WPMS 3V12A 1AO5A 1TB6H 1ACBE 1O5AB 5A0CA 1N6XA 4Q7YA 3ZVBA 2C8YB 2TGAA 3PS4A 1HJ9A 3WY8A 3Q3XA 3TNSA 3CYYA 4IS5A 1D3QB 2L97A 4OEPA 4D8NA 2G2LA 1PFXC 1LHFH 4ZHMU 1FI8A 2G4UA 1SI5H 5E0GA 2KJDA 1BJUA 1TRYA 4XE4A 1ZSKA 2GD4B 2WPHS 4NWKA 2P59A 2JKHA 1T4VH 1WIFA 2GCTC 3BSQA 1WU1A 4K76A 3M5NA 1N7TA 5I46H 5T6FA 2C8ZB 3O8DA 1VCWA 1UTKA 4KFVA 3ZRTA 1L2EA 2QXGA 4YZUA 3OY5U 1UO6A 1OZIA 2Z9LA 1K9OE 2GZ9A 1PQ7A 1DANH 1EXFA 1MKXH 2XWBI 3FP6E 3PMHB 1YLCA 1IQMA 1J14A 5L30H 5DP9A 4MPVA 3ZZCA 4IN1A 2M10A 4X8SH 1V1TA 1MTUA 1O2OA 4GLYA 1HDTH 1QBNA 1P11E 1ARBA 4FGMA 3LNXA 1W7XH 3LGIA 1DLEA 1O2SA 4GVDA 3ID1A 5J4QA 4ZMAH 4OEOA 4E3BA 4JZ1A 4NFEA 2VNTA 1Q3XA 4AX9H 2EAQA 2YNBA 2ZF0H 4YTAA 3RLEA 4GHQA 5TJXA 3H7TA 3RXOA 3SGAE 1BQYA 3MH7A 2OS6A 4HZHA 1C9TA 1V2UT 2ZDKA 2K1ZA 2BOHB 2UUYA 1RGWA 1DE7H 3RXEA 8GCHG 4NSVA 3UWIA 4YM9A 1NROH 2BYGA 4JOJA 2CN0H 1UJ1A 4H4FA 4A1VA 4BAKB 1OWHA 2D1JA 1TGSZ 4TPYA 2PKSC 5FCRA 3QIKA 1ZHRA 1TNKA 4JORA 3G01A 1W0ZU 3V0XA 5EQQA 1AD8H 1CBWB 3SW2B 2FOCA 1RRKA 1SGIB 2GDDA 2GT7A 2PZDA 4Q2PA 1KXAA 3UWJH 2KQFA 3B76A 1O2JA 3EYDA 2Y7XA 1BITA 1C2GA 4IW4E 5HMAA 2EGNA 1ZR0A 1PYTC 2FYRA 2KYLA 1GHAG 5EPNA 4O06A 1B7XB 2QGRA 4ABAA 3M37A 1C5TA 1GMCG 5LPRA 3E90B 5GCHF 4O3TA 1F0SA 1OXGA 2VRFA 2I6VA 2BXUH 3MTYA 5E0JA 4I8HA 1KXFA 1GM1A 4A6LA 1C4V2 3PYHA 7LPRA 1DX5M 1EX3A 4Q7XA 3S7HB 4AB9A 3DIWA 3SOSA 4H6TA 1SLXB 3WKLA 4WMFA 1OS8A 3MH5A 1X45A 1QFKH 2M0VA 3MNBA 2BY9X 4ABDA 2ENOA 2BDHA 4BTUB 1TOCB 2FOGA 3QO6A 2B8OH 3GY6A 1O30A 3VB7A 1YPHE 1WHDA 1P2OA 4UD9H 4DVAU 3BN9A 1LHGH 1EZXC 2OLGA 3Q00A 3TNTA 5DP5A 1HXEH 1RTLA 1HAOH 1TMUH 3PV4A 1BRAA 1W13U 3E16B 1HAVA 3RXKA 1NC6A 1O2IA 3O8BA 1NN6A 3A7XA 2Z9KA 2CSSA 1QRZA 2H9HA 1GJDB 3VGCB 2P3TB 2V1WA 5H3JA 1FJSA 3KNXA 4P0CA 1C4U2 1TX6A 2ZPSA 2O8UA 1TQ7B 1T32A 1UEZA 1GHZA 3M5OA 4ISOA 1V2NT 3LPRA 1NTPA 1SMFE 4NMRA 1XUKA 3NUMA 4ABFA 1BZXE 3BIVH 1HGTH 2NU0E 2GV6A 1TMBH 4F49A 2HPPH 3S0NA 1S0RA 1ELFA 1AWHB 1TP5A 1MBMA 3GDUA 3GICB 4UFGH 3RP2A 2XXLA 4CRCA 1RS0A 1UVSH 1O2KA 2D26C 2GMTC 2O9QA 3ZZ5A 1L4ZA 5T6DA 1FY4A 2PWXA 1UCYH 5I25A 3NFKA 1OP8A 5HYOA 3F9FA 1CVWH 2OTVA 3SJOA 2O2TA 1UCYE 4UEHH 4K75A 1O2NA 3SFJA 3A7WA 2PNTA 4Y8XA 3STJA 1O3KA 4B1TA 4VGCC 2QN5T 1WF7A 3IITA 1VJ6A 3KQCA 1LPGB 1V5LA 1SHHB 1O3EA 1QCPA 2YNAA 1GCTC 2WV4A 4Y7AA 3KZDA 3DFLA 1GVZA 1BTUA 2MHOA 3P8GA 1ZRBA 3VB5A 1AMHA 2BY5X 2VGCC 2GGVB 2A4RA 3T62A 1QHRB 1XMNB 3VB3A 2RA3A 4I8LA 2FO9A 2GP9B 2IJOB 2PFEA 3K2UA 1MQ6A 2QV1A 1XZ9A 3F9HA 3RXDA 3ZVCA 2XC5A 2C93B 2QF3A 4R8TB 1MKWH 2BM2A 2PUXB 1N7FA 3QE1A 1HAVB 4K8BA 3FZZA 3ENSB 3LDXH 1D5GA 1NRPH 1GBDA 4GSOA 1D6WA 3W95A 5HDYA 1CHOF 1SGQE 4D76A 1A7SA 1S82A 3SOEA 2CV3A 2FLRH 2WUBA 2M0ZA 1AB9B 1GI9B 4NFFA 4ABJA 2ZC9H 8LPRA 3SJ9A 2JETC 1EB2A 4QT8C 1FIWA 5FXLA 1V62A 2VVCA 2F3CE 1OBXA 1X5RA 2O8MA 1WI2A 1B5GH 1TBRH 1GMHF 4CRFA 2KV8A 3SV8A 3SU4A 3PMBB 2K1QA 3URDA 2I04A 4WJG2 4X2XA 3ZZ7A 1S5SA 3QN7A 4I33A 2A7CA 2M0TA 3KHFA 4X8TH 4H42U 3R3GB 3BG8A 4FUFA 1ANBA 3PTBA 5F8TA 3RL8A 5E2OA 2CF8H 2ZCKP 3BTGE 1FPHH 4NIXA 3AW1A 1VZQH 2SGDE 2EA3A 4CR5A 3LJJA 2WPIS 1HXFH 1NFYA 1GVKB 1AVGH 4A7IB 2C8WB 4OS1A 5EYZA 2FLBH 1FV9A 2BY8X 2SFAA 4MPUA 3M7TA 5FB8C 3I78A 3TH3H 1LO6A 4Z0KA 4ISLA 4JZEH 4Y11E 2Y80A 1YC0A 1KLIH 3GYMA 5DTHA 5ETXA 1AZ8A 1BTYA 1EP5A 1O2VA 2AS9A 8ESTE 1GI8B 2Q3GA 2ZTYA 4CRGA 2ZU3A 1FN6A 2H2BA 4Q2KA 4NXRA 4JYVH 2TBSA 4THNH 3Q3KA 1Z8RA 2XBYA 2EDPA 4Z8JA 3VB6A 2O8WA 1E38B 2GZ8A 1U37A 4NMQA 5GIBA 5G1EA 3A87A 1G3BA 2GV7A 3MHWU 5L2YH 1P9UA 5L2ZH 3N7OA 5J4SA 4DOQA 3QDOA 3UREA 5C67A 2KPLA 1BMLA 1V2RT 2G5VA 1PPCE 1ELDE 4AG2A 1DVAH 3TVJB 1WJLA 3QDZB 2SGPE 1QAVA 2GZVA 1QURH 5ESTE 1DWDH 3A81A 2RCEA 4UE7H 5G4BA 1A61H 1C5SA 4NMVA 4ABGA 1I16A 2QIQA 3HPKA 1JBUH 1H8IH 1L0ZA 1TONA 3A8DA 1VAEA 2ZQ1A 2ZU5A 1ZHPA 4TWYA 1GPZA 5H4IB 2GX4A 2OQUA 3SNDA 1DXWA 2F9PA 2ALVA 1O32A 1UMAH 2ZG0H 4Q2NA 2BDBA 4OS6A 1O2UA 3ATWA 2AMPA 3BTKE 1MTNB 1X8SA 1NO9H 3NXPA 1CU1A 2HNTE 1ABJH 4XSKU 1FY8E 4KTUA 3UOUA 2W3IA 2M0UA 1O2ZA 3ZZ6A 3O8RA 2O8LA 3ATIA 1PQ5A 3I18A 4ZROA 1BMAA 5GJ4B 1YCPM 4KGAA 1C9PA 4DY7B 4IBLH 3E8LA 3OSYA 1TLDA 1N6FA 4NSYA 2ZFRH 1TX7A 3NZIA 5HEBA 1QQ4A 1IQGA 2ODQA 3BTTE 4Z6AH 3RXIA 1HIAB 5HGGA 1S0QA 4J1YA 3MNSA 2YUYA 2VU8E 1GL1A 1D6RA 1MU8B 3HKIB 3R68A 1O5BB 5DP3A 3RUOA 1EAWA 1UJVA 1K2I1 1TBQH 1RTFB 4JCNA 4Q7ZA 1VB7A 2XCNA 1ZJDA 1ABIH 1CA8B 2BD5A 4TYDA 1UHPA 2J38A 1AGJA 1C5ZB 1IQKA 1MAXA 2ANKH 4ABEA 1P09A 1YF4A 3SGQE 2R3YA 4WVPE 2I6SA 2VIWA 3UUZA 5HFEA 3BTQE 3MNXA 5BPEA 3SU3A 7ESTE 2ZFPH 1RXPA 1XUIA 2B0FA 2VSVA 4XFQA 4NG9H 3RMLH 1BBRK 4D9RA 1N6DA 2DUCA 3LC5A 2ZPMA 1PPBH 2CGAA 2AWWA 1QAVB 4X2WA 1DY9A 3M35A 1IQLA 1KDQA 5F8ZA 1XX9A 3RU4E 5CMXH 3VPKA 1F0TA 2RA0A 1SBWA 1EAIA 4GCHF 1T8MA 2HGAA 1C5OH 1CBWC 1GI2A 3ODDA 2C3SA 1OP2A 2XNIA 2Z7FE 3CENA 3SU5A 4JYTA 4X1NU 1LPKB 1O3HA 4YESB 1FN8A 2PGBB 1KXBA 4GHTA 1DUEA 2SGFE 5IYTA 1XUGA 2A1DB 4YOJA 2JXOA 2GCHG 4GVUA 2V3OH 1QQUA 1THSH 1Z8JB 1KLJH 2EDVA 1JXPA 1Q31A 2A32A 3QTVH 1Y3UA 3ZZDA 4FU9A 2BDAA 1QBOA 4I8KA 1M5ZA 4IMZA 1WFGA 4JZDH 1SSXA 2JWEA 1GBMA 3V7TA 2IWPA 1LTOA 4TY7A 2I6QA 5C5OA 3H5CB 1AIXH 2BQWB 1GBIA 1TWXB 1T8LA 3P70B 1YPGH 1XXDA 1DT2A 2VIVA 1CT4E 1PPHE 1EZUC 4WMEA 4BXSA 1NPMA 1TABE 2KBSA 4CBNA 1WYKA 1MQ5A 2M5TA 3PLBA 4MLFB 2SGEE 4HI3A 4GPGA 1EAXA 2C8XB 2X7ZA 4AYYB 1DPOA 1TGNA 5JYIA 1WQSA 3KHVA 1ELBA 2XCFA 4JK5A 3SO3A 6GCHF 3VGCC 1FAXA 1K28D 2HGTH 2P94A 1YBOA 2FIRH 8GCHF 3BF6H 1X5NA 3DFJA 5EU8A 4X6MA 3A8CA 4MVNA 4NNLA 1F5RA 2IWNA 1O36A 1QNJA 1CHGA 1MUEB 1H9HE 2M3MA 1QA0A 4E7NA 1GBCA 2JIKA 1QL7A 1KDQB 3SI3H 1C1OA 1NRQH 3HPMA 1ANEA 1MTWA 4UU6A 1PPEE 3LOXA 3AXAA 1I92A 3SV2H 2W7UA 2ZA5A 1C1UH 1TPSA 4ZHAA 1H4WA 2BD3A 2UWLA 2VWLA 1GHAF 2VJ1A 4NMPA 1Z1IA 1GMCF 4YLUA 1RY4A 1NM6A 1YPMH 3RXPA 1HFDA 3D49H 1ZGVA 1P01A 1QLCA 1X6DA 1UVPA 2ZDLA 4LK4A 3RXBA 1TNLA 1CT2E 1AY6H 2V0BA 4CHAB 1A3BH 1G3DA 3E91A 4FU7A 4Y0YE 5C1YA 1PYTD 2YOLA 3LU9B 4Q80A 4L8NA 2HNTF 2J4IA 2Z9IA 2VIQA 3FFGA 4K5ZA 4MPAA 1C5PA 2CMYA 2UWPA 2FNEA 1O2XA 2ZEBA 1C5YB 2FOFA 3MWIU 1AU8A 1HUTH 1SG8B 2FS8A 4MPWA 3A86A 2DAZA 2OGPA 2HE4A 1QL9A 3EE0B 2H9TH 2BXTH 2AH4X 2OINA 4Y0ZE 2FODA 2Q6GA 3PMAB 1TPPA 1X5QA 3NKKA 1MC7A 1IU0A 1GBHA 1GBFA 3LT3A 1GVLA 4X6OA 3DJAA 1HRTH 3SUEA 3R0FA 1EOJA 1CGIE 1O3CA 5CE1A 3PWBA 4DIHH 4I31A 1P2NA 3WKMA 1ZPCA 3QX5H 2EEHA 3SHWA 4ABBA 3ZZ9A 1AB9C 1OYTH 4BTTB 3SU2A 3TPIZ 1C1VH 1W10U 2DMZA 1BTXA 4TY6A 2QXIA 2QKUA 1O2LA 2AMQA 1PPFE 1WF8A 1ANDA 2EEGA 2BOKA 3U8OH 1EUFA 5EQSA 2QC2A 1AHTH 1C1NA 1NRSH 5E2PA 2CSJA 5JB9S 2JILA 1P2KA 2VPHA 2ULLA 3CP7A 1BTZA 2PKUA 1RGRA 4NMSA 1DS2E 1NS3A 1S81A 2Z3EA 4KTSA 2QYIA 3U98H 1HYLA 3UR9A 1C1WH 2ANYA 1F92A 1TNJA 5A8ZA 3ID4A 2OQSA 1WFVA 3DHKH 3GY8A 1IQFA 3ZZ4A 2BZAA 3QLPH 2WYGA 5EXNA 3MYWA 1OKXA 2DLUA 4X8VH 3GSLA 2F9OA 1F5LA 1O37A 3PWCA 5A8XA 1ELVA 3GY3A 1P03A 2ZFFH 3QZQA 5C20A 1LVYA 4JZIA 1YLDA 4O03A 4NXQA 2PV9B 1QJ1B 5GXPA 1AFQB 1FXYA 2FOEA 1NESE 1C1QA 2WINI 1JWTA 2LUIA 1GJ5H 1HCGA 1UK2A 2TGPZ 2LOBA 2JH5D 3S9CA 1E34B 4F8KA 1JIMA 3ELAH 4REYA 3Q76A 2BX3A 3BG4B 1AUTC 2BTCE 4X1PU 1YPHC 2BMGB 1TGCA 3GISB 3RMOH 3ZZAA 4YYXA 1AE5A 1MMJN 3FZDA 3U8RH 3SV6A 4JOEA 1J8AA 1O2QA 4NZLA 1NRNH 3KGPA 1Q2WA 1SFQB 2J94A 1OWKA 2ZHFH 3LGVA 4YT6H 3ODFA 3PDZA 5JBAS 4Y79A 2FOHA 1P02A 5GNDA 3RDZA 1V2PT 2QXJA 3STIA 2B5TB 1ZMJA 3A88A 2REYA 4B2BA 2VH0A 6LPRA 3E0NB 1UVTH 2WPJS 1HJAB 1GDQA 1RJXB 1P10A 2ZGXH 3HATH 3EGKH 1B0FA 1SGTA 2ZWLH 3GCHB 5T6GA 4AOQA 2ANWA 2ZDNA 3BTWE 5F3XA 1E36B 2MX6A 1K1NA 5JBTA 1NZQH 2QA9E 1IOEA 1GI6A 4I8GA 1MTNC 1GBEA 4NZQA 2BQ6B 3M3VA 5FBEA 2C4FH 5A0BA 6ESTA 1QY6A 2KL1A 3SHAH 3QJMA 3TH4H 4FUJA 2NU4E 4JOGA 3BPUA 3HGNA 2C90B 5TCAA 2OC7A 5GDSH 2P16A 3ATKA 3EAJA 1OWEA 3CS0A 4LOYH 1XVOA 4AB8A 1A5IA 3P92A 5HF4A 2PA1A 2ANMH 1ETTH 4K60A 3CBZA 1JMOH 2ZHQH 1IHJA 3RLWH 2AFQB 4DURA 1HAPH 2KOMA 3RXCA 5B6LA 3ZYEA 4ZHLU 2W3KA 2UZCA 3QJNA 1F7ZA 2JH0D 3RC4A 1TGTA 2OSGA 2A7HA 1ELGA 3K65B 3MH6A 4K1SA 2ZTZA 1O2GH 2OC8A 4OGXA 3S9AA 4JMYA 4UFEH 3GOVB 4M7GA 1GI1A 3BTHE 4NMOA 2A2QH 3PB1E 3VXEH 4WWYA 1C1SA 1O3JA 3KF2A 3MMGA 7KMEH 2DJTA 3SGBE 1E37B 1AFEH 1EPTA 3SNBA 2CHAB 1J15A 2CF9H 2QF0A 2HVXA 1SVPA 2BD8A 4DG4A 3MH4A 3T2NA 1FY5A 1TRMA 1L4DA 3VQGA 3UFAA 1UM7A 1UFXA 1L1GA 2R2MB 1Q3PA 4Y6DA 3AVZA 4ISNA 2OC1A 1YBWA 2EGKA 1H9IE 1O3LA 1NRRH 1Y7NA 4ASHA 2FWWA 1P8VC 1O2MA 2V35A 1DITH 2Y5HA 3QWCH 1C5RA 1EOLA 2ALPA 3BIUH 1FY1A 1BCUH 2FI4E 1O5CB 2A4GA 2FOAA 5CHAB 3KEEA 2ZHDA 2OBOA 5EOKA 4B2AA 1UK3A 2K20A 3TU7H 1K32A 2AIQA 1SC8U 1O3BA 3V13A 3F9GA 1DWBH 4UFFH 4NXPA 4B76A 4LXBH 1WSSH 4BANB 1FIZA 3EDXB 2THFB 3CBYA 1NU9A 1Y8TA 5K7RA 2P3UB 2V3HH 1U38A 3AASA 5G1DA 4ESTE 1TALA 1DSUA 4JYUH 1DY8A 4WXIA 1YKTA 1DM4B 4Y71A 1N1LA 2IOTA 3UPEA 3P8FA 1GI5A 3SQEE 2F9NA 3RXVA 2G5MB 2OUAA 2FOBA 2XBWA 2KAWA 2LC7A 1GG6B 1YM0A 2SNWA 4TPIZ 3RXRA 1VA8A 4U01A 1C5QA 2PHBA 2JINA 1O3GA 4XBBA 1Z8GA 4NA9H 1DWEH 3L4FD 4X1RU 3A7ZA 2R2WU 2VIDA 1TQ3A 3PO1B 1O39A 1W9OA 4XBCA 5C2ZA 3EA9A 1GDNA 1V2WT 1O3NA 2FN5A 1LVMA 1TOMH 1UJUA 3MO6A 2CS5A 4DJZB 4AG1A 1EPTB 2ODYB 1P2IA 1SGCA 2ESTE 5F67A 1NT1A 1O34A 1FONA 1UVUH 4INHA 3A8AA 1EZQA 1QAUA 1V2MT 2L4TA 4X1SU 1EASA 2P93A 2E7KA 2OBQA 1O3DA 2A4OA 1FZZA 1THPB 1V2KT 2B7DH 4B73A 1BMMH 1Y5BT 3RXLA 1H9LB 5FX6A 2Z3CA 5AF9H 3OTJE 1SOZA 3TJVA 2FZZA 3HPTB 3DD2H 1ZUBA 3URCA 5AFYH 1K1MA 3L33A 1WTGH 1DUAA 4OS7A 4WH6A 2GCHF 2G4TA 2R0KA 4CH2B 2ZECA 1YGCH 3TSVA 1W2KH 2J34A 4Y7BA 2VSPA 3JXTA 4CHAC 1S84A 1WBGB 1WQVH 1IQJA 2HRVA 3TSZA 2BD7A 3P8NA 4ZAEA 1SGFG 3RXMA 1GJ7B 1EB1H 1WOFA 2HNTC 2A5KA 1W14U 3K9XB 4O97A 3GY4A 4OS5A 3LH3A 3SUDA 5HFCA 2RG3A 1YP9A 1EZSC 4UU5A 2I1NA 3RXTA 5D13A 4B74A 2GTBA 1HAGE 1V2OT 2BY6X 2TGDA 1BTHH 1D9IA 3B8JA 1Y5UT 1UEPA 2ZPQA 2FM2A 3MU4A 1LKAA 4AFZA 2G51A 3RM2H 2OPGA 3VQFA 2ZU1A 4U30A 5TCCA 1A5HA 1S83A 4HTCH 3MFJA 3DA9B 1GHWH 1LDTT 3ZVAA 4WMDA 2GVFA 4JK6A 3AW0A 1ZOKA 1A3EH 3MO3A 3SUGA 3EQ0H 2WYJA 2H5DA 1K1JA 1XXFA 3QUMP 2Q1JA 1J17T 1C2IA 3UIRA 4DCDA 3B23B 4I8JA 1O3PB 1LHCH 4HFPB 4WY3A 5EXMA 1ZTLA 4OS4A 1SOTA 1VCPA 1UTJA 5DP8A 1C1PA 3A7YA 4WYUA 1ZMNA 1GBTA 2BLWA 1UTQA 1B8QA 2A5IA 3UNSA 2HLCA 1GHBG 1O35A 4I32A 2JREA 5A2PA 1IHSH 1KXCA 4BAHB 4X2VA 1KYNA 5HXFA 4BNRA 1R6JA 2AERH 2ZI2H 4DT7B 1BOQA 1C5NH 3R69A 3QGJA 5DG6A 2IWOA 1TA2A 1WCZA 4Y8ZA 1AQ7A 1NFWA 5DJ7A 1FLEE 1HAIH 3AAUA 1C2EA 1P04A 1ELEE 2NU3E 2OC0A 1EAUA 3GCTG 4ABHA 4K8YA 2J2UA 1OX1A 1F0UA 1VR1H 2FI3E 1GMDF 4RI0A 2W5EA 2GDEH 4Z33A 3ATLA 1ELTA 1D3PB 3MU0A 3ZZ8A 1D3DB 2Z9GA 2EHRA 2BDCA 2ZTXA 1O5EH 1V2JT 1GCDA 1ZSLA 3M7QA 4ZH8A 3PLKA 3F9EA 3EA8A 3PV5A 3TGKE 1BRBE 1HV7A 4ZKNU 1AFQC 4JOHA 3VFEA 4BAOB 2H3LA 5EPYA 5I7ZA 2QBWA 2Y5FA 1P3CA 2UUJB 2AINA 2XTTB 4MNVA 1BRUP 2XC0A 1O2TA 1ZGIA 4P2AB 4JZFH 2BQ7B 2XBXA 3BG4C 3SBKA 1BE9A 1AWFH 2WUCA 2HPQH 1DLKB 2YT8A 4O3UA 1SLWB 3NPSA 3S69A 2PDZA 1OWJA 1OWIA 3ZV8A 1O3FA 1VITG 4FUEA 4IMQA 1OWDA 1GJCB 2RCZA 1EJNA 2HWLB 5C5NA 3SV9A 5GLJA 5GPIB 5K0HA 3HKJB 1OSSA 1EJMA 3ID3A 8KME2 1JRSA 4K72A 1GJAB 4DW2U 3BTME 5EG4A 1FC9A 1UVOA 2FTMA 3LJOA 3SU6A 2BHGA 2XC4A 1P57B 4FXGH 3P17H 1ZTJA 1GDUA 3U1JB 1UTNA 1S6HA 1SGPE 2WPKS 1HJAC 3RU4T 1RIWB 1HBTH 2G55A 3PMJA 1C2DA 1ELCA 1QL8A 2BLQA 5SGAE 3SNEA 2KJPA 1BJVA 1YCPK 3U8TH 2EI8A 2O8TA 5HFFA 1UK4A 5FHTA 1Y3XA 3LC3A 3IG6B 4BXWA 1UTPA 4FVBA 2VIPA 1XVMA 1ZJKA 1TPAE 1SGYE 1CGHA 1O3OA 1QTFA 3T27A 4LZ1H 4YOIA 1UEQA 3MOCA 1BBRH 4FUIA 5AHGH 2ODPA 4A5TS 4AYVB 3NGHA 2EI7A 1BBRE 5E0HA 3PM3A 4NA8A 1KXEA 1K21H 4NNMA 1GBJA 2BDGA 6CHAB 2A7JA 2TRMA 2W7SA 4Y10E 2OMJA 2G8TA 3ZVDA 1K1OA 3SHUA 4NIYA 1TNHA 1CA0B 1P2JA 2D2DA 3QGNB 1T8NA 1BMNH 2V6NA 4WH8A 2H1UA 3GJ9A 3A80A 3E6PH 3SNAA 1N7EA 4NGAH 3LIWA 4N6XA 3I29A 1KTSB 3OTPA 2PGQB 1W8BH 1WAYB 3FP8E 4CRDA 1G2MA 2WPLS 3KQDA 3PROA 3SHCH 3GDVA 1IU2A 4RN6A 5DK1A 2FCFA 1ESTA 2NU2E 1AE8H 2AIPA 1QB1A 3SI4H 3DJ1A 1SR5C 3SUFA 1N8OB 2KG2A 4AFQA 3AAVA 3HGPA 1A46H 1WHAA 3RXUA 4IGDA 1M9UA 1IQIA 4Q3HA 2KA9A 3GY7A 1XUFA 2R3UA 2CHAC 4E34A 9ESTA 5ABWA 4Q6SA 1W9QA 1FUJA 3TSWA 1TFXA 5F8XA 1GWAA 1TMTH 1YPEH 3GCNA 1TP3A 1E35B 2VINA 3BEIB 3RXSA 1FC7A 4CRBA 1C1MA 2CXVA 3S7KB 3GY5A 1C4Y2 3SQHE 2DLSA 5E1YA 1D3TB 1KLTA 1P2QA 1O2PA 2CJIA 5DP4A 4AZ2B 2FDAA 2ZDAH 3RXHA 1Q7XA 3LKWA 1V6BA 1ZYOA 1IQHA 5JB8S 1UF1A 4LMMA 1KSNA 1G9OA 1YPLH 2AWUA 1GGDB 1QJ6B 1LMWB 2G00A 3TK9A 2FMJA 5CHAC 1O3MA 3A7TA 1GQ4A 1NY22 4IC5A 1O0DH 1VGCB 1AZZA 3M7UA 3PLPA 2ZO3H 2KJKA 1OP0A 1Z7KA 4ZXXH 1W9EA 2R4HA 1UM1A 1V6DA 3K82A 1W0YH 3ZYDA 3CBXA 1ZPBA 4NA7A 1B0EA 1K1LA 4GCHG 3RM0H 4EDJA 3RLYH 1BA8B 2FYQA 2JH6D 3MO9A 1C2HA 3LH1A 1HJ8A 1THRH 2XBVA 1MFGA 2P8OB 2ZKSA 1LHDH 1Z6JH 1XUJA 4UFDH 2FX4A 3C1KA 2W4FA 4FU8A 2UWOA 3BTDE 1SQOA 1GG6C 2YUBA 3M5MA 4PROA 2FX6A 4A1XA 2TIOA 4GVCA 3D65E 2ZQ2A 1SL3A 3R0HA 3A89A 2EV8A 2ASUB 1F0RA 3PO1C 1HB0B 3ID2A 5LGOA 2F0AA 1RFNA 5PTPA 2ZCLP 3OU0A 2ZGJA 4G69A 1C2KA 3C27B 5JBCS 2A5AA 1MCTA 1WG6A 5A09A 4XOJA 1HAXB 1GI0A 2BYAX 3Q3YA 3LGUA 1EPTC 3A85A 2BD2A 1NTEA 1A0LA 2XWAA 1CGJE 1QIXB 1QBVH 1T4UH 4BAQB 2OP9A 2BLVA 3BTFE 3UNRA 5E21A 5E8EH 1T8OA 4R2ZA 1LQEA 1O2YA 4MG3A 4BAMB 5A8YA 5LPFA 4JOFA 1QB9A 1ZMLA 1TAWA 3UOPA 1HAZB 2PW8H 1WI4A 5FBIA 3W94A 2XW9A 1O5FH 1SGNE 2SNVA 1N6EA 2BVSH 6GCHG 3A7VA 1S6FA 2BVXH 3UTUH 2A4QA 4Y8YA 4J2YB 1ZLRA 3UQOA 1ARCA 1O5DH 3SN8A 3KIDU 1MAYA 1SGRE 1UEWA 4CREA 4NCYA 1T2MA 2AGEX 5EW2H 1H1BA 3FP7E 3I4WA 4CH8B 3Q77A 1TQ0B 1XM1A 5T3HA 4YO9A 2QKTA 4U32A 2QG1A 1DFPA 3QK1A 1LKBA 2FOMB 3DJ3A 3MU1A 2R9PA 2VIOA 1C2FA 1W3CA 2G5NA 3HK3B 4RKJB 4K1TA 1SGFA 2L4SA 4XDEA 1QGFA 7GCHG 1GJ8B 1U3BA 1WH1A 3T5FH 1GHYH 1H8DH 5FPYA 3SU1A 5DO4H 2A2XH 1O2HA 2ZDMA 2ZDVH 2HE2A 1EQ9A 2AWXA 1RGQA 1G37A 1UCYK 3M61U 2FP7B 2VB0A 2W26A 2DB5A 2BB4A 1VITH 4CRAA 3TGIE 5HEYA 1A0HB 4K3JA 4FUGA 1BT7A 1IQEA 5HFDA 1O33A 4UONA 2AGIX 2BY7X 2XYAA 5E11A 1MZAA 2ZFTA 4X1QU 3O46A 1V2LT 2A31A 1T31A 2KRGA 2FI5E 2PTNA 2JOAA 1UTLM 5F6MA 2IWQA 3RMMH 3U69H 2J92A 3KCGH 4D7GA 3JZ1B 2ZHWH 3PTNA 1L6OA 1QA7A 1KTTB 2Z9JA 1SHYA 3KN2A 1ID5H 1BRCE 3CS7A 2OQ5A 5AFZH 1TBZH 4JOPA 2NWNA 1GBBA 4B75A 3SV7A 1QRXA 1FPCH 5EZ0A 3V3MA 4ZUHA 1MKWK 3BV9B 1G3CA 2GZ7A 2YT7A 1XUHA 3L6PA 1G30B 3LGWA 5HM9A 1C5LH 1DWCH 1X7AC 2DE9A 3EGHC 3VB4A 4Q2QA 2KOHA 3GY2A 3KQBA 3E1XB 3K50A 5JBBS 4XHVA 3F6UH 3EGGC 2EEJA 3UY9A 1SFIA 2QY0B 2XRCA 2VWNA 3TK6A 1ZTKA 1KEFA 1G2LA 1O5GH 2Q9VA 3GCOA 1W12U 1LVOA 1QB6A 2WL7A 1AI8H 1O2RA 1WV7H 2UUKB 2W7RA 2HALA 3M3TA 2BDIA 5A0AE 2YTWA 5FCKA 5C1UA 1FNIA 1LVBA 2IPHA 4JL7A 4NWLA 1MU6B 1FMGA 2ZNKH 3F1SB 3IWMA 5EXLA 4AN7A 1A4WH 4ABIA 2B9LA 2A0QB 1CE5A 4MTBA 4OS2A 1V2QT 4ZKOU 1Z8IB 3T28A 3TMHA 3OX7U 1JRTA 1C5XB 1GI4A 2F9UA 4K2YA 3RC6A 1UTMA 1G36A 2EDZA 5DP6A 3TJOA 1P3EA 5HETA 3KQEA 3FY5A 1TIOA 3VXFH 5C1XA 1O38A 3I1EA 1UHBA 2PKTA 1IAUA 1EATA 3NFLA 1MTSA 1V2VT 5B6OA 2Y5GA 3KL6A 3T26A 1DOJA 3L3TA 1GBAA 4Y76A 5EGMA 3A83A 1GBLA 3TJUA 1WTHD 2QCYA 1G9IE 1ESBA 1XKAC 4R0IA 4H6SB 3HVQC 2F83A 2ZU4A 3UQVA 1U39A 1Y3VA 2Q6DA 1F2SE 1N6YA 2NU1E 1ETRH 2Z94A 3E0PB 1J9CH 2H9EH 3NWUA 1BFEA 1NF3C 1BTPA 1KY9A 1ZOMA 1GHBF 2OCSA 2SGQE 3BEFB 2BVRH 2GCTB 1GL0E 2VVUA 1SLVB 2FXRA 1P9SA 4X8UH 1O31A 2EGOA 2R0LA 3ITIA 5GCHG 1RIWC 2VZ5A 2VWMA 2ZFSA 3ZVFA 3CC0A 2Y7ZA 3UR6A 1OBYA 1HLTH 1P05A 1EP6A 5FPSA 1PDRA 1RD3B 1GJ6A 3LGYA 5IDKA 2FESH 3TGJE 4GHNA 1HNEE 2AYWA 2OCVB 1CSOE 1AVWA 4H11A 2ZHEH 3GCTF 2Y82A 1PJPA 3SU0A 2I4SA 4KKDA 5JPMH 4WXVA 2UUFB 1W7GH 2AMDA 1EJAA 3RU4D 3NCLA 1Y5AT 4HOPA 1O2WA 2ZIQH 3D62A 1GQ5A 3TITA 1K1PA 1SQTA 2J95A 3A82A 1NFXA 1FQ3A 3FAOA 1BDAA 2HOBA 3MNCA 3SJKA 2PSYA 3ZVGA 1C2LA 6CHAC 2P3FH 1DSTA 1K22H 1T7CA 4GUXA 4MDSA 2ZGHA 1CA0C 2EXGA 4I7YH 1TPOA 3ZZ3A 2STAE 1C5MD 3DORA 1ORFA 3DUXH 1JOUB 2Z17A 1DXPA 2G52A 3ATMA 4KFWA 4CBOA 4OAJA 5HM2A 2TGTA 1HIAA 2F5YA 2PUQH 1UHBB 2ZGCA 2ZU2A 3QZRA 2J9NA 5E22A 2PKSB 3TK5A 1GHVH 1VITF 4KP0A 2WV5A 3BTEE 1BIOA 1N8OC 2G81E 3SNCA 1C5WB 3FVFB 4ISIH 2GKVE 4XBDA 3I77A 1HAHH 4MPXA 1EKBB 1MD8A 5C3NA 2BZ6H 5E6PB 4BTIB 2EEIA 4E35A 9LPRA 2IN2A 4AGKA 3TJNA 1Y59T 1V2TT 2QKVA 4X2YA 2D90A 2P3WA 1SGDE 1Y3WA 1AKSA 2OD3B 3K6ZA 1QJ7B 1TX8A 1MFLA 3A84A 3RL7A 1ZHMA 5JXBA 5EW1H 1S85A 4ZXYH 3U1IB 5HEDA 3GYLB 2LC6A 1GJ9B 1MCVA 1C5UA 1P2MA 2RDLA 1ANCA 1GGDC 1RTKA 1PPZA 4PQWA 1TRNA 2EJYA 1BB0B 3P8OA 4SGAE 1QRWA 1ZSJA 3A8BA 1A1RA 1O3AA 5L6NH 1AUJA 1VGCC 1VJ9U 3OY6U 4UDWH 2D92A 1FAKH 1K1IA 4KTCA 4FVDA 1IQNA 2H5CA 2GT8A 1SGEE 1TE0A 2H2CA 1Z1JA 1PPGE 1CO7E 1C2JA 4F4OC 1A2CH 3RMNH 1C5VA 4HOPB 1UTOA 4O9VA 2H6MA 3MI4A 1W11U 3SJIA 1UITA 2F9VA 3GGEA 1MZDA 2PSXA 1D4PB 5DGJA 2F9BH 4K78A 2P8OC 2FTLE 5LPEA 4AGJA 3LGTA 4HGCA 3RXFA 2Y81A 4AFUA 3VEQB 1GJ4H 2FEQH 2STBE 3FANA 2RRMA 1AVXA 1CHOG 1DDJA 3M5LA 2AGGX 1Y3YA 1RZXA 1TYNA 2KAIA 5EQRA 1N99A 3EA7A 5A2MH 2I0LA 2BLOA 4FUBA 3ZVEA 2ZPLA 1TA6A 4LZ4B 3M3SA 2PKAA 2Z3DA 2OZFA 1OPHB 1TNIA 2PLXA 4U2WA 3OYPA 1GMHG 3SZNA 1LPZB 2KOJA 3RXGA 2I0IA 3MU8A 4NIVA 3TH2H 1ETSH 1IHTH 1KIGH 1ELAA 5HJ1A 1GJBB 2EC9H 4FUDA 4RSPA 4E05H 4B2CA 2GMTB 2LA8A 1UJDA 3UNQA 1C1TA 2VH6A 1SLUB 1L1NA 5DKMA 1YYY1 5BRRE 2BX4A 5FX5A 5FAHA 1AKSB 1C1RA 5JDUB 1J16A 3HK6B 3T29A 4E7RG 1ESAA 2QT5A 4D9QA 2BDYA 4SGBE 4DGJA 4RKOB 4VGCB 4MNXA 4A92A 1ZPZA 2LPRA 1NU7B 2LNCA 4K1EA 3ESTA 2KPKA 4AMHA 1GCTB 2DC2A 3SUZA 1PQAA 1BHXF 1BHXB 4YLQH 5EODA 1TGBA 1YPJH 3TIUA 1V5QA 1Z87A 2VWRA 1V3XA 2VGCB 2VWOA 3TLOA 2ZFQH 2P95A 1GI3A 1GI7B 1FDPA 4OGYA 1BTWA
chains in the Genus database with same CATH superfamily
3PDVA 2FE5A 1FCFA 4JOKA 2PTCE 3QGLA 5DPAA 2ILNA 2OXSA 4B71A 3RXQA 2SGAA 5EJLA 2ZCHP 1HPGA 2BD4A 1SB1H 2ZP0H 3ZIAD 4K69A 3T25A 1NFUA 2VVVA 3F3BA 4YOGA 3ZV9A 4D7FA 2QAAA 1Q3OA 1CQQA 1HAYB 1BUIA 1P12E 2EEKA 2DKRA 5AVDA 3CH8A 5DP7A 2DE8A 3DT0H 2A45B 2V90A 3O5NA 3GCHC 1FC6A 2ZZUH 1MBQA 4FUCA 2JETB 2WZQA 3P6ZB 3GDSA 1C2MA 2KAIB 4NIWA 4YDPA 4E06H 3M36A 2Z6BD 3SORA 4ZKSU 4YT7H 1YPKH 4MNYA 3S9BA 2PKAB 2TPIZ 1P06A 4MQAA 1LCYA 1U6QA 3JZ2B 1CT0E 4INKA 5F03A 1OBZA 1G32B 3KZEA 3O8CA 1TNGA 4IC6A 3PV2A 3P95A 5FPTA 3LONA 1SQAA 2EQNA 2QXHA 1ZRKA 3N99A 4Q2OA 4X0WU 1JIRA 1Z86A 1LHEH 1XKBC 2F91A 1ZZZA 5ESBA 1INCA 1O3IA 4FUHA 3H7OA 2ZPRA 1VCQA 1GHXH 3BEUA 5HFBA 3QTOH 3LNYA 4BOHA 4K6YA 5GWZA 1FY3A 1Z71A 2J97A 4X6NA 2FS9A 1WUNH 1SPJA 3OEED 4CR9A 2H3MA 1A0JA 3RC5A 4AORA 2PR3A 3K1RA 1AN1E 5LH8A 4NMTA 4TWWA 1OOKB 2ZGBH 1MKXK 4ZKRU 3SJ8A 1DICA 1P1EA 4DIIH 1A5GH 3NK8A 4X6PA 7GCHF 3F68H 3D23A 4WF8A 3ZZBA 2D8WA 3RXJA 2H2ZA 2Y6TA 4AFSA 1G3EA 3K6YA 1KWAA 1F5KU 1KMHB 2FPZA 1E0FD 3RXAA 1MD7A 1QR3E 1V2ST 4KELA 1GBKA 5HIYA 4GAWA 2AEIH 1L1JA 1LQDB 1KXDA 1P1DA 1P0SH 3W1EA 3MU5A 1PQ8A 1OYQA 3U9AH 4Q6HA 5HF1A 1VJAU 2HVYB 4INLA 1YCPH 2Q6FA 1MTVA 1GMDG 3E3TA 2M2AA 4MNWA 4IN2A 4ISHH 3E17A 3B9FH 1MH0A 2DM8A 2D8IA 4A1TA 2BD9A 4WYTA 1Z6EA 2EI6A 2WPMS 3V12A 1AO5A 1TB6H 1ACBE 1O5AB 5A0CA 1N6XA 4Q7YA 3ZVBA 2C8YB 2TGAA 3PS4A 1HJ9A 3WY8A 3Q3XA 3TNSA 3CYYA 4IS5A 1D3QB 2L97A 4OEPA 4D8NA 2G2LA 2GEFA 1PFXC 1LHFH 4ZHMU 1FI8A 2G4UA 1SI5H 5E0GA 2KJDA 1BJUA 1TRYA 4XE4A 1ZSKA 2GD4B 2WPHS 4NWKA 2P59A 2JKHA 1T4VH 1WIFA 2GCTC 2V7QD 3BSQA 1WU1A 4K76A 3M5NA 1N7TA 2XOKD 5I46H 5T6FA 2C8ZB 3O8DA 1VCWA 1UTKA 4KFVA 3ZRTA 1L2EA 2QXGA 4YZUA 3OY5U 1UO6A 1OZIA 2Z9LA 1K9OE 2GZ9A 1PQ7A 1DANH 1EXFA 1MKXH 2XWBI 3FP6E 3PMHB 1YLCA 1IQMA 1J14A 5L30H 5DP9A 4MPVA 3ZZCA 4IN1A 2M10A 4X8SH 1V1TA 1MTUA 1O2OA 4GLYA 1FX0B 1HDTH 1QBNA 1P11E 1ARBA 4FGMA 3LNXA 1W7XH 3LGIA 1DLEA 1NBMD 1O2SA 4GVDA 3ID1A 2L6OA 5J4QA 4ZMAH 4OEOA 4Z1MD 4E3BA 4JZ1A 4NFEA 2VNTA 1Q3XA 4AX9H 2EAQA 2YNBA 2ZF0H 4YTAA 3RLEA 4GHQA 5TJXA 3H7TA 3RXOA 3SGAE 1BQYA 3MH7A 2OS6A 4HZHA 1C9TA 1V2UT 2ZDKA 2K1ZA 2BOHB 2UUYA 1RGWA 1DE7H 3RXEA 8GCHG 4NSVA 3UWIA 4YM9A 1NROH 2BYGA 4JOJA 2CN0H 1UJ1A 4H4FA 4A1VA 4BAKB 1OWHA 2D1JA 1TGSZ 4TPYA 2PKSC 5FCRA 3QIKA 1ZHRA 1TNKA 4JORA 3G01A 1W0ZU 2KR7A 3V0XA 5EQQA 1AD8H 1CBWB 3SW2B 2FOCA 1RRKA 1SGIB 2GDDA 2GT7A 2PZDA 4Q2PA 1KXAA 3UWJH 2KQFA 3B76A 1O2JA 3EYDA 2Y7XA 1BITA 1C2GA 4IW4E 5HMAA 2EGNA 1ZR0A 1PYTC 2FYRA 2KYLA 1GHAG 5EPNA 4O06A 1B7XB 2QGRA 4ABAA 3M37A 1C5TA 1GMCG 5LPRA 3E90B 5GCHF 4O3TA 1F0SA 1OXGA 2VRFA 2I6VA 2BXUH 3MTYA 5E0JA 4I8HA 1KXFA 1GM1A 4A6LA 1C4V2 3PYHA 7LPRA 1DX5M 1EX3A 4Q7XA 3S7HB 4AB9A 3DIWA 3SZEA 3SOSA 4H6TA 1SLXB 3WKLA 4WMFA 1OS8A 3MH5A 1X45A 1QFKH 2M0VA 1S6LA 3MNBA 2BY9X 4ABDA 2ENOA 2BDHA 4BTUB 1TOCB 2FOGA 3QO6A 2B8OH 2IPQX 3GY6A 1O30A 3VB7A 5HKKD 1YPHE 1WHDA 1P2OA 4UD9H 4DVAU 3BN9A 1LHGH 1EZXC 2OLGA 3Q00A 3TNTA 5DP5A 1HXEH 1RTLA 1HAOH 1TMUH 3PV4A 1BRAA 1W13U 3E16B 1HAVA 3RXKA 1NC6A 1O2IA 3O8BA 1NN6A 3A7XA 2Z9KA 2CSSA 4JJ3A 1QRZA 2KCPA 2H9HA 1GJDB 3VGCB 2P3TB 2V1WA 5H3JA 1FJSA 3KNXA 4P0CA 1C4U2 1TX6A 2ZPSA 2O8UA 1TQ7B 1T32A 1UEZA 1GHZA 3M5OA 4ISOA 1V2NT 3LPRA 1NTPA 1SMFE 4NMRA 1XUKA 3NUMA 4ABFA 1BZXE 3BIVH 1HGTH 2NU0E 2GV6A 1TMBH 4F49A 2HPPH 1COWD 1S0RA 3S0NA 1ELFA 1AWHB 1TP5A 1MBMA 3GDUA 3GICB 4UFGH 3RP2A 2XXLA 4CRCA 1RS0A 1UVSH 1O2KA 2D26C 2GMTC 2O9QA 3ZZ5A 1L4ZA 5T6DA 1FY4A 2PWXA 1UCYH 5I25A 3NFKA 1OP8A 5HYOA 3F9FA 1CVWH 2OTVA 3SJOA 2O2TA 1UCYE 4UEHH 4K75A 1O2NA 3SFJA 3A7WA 2PNTA 4Y8XA 3STJA 1O3KA 4B1TA 4VGCC 2QN5T 1WF7A 3IITA 1VJ6A 3KQCA 1LPGB 1V5LA 1SHHB 1O3EA 1QCPA 2YNAA 1GCTC 4JJ0A 2WV4A 4Y7AA 3KZDA 2HLDD 3DFLA 1GVZA 1BTUA 2MHOA 3P8GA 1ZRBA 3VB5A 1AMHA 2BY5X 2VGCC 2GGVB 2A4RA 3T62A 1QHRB 1XMNB 3VB3A 2RA3A 4I8LA 2FO9A 2GP9B 2IJOB 2PFEA 3K2UA 1MQ6A 2QV1A 1XZ9A 2JJ1D 3F9HA 3RXDA 3ZVCA 2XC5A 2C93B 2QF3A 4R8TB 1MKWH 2BM2A 2PUXB 1N7FA 3QE1A 1HAVB 4K8BA 3FZZA 3ENSB 3LDXH 1D5GA 1NRPH 1GBDA 4GSOA 1D6WA 3W95A 5HDYA 1CHOF 1SGQE 4D76A 1A7SA 1S82A 3SOEA 2CV3A 2FLRH 2WUBA 2M0ZA 1AB9B 1GI9B 4NFFA 4ABJA 2ZC9H 8LPRA 3SJ9A 2JETC 1EB2A 4QT8C 1FIWA 5FXLA 1V62A 2VVCA 2F3CE 1OBXA 1X5RA 2WV9A 2O8MA 1WI2A 1B5GH 1TBRH 1GMHF 4CRFA 2KV8A 3SV8A 3SU4A 3PMBB 2K1QA 3URDA 2I04A 4WJG2 4X2XA 3ZZ7A 1S5SA 3QN7A 4I33A 2A7CA 2M0TA 3KHFA 4X8TH 4H42U 3R3GB 3BG8A 4FUFA 1ANBA 3PTBA 5F8TA 3RL8A 5E2OA 2CF8H 2ZCKP 3BTGE 1FPHH 4NIXA 3AW1A 1VZQH 2SGDE 2EA3A 4CR5A 1E1QD 3LJJA 2WPIS 1HXFH 2JJ2D 1NFYA 1GVKB 1AVGH 4A7IB 2C8WB 4OS1A 3KDKA 5EYZA 2FLBH 1FV9A 2BY8X 2SFAA 4MPUA 3M7TA 5FB8C 3I78A 3TH3H 1LO6A 5C0UA 4Z0KA 2QE7D 4ISLA 4JZEH 4Y11E 2Y80A 1YC0A 1KLIH 3GYMA 5DTHA 5F53A 5ETXA 1AZ8A 1BTYA 1EP5A 1O2VA 2AS9A 8ESTE 1GI8B 2Q3GA 2ZTYA 4CRGA 2ZU3A 1FN6A 2H2BA 4Q2KA 4NXRA 4JYVH 2TBSA 4THNH 3Q3KA 1Z8RA 2XBYA 2EDPA 4Z8JA 3VB6A 2O8WA 1E38B 2GZ8A 1U37A 4NMQA 5GIBA 5G1EA 3A87A 1G3BA 2GV7A 3MHWU 4M9FA 5L2YH 1P9UA 5L2ZH 3N7OA 5J4SA 4DOQA 3QDOA 3UREA 5C67A 2KPLA 1BMLA 1V2RT 2G5VA 1PPCE 1ELDE 3PRBA 4AG2A 1DVAH 3TVJB 1WJLA 3QDZB 2SGPE 1QAVA 2GZVA 1QURH 5ESTE 1DWDH 3A81A 2RCEA 4UE7H 5G4BA 1A61H 1C5SA 4NMVA 3KDGA 4ABGA 1I16A 2QIQA 3HPKA 1JBUH 3FO8D 2JIZD 1MABB 1H8IH 1L0ZA 1TONA 3A8DA 1VAEA 2ZQ1A 2ZU5A 4ASUD 1WDIA 1ZHPA 4TWYA 1GPZA 5H4IB 2GX4A 2OQUA 3SNDA 1DXWA 2F9PA 2ALVA 1O32A 1UMAH 2ZG0H 2OK5A 4Q2NA 2BDBA 4OS6A 1O2UA 3ATWA 2AMPA 3BTKE 1MTNB 1X8SA 1NO9H 4FLNA 3NXPA 1CU1A 2HNTE 1ABJH 4XSKU 1FY8E 4KTUA 3UOUA 2W3IA 2M0UA 1O2ZA 3ZZ6A 3O8RA 2O8LA 3ATIA 2LP6A 1PQ5A 3I18A 4ZROA 1BMAA 5GJ4B 1YCPM 4KGAA 1C9PA 4DY7B 4IBLH 3E8LA 3OSYA 1TLDA 1N6FA 4NSYA 2ZFRH 1TX7A 3NZIA 5HEBA 1QQ4A 1IQGA 2ODQA 3BTTE 4Z6AH 3RXIA 1HIAB 5HGGA 1S0QA 4J1YA 3MNSA 2YUYA 2QF5A 2VU8E 1GL1A 1D6RA 1MU8B 3HKIB 3R68A 5HIZA 1O5BB 5DP3A 3RUOA 1EAWA 1UJVA 1K2I1 1TBQH 1RTFB 4JCNA 4Q7ZA 1VB7A 2XCNA 1ZJDA 1ABIH 1H8ED 1CA8B 2BD5A 4TYDA 1UHPA 2J38A 1AGJA 1C5ZB 1IQKA 1MAXA 2ANKH 4ABEA 1P09A 1YF4A 3SGQE 2R3YA 4WVPE 2I6SA 2VIWA 3UUZA 5HFEA 3BTQE 3MNXA 5BPEA 3SU3A 7ESTE 2ZFPH 1RXPA 1XUIA 2B0FA 2VSVA 1YY3A 4NG9H 4XFQA 3RMLH 1BBRK 4D9RA 1N6DA 2DUCA 3LC5A 2ZPMA 1PPBH 2CGAA 2AWWA 1QAVB 4X2WA 1DY9A 3M35A 1IQLA 1KDQA 5F8ZA 1XX9A 3RU4E 5CMXH 3VPKA 1F0TA 2RA0A 1SBWA 1EAIA 4GCHF 1T8MA 2HGAA 1C5OH 1CBWC 1GI2A 3F0PA 3ODDA 2C3SA 1OP2A 2XNIA 2Z7FE 3CENA 3SU5A 4JYTA 5ILBA 4X1NU 1LPKB 3U28C 1O3HA 4YESB 1FN8A 2PGBB 1KXBA 4GHTA 1DUEA 2SGFE 5IYTA 1XUGA 2A1DB 4YOJA 2JXOA 2GCHG 4GVUA 2V3OH 1QQUA 1THSH 1Z8JB 1KLJH 2EDVA 1JXPA 1Q31A 2A32A 3QTVH 1Y3UA 3ZZDA 4FU9A 3GABA 2BDAA 1QBOA 4I8KA 1M5ZA 4IMZA 1WFGA 4JZDH 1SSXA 2JWEA 1GBMA 3V7TA 2IWPA 1LTOA 2QF4A 2I6QA 4TY7A 5C5OA 3H5CB 1AIXH 2BQWB 1GBIA 1TWXB 1T8LA 3P70B 1YPGH 1XXDA 1DT2A 2VIVA 1CT4E 1PPHE 1EZUC 4WMEA 4BXSA 1NPMA 1TABE 2KBSA 4CBNA 1WYKA 1MQ5A 2M5TA 3PLBA 4MLFB 2SGEE 4HI3A 4GPGA 1EAXA 2C8XB 2X7ZA 4AYYB 1DPOA 1TGNA 3AK5A 5JYIA 1WQSA 3KHVA 1ELBA 2XCFA 4JK5A 3SO3A 6GCHF 3VGCC 1FAXA 1K28D 2HGTH 2P94A 1YBOA 2FIRH 8GCHF 1X9ZA 1X5NA 3BF6H 3DFJA 5EU8A 4X6MA 3A8CA 4MVNA 4NNLA 5C17A 1F5RA 3EE7A 2IWNA 5CHBA 1O36A 1QNJA 1CHGA 1MUEB 1H9HE 2M3MA 1QA0A 4E7NA 1GBCA 2JIKA 1QL7A 2L74A 1KDQB 3SI3H 1C1OA 1NRQH 1E1RD 3HPMA 1ANEA 1MTWA 4UU6A 1PPEE 3LOXA 4ACAA 3AXAA 2KCOA 1I92A 3SV2H 2W7UA 2ZA5A 1C1UH 1TPSA 4ZHAA 1H4WA 2BD3A 2UWLA 2VWLA 1GHAF 2VJ1A 4NMPA 1Z1IA 1GMCF 4YLUA 1RY4A 1NM6A 1YPMH 3RXPA 1HFDA 3D49H 1ZGVA 1P01A 1QLCA 1X6DA 1UVPA 2ZDLA 4LK4A 3RXBA 1TNLA 1CT2E 1AY6H 2V0BA 4CHAB 1A3BH 1G3DA 3E91A 4FU7A 4Y0YE 5C1YA 1PYTD 2YOLA 3LU9B 4Q80A 4L8NA 2HNTF 2J4IA 2Z9IA 2VIQA 3FFGA 4K5ZA 2XNDD 4MPAA 3N7DA 1C5PA 2CMYA 4AC9A 2UWPA 5KGOA 2FNEA 1O2XA 2ZEBA 4TSFD 1C5YB 2FOFA 3MWIU 1AU8A 1HUTH 1SG8B 2FS8A 4MPWA 3A86A 2DAZA 2OGPA 2HE4A 1QL9A 3EE0B 2H9TH 2BXTH 2AH4X 2OINA 4Y0ZE 2FODA 2Q6GA 3PMAB 1TPPA 1X5QA 3NKKA 1MC7A 1IU0A 1GBHA 1GBFA 3LT3A 1WXRA 1GVLA 4X6OA 3DJAA 1HRTH 3SUEA 3R0FA 1EOJA 1CGIE 1O3CA 5CE1A 3PWBA 4DIHH 4I31A 1P2NA 3WKMA 1ZPCA 3QX5H 2EEHA 3SHWA 4ABBA 3ZZ9A 1W0JD 2LELA 1AB9C 1OYTH 4BTTB 3SU2A 3TPIZ 1C1VH 1W10U 2DMZA 2PP6A 1BTXA 4TY6A 2KCYA 2QXIA 2QKUA 1O2LA 2AMQA 1PPFE 1WF8A 1ANDA 2EEGA 2BOKA 3U8OH 1EUFA 5EQSA 2QC2A 1AHTH 1C1NA 1NRSH 5E2PA 2CSJA 5JB9S 2JILA 2J98A 1P2KA 2VPHA 2ULLA 3CP7A 1BTZA 2PKUA 1RGRA 4NMSA 1DS2E 1NS3A 1S81A 2Z3EA 4KTSA 2QYIA 3U98H 4DT4A 1HYLA 3UR9A 1C1WH 2ANYA 1F92A 1TNJA 5A8ZA 3ID4A 2OQSA 1WFVA 3DHKH 3GY8A 1IQFA 3ZZ4A 2BZAA 3QLPH 4ACBA 2WYGA 5EXNA 3MYWA 1OKXA 2DLUA 4X8VH 2JDID 3GSLA 2F9OA 1F5LA 1O37A 3PWCA 5A8XA 1ELVA 3GY3A 1P03A 2ZFFH 3QZQA 5C20A 1LVYA 3NCVA 4JZIA 1YLDA 4O03A 4NXQA 2PV9B 1QJ1B 5GXPA 1AFQB 1FXYA 2FOEA 1NESE 1C1QA 2WINI 1JWTA 2LUIA 3SYJA 1GJ5H 1HCGA 1UK2A 2TGPZ 2LOBA 2JH5D 3S9CA 1E34B 4F8KA 1JIMA 3ELAH 4REYA 3Q76A 2BX3A 3BG4B 1AUTC 2J5UA 2BTCE 4X1PU 1YPHC 2BMGB 1TGCA 3GISB 3RMOH 3ZZAA 4YYXA 1AE5A 1MMJN 3FZDA 3U8RH 3SV6A 4JOEA 1J8AA 1O2QA 4NZLA 1NRNH 3KGPA 1Q2WA 1SFQB 2J94A 3DSPA 1OWKA 2ZHFH 3LGVA 4YT6H 3ODFA 3PDZA 4RT0A 5JBAS 4Y79A 3VG8A 2FOHA 1P02A 5GNDA 3RDZA 1V2PT 2QXJA 3STIA 2B5TB 1ZMJA 3A88A 2REYA 4B2BA 2VH0A 6LPRA 3E0NB 1UVTH 2WPJS 1HJAB 1GDQA 1RJXB 2YMSB 1P10A 2ZGXH 3HATH 3EGKH 1B0FA 3OAAD 1SGTA 2ZWLH 3GCHB 5T6GA 4AOQA 2J98B 2ANWA 2ZDNA 3BTWE 5F3XA 1E36B 2MX6A 1K1NA 5JBTA 1NZQH 2QA9E 3KYFA 1IOEA 1GI6A 4I8GA 1MTNC 1GBEA 4NZQA 2BQ6B 3M3VA 5FBEA 2C4FH 5A0BA 6ESTA 1QY6A 2KL1A 3SHAH 3QJMA 3TH4H 4FUJA 2NU4E 4JOGA 3BPUA 2VBCA 3HGNA 2C90B 5TCAA 2OC7A 5GDSH 2P16A 3ATKA 3EAJA 1OWEA 3CS0A 1UW7A 1XVOA 4LOYH 4AB8A 1A5IA 3P92A 5HF4A 2PA1A 2ANMH 1ETTH 4XRNA 4K60A 3CBZA 1JMOH 2ZHQH 1IHJA 3RLWH 2AFQB 4DURA 4F48B 1HAPH 2KOMA 3RXCA 5B6LA 3ZYEA 4ZHLU 2W3KA 2UZCA 3QJNA 1F7ZA 2JH0D 3RC4A 1TGTA 2OSGA 2A7HA 1ELGA 3K65B 3MQKC 3MH6A 4K1SA 2ZTZA 1O2GH 2OC8A 4OGXA 3S9AA 4JMYA 4UFEH 3GOVB 4M7GA 1GI1A 3BTHE 4NMOA 2A2QH 3PB1E 3VXEH 4WWYA 1C1SA 1O3JA 3KF2A 3MMGA 7KMEH 2DJTA 3SGBE 1E37B 1AFEH 1EPTA 3SNBA 2CHAB 1J15A 2CF9H 2QF0A 2HVXA 1SVPA 2BD8A 4DG4A 3MH4A 3T2NA 1FY5A 1TRMA 1L4DA 3VQGA 3UFAA 1UM7A 1UFXA 1L1GA 2R2MB 1Q3PA 4Y6DA 3AVZA 4ISNA 2OC1A 1YBWA 2EGKA 1H9IE 1NBME 1O3LA 1NRRH 1Y7NA 4ASHA 2FWWA 1P8VC 1O2MA 2V35A 1DITH 2F4LA 1YWUA 2Y5HA 3QWCH 1C5RA 1EOLA 2ALPA 3BIUH 1FY1A 1BCUH 1YLNA 2FI4E 1O5CB 2A4GA 2FOAA 5CHAB 5KECA 3KEEA 3KYGA 2ZHDA 1OHHD 1SKYE 2OBOA 5EOKA 4B2AA 1UK3A 2K20A 3PRDA 3TU7H 1K32A 2AIQA 1SC8U 3GS9A 1O3BA 3V13A 3F9GA 1DWBH 4UFFH 4NXPA 4ZCNA 4B76A 4LXBH 1WSSH 4BANB 1FIZA 3EDXB 2THFB 3CBYA 1NU9A 1Y8TA 5K7RA 2P3UB 2V3HH 1U38A 3AASA 5G1DA 4ESTE 1TALA 1DSUA 4JYUH 1DY8A 4WXIA 1YKTA 1DM4B 4Y71A 1N1LA 2IOTA 4Q4LA 3UPEA 3P8FA 1GI5A 3SQEE 2F9NA 3RXVA 2G5MB 2OUAA 2FOBA 2XBWA 2KAWA 2LC7A 1GG6B 1YM0A 2SNWA 4TPIZ 3RXRA 1VA8A 4U01A 1C5QA 2PHBA 2JINA 1O3GA 4XBBA 1Z8GA 4NA9H 1DWEH 3L4FD 4X1RU 3A7ZA 2R2WU 2VIDA 1TQ3A 3PO1B 1O39A 1W9OA 4XBCA 5C2ZA 3EA9A 2GJGA 1GDNA 1V2WT 1O3NA 2FN5A 1LVMA 1TOMH 1UJUA 3MO6A 2CS5A 4DJZB 4AG1A 1EPTB 2ODYB 1P2IA 1SGCA 2ESTE 4XD7D 5F67A 1NT1A 1O34A 1FONA 1UVUH 4INHA 3A8AA 1EZQA 1QAUA 1V2MT 2L4TA 4X1SU 1EASA 2P93A 2E7KA 2OBQA 1O3DA 4B6FA 2A4OA 1FZZA 1THPB 1V2KT 2B7DH 4B73A 1BMMH 1Y5BT 3RXLA 1H9LB 5FX6A 2Z3CA 5AF9H 3OTJE 1SOZA 3TJVA 2FZZA 3HPTB 3DD2H 3F2FA 1ZUBA 3URCA 5AFYH 1K1MA 3L33A 1WTGH 1DUAA 1QZ8A 4OS7A 4WH6A 2GCHF 2KCAA 2G4TA 2R0KA 4CH2B 2ZECA 1YGCH 3TSVA 1W2KH 2J34A 4Y7BA 2VSPA 3JXTA 4CHAC 1S84A 5C0TA 1WBGB 1WQVH 1IQJA 2HRVA 3TSZA 2BD7A 3DSOA 3P8NA 4ZAEA 1SGFG 3RXMA 1GJ7B 1EB1H 1WOFA 2HNTC 2A5KA 1W14U 3K9XB 4O97A 3GY4A 4OS5A 3LH3A 3SUDA 5HFCA 2RG3A 1YP9A 1EZSC 4UU5A 2I1NA 3RXTA 5D13A 4B74A 2GTBA 1HAGE 1V2OT 2BY6X 2TGDA 3OE7D 4F55A 1BTHH 1D9IA 3B8JA 1Y5UT 1UEPA 2ZPQA 2FM2A 3MU4A 1LKAA 4AFZA 2G51A 3RM2H 2OPGA 3VQFA 2ZU1A 4U30A 5TCCA 1A5HA 1S83A 4HTCH 3MFJA 3DA9B 1GHWH 1LDTT 3ZVAA 4WMDA 2GVFA 4JK6A 1E79D 3AW0A 1ZOKA 1A3EH 3MO3A 4I86A 3SUGA 3EQ0H 2WYJA 2H5DA 1K1JA 1XXFA 3QUMP 2Q1JA 1J17T 1C2IA 3UIRA 4DCDA 3B23B 4I8JA 1O3PB 1LHCH 4HFPB 4WY3A 5EXMA 1ZTLA 4OS4A 1SOTA 1VCPA 1UTJA 5DP8A 1C1PA 3A7YA 4WYUA 1ZMNA 1GBTA 2BLWA 1UTQA 1B8QA 2A5IA 3UNSA 2HLCA 1GHBG 1O35A 4I32A 2JREA 5A2PA 1IHSH 1KXCA 4BAHB 4X2VA 5DN6D 1KYNA 4OM9A 5HXFA 4BNRA 1R6JA 2AERH 2ZI2H 4DT7B 1BOQA 1C5NH 2KM0A 3R69A 3QGJA 5DG6A 2IWOA 1TA2A 1WCZA 4Y8ZA 1AQ7A 1NFWA 5DJ7A 1FLEE 1HAIH 3AAUA 1C2EA 1P04A 1ELEE 2NU3E 2OC0A 1EAUA 3GCTG 4ABHA 4K8YA 2J2UA 1OX1A 1F0UA 1VR1H 2FI3E 1GMDF 4RI0A 2W5EA 2GDEH 4Z33A 3ATLA 1ELTA 1D3PB 3MU0A 3ZZ8A 1D3DB 2Z9GA 2EHRA 2BDCA 2ZTXA 1O5EH 1V2JT 1GCDA 1ZSLA 2WPDD 3M7QA 4ZH8A 3PLKA 3F9EA 3EA8A 3PV5A 3TGKE 1BRBE 1HV7A 4ZKNU 1AFQC 4JOHA 3VFEA 4BAOB 2H3LA 5EPYA 5I7ZA 2QBWA 2Y5FA 1P3CA 2UUJB 2AINA 2XTTB 4MNVA 1BRUP 2XC0A 1O2TA 1ZGIA 4P2AB 4JZFH 2BQ7B 2XBXA 3BG4C 3SBKA 1BE9A 1AWFH 2WUCA 2HPQH 1DLKB 2YT8A 4O3UA 1SLWB 3NPSA 3S69A 2PDZA 1OWJA 1OWIA 3ZV8A 1O3FA 1VITG 4FUEA 4IMQA 1OWDA 1GJCB 2RCZA 1EJNA 2HWLB 5C5NA 3SV9A 5GLJA 5GPIB 5K0HA 3HKJB 5KEDA 1OSSA 1EJMA 3ID3A 8KME2 1JRSA 4K72A 1GJAB 4DW2U 3BTME 5EG4A 1FC9A 1UVOA 2FTMA 3LJOA 3SU6A 2BHGA 2XC4A 1P57B 4FXGH 3P17H 1ZTJA 1GDUA 3U1JB 1UTNA 1S6HA 1SGPE 1W0KD 1HJAC 2WPKS 3F2GA 3RU4T 1RIWB 1HBTH 2YMSC 2G55A 3PMJA 1C2DA 1ELCA 1QL8A 2BLQA 5SGAE 3SNEA 2KJPA 1BJVA 1YCPK 3U8TH 2EI8A 2O8TA 5HFFA 1UK4A 5FHTA 1Y3XA 3LC3A 3IG6B 4BXWA 1UTPA 4FVBA 2VIPA 1XVMA 1ZJKA 1TPAE 1SGYE 1CGHA 1O3OA 1QTFA 3T27A 4LZ1H 4YOIA 1UEQA 3MOCA 1BBRH 4FUIA 5AHGH 2ODPA 4A5TS 4AYVB 3NGHA 2EI7A 1BBRE 5E0HA 3PM3A 4NA8A 1KXEA 1K21H 4NNMA 1GBJA 4FETA 2BDGA 6CHAB 2A7JA 2TRMA 2AHME 4Y10E 2W7SA 2OMJA 2G8TA 3ZVDA 1K1OA 3SHUA 4NIYA 1TNHA 1CA0B 1P2JA 2D2DA 3QGNB 1T8NA 1BMNH 2V6NA 4WH8A 2H1UA 3GJ9A 3A80A 3E6PH 3SNAA 1N7EA 4NGAH 3LIWA 4N6XA 3I29A 1KTSB 3OTPA 2PGQB 1W8BH 1WAYB 3FP8E 4CRDA 1G2MA 2WPLS 3KQDA 3PROA 3SHCH 3GDVA 1IU2A 4RN6A 5DK1A 2FCFA 1ESTA 2NU2E 1AE8H 2AIPA 1QB1A 3SI4H 3DJ1A 1SR5C 3SUFA 1N8OB 2KG2A 4AFQA 3AAVA 3HGPA 1A46H 1WHAA 3RXUA 4IGDA 1M9UA 1IQIA 4Q3HA 2KA9A 3WW7A 3GY7A 1XUFA 2R3UA 2CHAC 4E34A 9ESTA 5ABWA 4Q6SA 1W9QA 1FUJA 3TSWA 1TFXA 5F8XA 1GWAA 1TMTH 1YPEH 3GCNA 1TP3A 1E35B 2VINA 3BEIB 3RXSA 1FC7A 4CRBA 1C1MA 2CXVA 3S7KB 3GY5A 1C4Y2 3SQHE 2DLSA 5E1YA 1D3TB 1KLTA 1P2QA 1O2PA 2CJIA 5DP4A 4AZ2B 2FDAA 2ZDAH 3RXHA 1Q7XA 3LKWA 1V6BA 1ZYOA 1IQHA 5JB8S 1UF1A 4LMMA 1KSNA 1G9OA 1YPLH 2AWUA 1GGDB 1QJ6B 1LMWB 2G00A 3TK9A 2FMJA 5CHAC 1O3MA 3A7TA 1GQ4A 1NY22 4IC5A 1O0DH 1VGCB 1AZZA 3M7UA 3PLPA 5EIYA 2ZO3H 2KJKA 1OP0A 5DSFA 1Z7KA 4ZXXH 1W9EA 2R4HA 2EY4C 1UM1A 1V6DA 3K82A 1W0YH 3ZYDA 3CBXA 1ZPBA 4NA7A 1B0EA 1K1LA 4GCHG 3RM0H 4EDJA 3RLYH 1BA8B 2FYQA 2JH6D 3MO9A 1C2HA 3LH1A 1HJ8A 1THRH 2XBVA 1MFGA 1SQRA 2P8OB 2ZKSA 1LHDH 1Z6JH 1XUJA 4UFDH 2FX4A 3C1KA 2W4FA 4FU8A 2UWOA 3WWFA 3BTDE 1SQOA 1GG6C 2YUBA 3M5MA 4PROA 2FX6A 4A1XA 2TIOA 4GVCA 3D65E 2ZQ2A 1SL3A 4FOUC 3R0HA 3A89A 2EV8A 2ASUB 1F0RA 2CK3D 3PO1C 1HB0B 3ID2A 5LGOA 2F0AA 1RFNA 5PTPA 2ZCLP 3OU0A 2ZGJA 4G69A 1C2KA 3C27B 5JBCS 2A5AA 1MCTA 1WG6A 5A09A 4XOJA 1HAXB 1GI0A 2BYAX 3Q3YA 3LGUA 1EPTC 3A85A 2BD2A 1NTEA 1A0LA 2XWAA 1CGJE 1QIXB 1QBVH 1T4UH 4BAQB 2OP9A 2BLVA 3BTFE 3UNRA 5E21A 5E8EH 1T8OA 4R2ZA 1LQEA 1O2YA 4MG3A 4BAMB 5A8YA 5LPFA 4JOFA 4TT3D 1QB9A 1ZMLA 1TAWA 3UOPA 1HAZB 2PW8H 1WI4A 5FBIA 3W94A 2XW9A 1O5FH 1SGNE 2SNVA 1N6EA 2BVSH 2RDEA 6GCHG 3A7VA 1S6FA 2BVXH 3UTUH 2A4QA 4Y8YA 4J2YB 1ZLRA 3UQOA 3FN8A 1ARCA 1O5DH 3SN8A 2KFWA 1MAYA 1SGRE 3KIDU 1UEWA 4CREA 4NCYA 1T2MA 2AGEX 5EW2H 1H1BA 3FP7E 3I4WA 4CH8B 3Q77A 1TQ0B 1XM1A 5T3HA 4YO9A 2QKTA 4U32A 2QG1A 1DFPA 3QK1A 1LKBA 2FOMB 3DJ3A 3MU1A 2R9PA 2VIOA 1C2FA 1W3CA 2G5NA 3HK3B 4RKJB 4K1TA 1SGFA 2L4SA 4XDEA 1QGFA 7GCHG 1GJ8B 1U3BA 1WH1A 3T5FH 1GHYH 1H8DH 5FPYA 3SU1A 5DO4H 2A2XH 1O2HA 2ZDMA 2ZDVH 2HE2A 1EQ9A 2AWXA 1RGQA 1G37A 1UCYK 2IJD1 3M61U 2FP7B 2VB0A 2W26A 2DB5A 2BB4A 1VITH 3OEHD 4CRAA 3TGIE 5HEYA 1A0HB 4K3JA 4FUGA 5CDFE 1IQEA 1BT7A 5HFDA 1O33A 4UONA 2AGIX 2BY7X 2XYAA 5E11A 1MZAA 2ZFTA 4X1QU 3O46A 1V2LT 2A31A 1T31A 2KRGA 2FI5E 4HG6A 2PTNA 2JOAA 1UTLM 5F6MA 2IWQA 3DSGA 3RMMH 3U69H 2J92A 3KCGH 4D7GA 3JZ1B 2ZHWH 3PTNA 1L6OA 1QA7A 1KTTB 2Z9JA 1SHYA 3KN2A 1ID5H 1BRCE 3CS7A 2OQ5A 5AFZH 1TBZH 4JOPA 2NWNA 1GBBA 4B75A 3SV7A 1QRXA 1FPCH 5EZ0A 3V3MA 4ZUHA 1MKWK 1EFRD 3BV9B 1G3CA 2GZ7A 2YT7A 1XUHA 3L6PA 1G30B 3LGWA 5IL9A 1C5LH 1DWCH 5HM9A 1X7AC 2DE9A 3EGHC 3UAIC 3VB4A 4Q2QA 2KOHA 3GY2A 3KQBA 3E1XB 3K50A 5JBBS 4XHVA 5IK2D 3F6UH 3EGGC 2EEJA 3UY9A 1SFIA 2QY0B 2XRCA 2VWNA 3TK6A 1ZTKA 1KEFA 1G2LA 1O5GH 2Q9VA 3GCOA 1W12U 2W6JD 1LVOA 1QB6A 2WL7A 1AI8H 1O2RA 2K8IA 1WV7H 2UUKB 2W7RA 3N7EA 2HALA 3M3TA 2BDIA 5A0AE 2YTWA 5FCKA 5C1UA 1FNIA 1LVBA 2IPHA 4JL7A 4NWLA 1MU6B 1FMGA 2ZNKH 3F1SB 3IWMA 5EXLA 4AN7A 1A4WH 4ABIA 2B9LA 2A0QB 1CE5A 4MTBA 4OS2A 1V2QT 4ZKOU 1Z8IB 3H09A 3T28A 3TMHA 3OX7U 1JRTA 1C5XB 1GI4A 2F9UA 4K2YA 3RC6A 1UTMA 1G36A 2EDZA 5DP6A 3TJOA 1P3EA 3OFND 5HETA 3KQEA 3FY5A 1TIOA 3VXFH 5C1XA 1O38A 3I1EA 1UHBA 2PKTA 1IAUA 1EATA 3NFLA 1MTSA 1V2VT 5B6OA 2Y5GA 3KL6A 3T26A 1DOJA 3L3TA 1GBAA 4Y76A 5EGMA 3A83A 1GBLA 3TJUA 1WTHD 2QCYA 1G9IE 1ESBA 4B6EA 1XKAC 4R0IA 4H6SB 3HVQC 2F83A 2ZU4A 3UQVA 1U39A 1Y3VA 2Q6DA 1F2SE 1N6YA 2NU1E 1ETRH 2Z94A 3E0PB 1J9CH 2H9EH 3NWUA 3F0OA 2F43B 1BFEA 1NF3C 1BTPA 1KY9A 1ZOMA 1GHBF 2OCSA 2SGQE 3BEFB 2BVRH 2GCTB 1GL0E 2V3MA 1SLVB 2FXRA 2VVUA 1K0HA 1P9SA 4X8UH 1O31A 2EGOA 2R0LA 3ITIA 5GCHG 1RIWC 2VZ5A 2VWMA 2ZFSA 3DCLA 3ZVFA 3CC0A 1VKYA 2Y7ZA 3UR6A 1OBYA 1HLTH 1P05A 1EP6A 5FPSA 1PDRA 1RD3B 1GJ6A 3LGYA 5IDKA 2FESH 3TGJE 4GHNA 1HNEE 2AYWA 2OCVB 1CSOE 1AVWA 4H11A 2ZHEH 3GCTF 2Y82A 1PJPA 3SU0A 2I4SA 4KKDA 5JPMH 4WXVA 2UUFB 1W7GH 2AMDA 1EJAA 3RU4D 1H8HD 1Y5AT 3NCLA 4HOPA 1O2WA 2ZIQH 3D62A 1GQ5A 3TITA 1K1PA 1SQTA 2J95A 3A82A 1NFXA 1FQ3A 3FAOA 1BDAA 2HOBA 3MNCA 3SJKA 2PSYA 3ZVGA 1C2LA 6CHAC 5B42A 2P3FH 1DSTA 1K22H 1T7CA 4GUXA 4MDSA 2ZGHA 1CA0C 2EXGA 4I7YH 1TPOA 3FOAA 3ZZ3A 2STAE 1C5MD 3DORA 1ORFA 3F2HA 3DUXH 1JOUB 2Z17A 1DXPA 2G52A 3ATMA 4KFWA 4CBOA 4OAJA 5HM2A 2TGTA 1HIAA 2F5YA 2PUQH 1UHBB 2ZGCA 2ZU2A 3QZRA 2J9NA 5E22A 2PKSB 3TK5A 1GHVH 1VITF 4KP0A 2WV5A 3BTEE 1BIOA 1BMFD 1N8OC 2G81E 3SNCA 1C5WB 2KZ4A 2KX4A 2WSSD 3FVFB 4ISIH 2GKVE 4XBDA 3I77A 1HAHH 4MPXA 4YXWD 1EKBB 1MD8A 5C3NA 2BZ6H 5E6PB 5FL7D 3WWBA 4BTIB 5C94A 2EEIA 4E35A 9LPRA 2IN2A 4AGKA 3TJNA 1Y59T 1V2TT 2QKVA 4X2YA 2D90A 2P3WA 1SGDE 1Y3WA 1AKSA 2OD3B 4RT1A 3K6ZA 1QJ7B 1TX8A 1MFLA 3A84A 3RL7A 1ZHMA 5JXBA 4Q63A 1S85A 5EW1H 4ZXYH 3U1IB 5HEDA 3GYLB 2LC6A 1GJ9B 1MCVA 1C5UA 1P2MA 2RDLA 1ANCA 1GGDC 2K0QA 1RTKA 3KQ5A 1PPZA 4P00A 4PQWA 1TRNA 2EJYA 1BB0B 3P8OA 4SGAE 1QRWA 1ZSJA 3A8BA 1A1RA 1O3AA 5L6NH 1AUJA 1VGCC 1VJ9U 3OY6U 2YMSD 4UDWH 2D92A 1FAKH 1K1IA 4KTCA 2WHXA 4FVDA 1IQNA 2H5CA 3UB0A 2GT8A 1SGEE 1TE0A 2H2CA 1Z1JA 1PPGE 1CO7E 1C2JA 4F4OC 1A2CH 3RMNH 1C5VA 4HOPB 3CNRA 1UTOA 4O9VA 2H6MA 3MI4A 1W11U 5EJZA 3SJIA 1UITA 2F9VA 3GGEA 1MZDA 2PSXA 1D4PB 5DGJA 2F9BH 4K78A 2P8OC 2FTLE 5LPEA 4P02A 4AGJA 3LGTA 2RFKC 4HGCA 3RXFA 3NRLA 2Y81A 4AFUA 5EJ1A 3VEQB 1GJ4H 2FEQH 2STBE 3FANA 3FKSD 2RRMA 1AVXA 1CHOG 1DDJA 3M5LA 2AGGX 1Y3YA 1RZXA 1TYNA 2KAIA 5EQRA 1N99A 3EA7A 5A2MH 2I0LA 2BLOA 4FUBA 3ZVEA 2ZPLA 1TA6A 4LZ4B 3M3SA 2PKAA 2Z3DA 2OZFA 1OPHB 1TNIA 2PLXA 4U2WA 3OYPA 1GMHG 3SZNA 1LPZB 2KOJA 3RXGA 2I0IA 3MU8A 4NIVA 5T1VA 3TH2H 1ETSH 2W6ID 1IHTH 1KIGH 1ELAA 5HJ1A 1GJBB 2EC9H 4FUDA 4RSPA 4E05H 4B2CA 2GMTB 2LA8A 1UJDA 3UNQA 1C1TA 2VH6A 1SLUB 1L1NA 5DKMA 1YYY1 5BRRE 2BX4A 5FX5A 2JSNA 1AKSB 1C1RA 5FAHA 5JDUB 1J16A 3HK6B 3T29A 4E7RG 1ESAA 2QT5A 4D9QA 2BDYA 4SGBE 4DGJA 4RKOB 4VGCB 4MNXA 4A92A 1ZPZA 2LPRA 1NU7B 2LNCA 4K1EA 3ESTA 2KPKA 4AMHA 1GCTB 2DC2A 3SUZA 1PQAA 1BHXF 1BHXB 4YLQH 5EODA 1TGBA 1YPJH 3TIUA 1V5QA 1Z87A 2VWRA 1V3XA 2VGCB 2VWOA 3TLOA 2ZFQH 2P95A 1GI3A 1GI7B 1FDPA 4OGYA 1BTWA
chains in the Genus database with same CATH topology
3PDVA 2FE5A 1FCFA 4JOKA 2PTCE 3QGLA 5DPAA 2ILNA 2OXSA 4B71A 3RXQA 2SGAA 2ZCHP 1HPGA 2BD4A 1SB1H 2ZP0H 4K69A 3T25A 1NFUA 2VVVA 4YOGA 3ZV9A 4D7FA 2QAAA 1Q3OA 1CQQA 1HAYB 1BUIA 1P12E 2EEKA 2DKRA 5AVDA 3CH8A 5DP7A 2DE8A 3DT0H 2A45B 2V90A 3O5NA 3GCHC 1FC6A 2ZZUH 1MBQA 4FUCA 2JETB 3P6ZB 3GDSA 1C2MA 2KAIB 4NIWA 4YDPA 4E06H 3M36A 2Z6BD 3SORA 4ZKSU 4YT7H 1YPKH 4MNYA 3S9BA 2PKAB 2TPIZ 1P06A 4MQAA 1LCYA 1U6QA 3JZ2B 1CT0E 4INKA 5F03A 1OBZA 1G32B 3KZEA 3O8CA 1TNGA 4IC6A 3PV2A 3P95A 5FPTA 3LONA 1SQAA 2QXHA 4X0WU 1ZRKA 4Q2OA 1JIRA 1Z86A 1LHEH 1XKBC 2F91A 1ZZZA 5ESBA 1INCA 1O3IA 4FUHA 3H7OA 2ZPRA 1VCQA 1GHXH 3BEUA 5HFBA 3QTOH 3LNYA 4BOHA 4K6YA 5GWZA 1FY3A 1Z71A 4X6NA 2FS9A 1WUNH 1SPJA 4CR9A 2H3MA 1A0JA 3RC5A 4AORA 2PR3A 3K1RA 1AN1E 5LH8A 4NMTA 4TWWA 1OOKB 2ZGBH 1MKXK 4ZKRU 3SJ8A 1DICA 1P1EA 4DIIH 1A5GH 3NK8A 4X6PA 7GCHF 3F68H 3D23A 4WF8A 3ZZBA 2D8WA 3RXJA 2H2ZA 2Y6TA 4AFSA 1G3EA 3K6YA 1KWAA 1F5KU 2FPZA 1E0FD 3RXAA 1MD7A 1QR3E 1V2ST 4KELA 1GBKA 4GAWA 2AEIH 1L1JA 1LQDB 1KXDA 1P1DA 1P0SH 3MU5A 1PQ8A 1OYQA 3U9AH 4Q6HA 5HF1A 1VJAU 4INLA 1YCPH 2Q6FA 1MTVA 1GMDG 3E3TA 4MNWA 4IN2A 4ISHH 3E17A 3B9FH 1MH0A 2DM8A 2D8IA 4A1TA 2BD9A 4WYTA 1Z6EA 2EI6A 2WPMS 3V12A 1AO5A 1TB6H 1ACBE 1O5AB 5A0CA 1N6XA 4Q7YA 3ZVBA 2C8YB 2TGAA 3PS4A 1HJ9A 3WY8A 3Q3XA 3TNSA 3CYYA 4IS5A 1D3QB 2L97A 4OEPA 4D8NA 2G2LA 2GEFA 1PFXC 1LHFH 4ZHMU 1FI8A 2G4UA 1SI5H 5E0GA 2KJDA 1BJUA 1TRYA 4XE4A 1ZSKA 2GD4B 2WPHS 4NWKA 2P59A 2JKHA 1T4VH 1WIFA 2GCTC 3BSQA 1WU1A 4K76A 3M5NA 1N7TA 5I46H 5T6FA 2C8ZB 3O8DA 1VCWA 1UTKA 4KFVA 3ZRTA 1L2EA 2QXGA 4YZUA 3OY5U 1UO6A 1OZIA 2Z9LA 1K9OE 2GZ9A 1PQ7A 1DANH 1EXFA 1MKXH 2XWBI 3FP6E 3PMHB 1YLCA 1IQMA 1J14A 5L30H 5DP9A 4MPVA 3ZZCA 4IN1A 2M10A 4X8SH 1V1TA 1MTUA 1O2OA 4GLYA 1HDTH 1QBNA 1P11E 1ARBA 4FGMA 3LNXA 1W7XH 3LGIA 1DLEA 1O2SA 4GVDA 3ID1A 5J4QA 4ZMAH 4OEOA 4E3BA 4JZ1A 4NFEA 2VNTA 1Q3XA 4AX9H 2EAQA 2YNBA 2ZF0H 4YTAA 3RLEA 4GHQA 5TJXA 3H7TA 3RXOA 3SGAE 1BQYA 3MH7A 2OS6A 4HZHA 1C9TA 1V2UT 2ZDKA 2K1ZA 2BOHB 2UUYA 1RGWA 1DE7H 3RXEA 8GCHG 4NSVA 3UWIA 4YM9A 1NROH 2BYGA 4JOJA 2CN0H 1UJ1A 4H4FA 4A1VA 4BAKB 1OWHA 2D1JA 1TGSZ 4TPYA