2G5MB

Spinophilin pdz domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
GHMELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurabin-2
publication title Structural basis for spinophilin-neurabin receptor interaction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2g5mB01
2JINA 3QGLA 4NMSA 4L8NA 5B6LA 3STJA 2Z17A 2JWEA 2L97A 2EXGA 3WKLA 4JOJA 1V1TA 1UFXA 5HFDA 3TSWA 2IWPA 5DTHA 5HFBA 1GQ4A 2M0UA 1WI4A 3NFKA 3QO6A 4JOFA 1XZ9A 2OS6A 3BPUA 1OBXA 2KPKA 1UEZA 4GHNA 3DIWA 1N7EA 4K76A 4Q2QA 2KJPA 1KEFA 1FC9A 2HE2A 2QBWA 4E3BA 5HEYA 4JOKA 1VJ6A 3DJ3A 4E35A 4NMVA 4GVDA 2JIKA 1WFVA 1UJDA 2PNTA 2F0AA 3OTPA 2D8IA 4AMHA 4Z33A 2IWQA 2MX6A 2R4HA 5E21A 2FCFA 1N7TA 3DJ1A 1I92A 2H2CA 3GDVA 2H3LA 1WHDA 3SHUA 3EGHC 2KOMA 1GQ5A 1RY4A 2OMJA 5A2PA 2M0TA 1V62A 3GSLA 2AWWA 4JORA 2VPHA 1N7FA 3PS4A 1Y8TA 4PQWA 2EGKA 2F5YA 4NMQA 2EEJA 5E6PB 3K82A 3TSVA 1UM7A 4K78A 5EYZA 4P0CA 1UEWA 3PDVA 4H11A 1I16A 1NF3C 2RRMA 2AWUA 2PA1A 1T2MA 1W9EA 1OBYA 4NMOA 2I4SA 3ID3A 3MH4A 3WKMA 2JXOA 2Q3GA 2IWOA 2PDZA 2GZVA 2LC7A 2DMZA 2QG1A 3GCOA 1UEQA 3RLEA 1U39A 2YUBA 1N6FA 2DM8A 2JOAA 3PV4A 1OZIA 1U38A 1X5NA 1VA8A 2FN5A 3AXAA 1UJUA 1X8SA 4YDPA 2G5MB 1M5ZA 3NFLA 2EDZA 1UM1A 4NMTA 4K72A 5H3JA 4Q2PA 5HDYA 1PDRA 1V5LA 2KPLA 5E1YA 2L4TA 3QE1A 5HFEA 2EGOA 4JOHA 1P1EA 1Z87A 2QKUA 1P1DA 2KBSA 5HF4A 1FC6A 3LNXA 2EAQA 2OPGA 1MC7A 4Q2OA 1QLCA 3KZEA 1GM1A 3TSZA 1ZUBA 1IU0A 3MH6A 4NNLA 1WI2A 1G9OA 2CSSA 3FY5A 2LC6A 2RCZA 2BYGA 1UJVA 2LUIA 3SOEA 2I04A 4LMMA 3QJMA 1X45A 4K6YA 3R68A 5D13A 3OU0A 2EDVA 3SUZA 4MPAA 3RL7A 4O06A 4Q2NA 3VQFA 1FC7A 2I0IA 2IWNA 2AWXA 3VQGA 2HE4A 2EEGA 3LNYA 1TP3A 1X5QA 5GNDA 2G2LA 4JOPA 2QT5A 2EGNA 3HVQC 4GVCA 2ZPLA 1V5QA 2QKVA 3QJNA 5I7ZA 2PKTA 1WF8A 2R3YA 1U37A 5HEDA 3DJAA 3K1RA 2VZ5A 4NXQA 2DJTA 5F3XA 1QAUA 2VWRA 5EZ0A 3ID4A 2REYA 4KFWA 1N6DA 4OEPA 4KFVA 1ZOKA 3I4WA 1FCFA 5HF1A 2M3MA 1WHAA 4EDJA 3EGGC 1WF7A 2KOHA 3NGHA 2M10A 1Z86A 1KWAA 1KY9A 1Q3PA 2KYLA 3PV5A 5GLJA 3CH8A 4UU6A 1V6BA 2YUYA 4WYUA 3ZRTA 2HGAA 4OAJA 1UITA 2MHOA 3SFJA 4OEOA 2Z9IA 4REYA 3GJ9A 3I1EA 1WIFA 1BFEA 1N6EA 2KV8A 3TMHA 2I6VA 4IC6A 1QAVA 2PKUA 3HPKA 1MFGA 4UU5A 5E22A 1N99A 1Y7NA 2K1ZA 1TP5A 2QKTA 2ENOA 4R2ZA 2E7KA 1UEPA 2KRGA 3ID2A 1RZXA 5HFCA 4JL7A 2YT8A 3CYYA 3ID1A 1VB7A 1MFLA 2W4FA 2VSVA 2H3MA 5FB8C 1R6JA 4RI0A 1SOZA 1NTEA 2EV8A 3E17A 2ZPMA 3QIKA 2Q9VA 2UZCA 4YYXA 1IU2A 1WH1A 2OZFA 4N6XA 2OCSA 1L6OA 1WG6A 4NXPA 1X6DA 2LOBA 2I0LA 2W7RA 2OSGA 4Q6HA 5HEBA 1TQ3A 4P2AB 4HOPA 2DLUA 1QAVB 2FE5A 2M0ZA 3R0HA 2KG2A 3CBXA 1B8QA 2KA9A 4E34A 4Q6SA 2V90A 2YT7A 2VSPA 3KZDA 3GCNA 2O2TA 4Q3HA 2CSJA 1RGRA 1W9OA 3JXTA 3O5NA 4Z8JA 5HJ1A 4K75A 1IHJA 2DB5A 3HPMA 4NMRA 4NMPA 4FGMA 3SHWA 2PZDA 2KJKA 1SOTA 2V1WA 3CC0A 4WYTA 2VRFA 5G1DA 2M0VA 3CBZA 1VAEA 5HETA 3K50A 1BE9A 1OBZA 1YBOA 5JXBA 1WJLA 2OGPA 3I18A 2I1NA 2H2BA 5HFFA 2D92A 3O46A 2WL7A 2DKRA 4NXRA 1UHPA 3GGEA 3CBYA 1UF1A 5FHTA 1D5GA 1Q3OA 2X7ZA 5G1EA 3R69A 4JOGA 2L4SA 4G69A 4JOEA 2D90A 2EDPA 3GDUA 4HOPB 4NNMA 2YTWA 3GDSA 3PDZA 2DC2A 2FNEA 2EJYA 3RL8A 1VCWA 3B76A 2P3WA 2AINA 1WFGA 3QDOA 1X5RA 3KHFA 2DAZA 3DORA 2JILA 2DLSA 1K32A 1U3BA 2K20A 2KJDA 2EEHA 3L4FD 3CS0A 5E11A 2OQSA 1LCYA 1RGWA 4XHVA 3PV2A 2KL1A 2LA8A 1W9QA 2KOJA 2EEIA 4F8KA 2JREA 2EHRA 1TE0A 2KQFA 2KAWA 1Q7XA 2CS5A 5F67A 3MH7A
chains in the Genus database with same CATH superfamily
2JINA 3QGLA 4NMSA 4L8NA 5B6LA 3STJA 2Z17A 2JWEA 2L97A 2EXGA 3WKLA 4JOJA 1V1TA 1UFXA 5HFDA 3TSWA 2IWPA 5DTHA 5HFBA 2JSNA 1GQ4A 2M0UA 1WI4A 3NFKA 3QO6A 4JOFA 1XZ9A 2OS6A 3BPUA 1OBXA 2KPKA 1UEZA 4GHNA 3DIWA 1N7EA 4K76A 4Q2QA 2KJPA 1KEFA 1FC9A 2HE2A 2QBWA 4E3BA 5HEYA 4JOKA 1VJ6A 3DJ3A 4E35A 4NMVA 4GVDA 2JIKA 1WFVA 1UJDA 2PNTA 2F0AA 3OTPA 2D8IA 4AMHA 4Z33A 2IWQA 2MX6A 2R4HA 5E21A 2FCFA 1N7TA 3DJ1A 1I92A 2H2CA 3GDVA 2H3LA 1WHDA 3SHUA 3EGHC 2KOMA 1GQ5A 1RY4A 2OMJA 5A2PA 2M0TA 1V62A 3GSLA 2AWWA 3KDGA 4JORA 2VPHA 1N7FA 3PS4A 1Y8TA 4PQWA 2EGKA 2F5YA 4NMQA 2EEJA 5E6PB 3K82A 3TSVA 1UM7A 4K78A 5EYZA 4P0CA 1UEWA 3PDVA 4H11A 1I16A 1NF3C 2RRMA 5IL9A 2AWUA 2PA1A 1T2MA 1W9EA 1OBYA 4NMOA 2I4SA 3ID3A 3MH4A 3WKMA 2JXOA 2Q3GA 2IWOA 2PDZA 2GZVA 2LC7A 3GABA 2DMZA 2QG1A 3GCOA 1UEQA 3RLEA 1U39A 2YUBA 1N6FA 2DM8A 2JOAA 3PV4A 1OZIA 1U38A 1X5NA 1VA8A 2FN5A 3AXAA 1UJUA 1X8SA 4YDPA 2G5MB 1M5ZA 3NFLA 2EDZA 1UM1A 4NMTA 4K72A 5H3JA 2GEFA 4Q2PA 5HDYA 1PDRA 1V5LA 2KPLA 5E1YA 2L4TA 3QE1A 5HFEA 2EGOA 4JOHA 1P1EA 1Z87A 2QKUA 1P1DA 2KBSA 5HF4A 1FC6A 3KDKA 3LNXA 2EAQA 2OPGA 1MC7A 4Q2OA 1QLCA 3KZEA 1GM1A 3TSZA 1ZUBA 1IU0A 3MH6A 4NNLA 1WI2A 1G9OA 2CSSA 3FY5A 2LC6A 2RCZA 2BYGA 1UJVA 2LUIA 3SOEA 2I04A 4LMMA 3QJMA 1X45A 4K6YA 3R68A 5D13A 3OU0A 2EDVA 3SUZA 4MPAA 3RL7A 4O06A 4Q2NA 3VQFA 1FC7A 2I0IA 2IWNA 2AWXA 3VQGA 2HE4A 2EEGA 3LNYA 1TP3A 1X5QA 5GNDA 2G2LA 4JOPA 2QT5A 2EGNA 4JJ3A 3HVQC 4GVCA 2ZPLA 1V5QA 2QKVA 3QJNA 5I7ZA 2PKTA 1WF8A 2R3YA 1U37A 5HEDA 3DJAA 3K1RA 2VZ5A 4NXQA 2DJTA 5F3XA 1QAUA 2VWRA 5EZ0A 3ID4A 2REYA 4KFWA 1N6DA 4OEPA 4FLNA 4KFVA 1ZOKA 3I4WA 1FCFA 5HF1A 2M3MA 1WHAA 4EDJA 3EGGC 1WF7A 2KOHA 3NGHA 2M10A 1Z86A 1KWAA 1KY9A 1Q3PA 2KYLA 3PV5A 5GLJA 3CH8A 4UU6A 4JJ0A 1V6BA 2YUYA 4WYUA 3ZRTA 2HGAA 4OAJA 1UITA 2MHOA 3SFJA 4OEOA 2Z9IA 4REYA 3GJ9A 3I1EA 1WIFA 1BFEA 1N6EA 2KV8A 3TMHA 2I6VA 4IC6A 1QAVA 2PKUA 3HPKA 1MFGA 4UU5A 5E22A 1N99A 1Y7NA 2K1ZA 1TP5A 2QKTA 2ENOA 4R2ZA 5ILBA 2E7KA 1UEPA 2KRGA 3ID2A 1RZXA 5HFCA 4JL7A 2YT8A 3CYYA 3ID1A 1VB7A 1MFLA 2W4FA 2VSVA 2H3MA 5FB8C 1R6JA 4RI0A 1SOZA 1NTEA 2EV8A 3E17A 2ZPMA 3QIKA 2Q9VA 2UZCA 4YYXA 1IU2A 1WH1A 2OZFA 4N6XA 2OCSA 1L6OA 1WG6A 4NXPA 1X6DA 2LOBA 2I0LA 2W7RA 2OSGA 4Q6HA 5HEBA 1TQ3A 4P2AB 4HOPA 2DLUA 1QAVB 2FE5A 2M0ZA 3R0HA 2KG2A 3CBXA 1B8QA 2KA9A 4E34A 4Q6SA 2V90A 2YT7A 2VSPA 3KZDA 3GCNA 2O2TA 4Q3HA 2CSJA 1RGRA 1W9OA 3JXTA 3O5NA 3NCVA 4Z8JA 5HJ1A 4K75A 1IHJA 2DB5A 3HPMA 4NMRA 1X9ZA 4NMPA 4FGMA 3SHWA 2PZDA 2KJKA 1SOTA 2V1WA 3CC0A 4WYTA 2VRFA 5G1DA 2M0VA 3CBZA 1VAEA 5HETA 3K50A 1BE9A 1OBZA 1YBOA 5JXBA 1WJLA 2OGPA 3I18A 2I1NA 2H2BA 5HFFA 2D92A 3O46A 2WL7A 2DKRA 4NXRA 1UHPA 3GGEA 3CBYA 1UF1A 5FHTA 1D5GA 1Q3OA 2X7ZA 5G1EA 3R69A 4JOGA 2L4SA 4G69A 4JOEA 2D90A 2EDPA 3GDUA 4HOPB 4NNMA 2YTWA 3GDSA 3PDZA 2DC2A 2FNEA 2EJYA 3RL8A 1VCWA 3B76A 2P3WA 2AINA 1WFGA 3QDOA 1X5RA 3KHFA 2DAZA 3DORA 2JILA 2DLSA 1K32A 1U3BA 2K20A 2KJDA 2EEHA 3L4FD 3CS0A 5E11A 2OQSA 1LCYA 1RGWA 4XHVA 3PV2A 2KL1A 2LA8A 5B42A 1W9QA 2KOJA 2EEIA 4F8KA 2JREA 2EHRA 1TE0A 2KQFA 2KAWA 1Q7XA 2CS5A 5F67A 3MH7A
chains in the Genus database with same CATH topology
2JINA 3QGLA 4NMSA 4L8NA 5B6LA 3STJA 2Z17A 2JWEA 2L97A 2EXGA 3WKLA 4JOJA 1V1TA 1UFXA 5HFDA 3TSWA 2IWPA 5DTHA 5HFBA 2JSNA 1GQ4A 2M0UA 1WI4A 3NFKA 3QO6A 4JOFA 1XZ9A 2OS6A 3BPUA 1OBXA 2KPKA 1UEZA 4GHNA 3DIWA 1N7EA 4K76A 4Q2QA 2KJPA 1KEFA 1FC9A 2HE2A 2QBWA 4E3BA 5HEYA 4JOKA 1VJ6A 3DJ3A 4E35A 4NMVA 4GVDA 2JIKA 1WFVA 1UJDA 2PNTA 2F0AA 3OTPA 2D8IA 4AMHA 4Z33A 2IWQA 2MX6A 2R4HA 5E21A 2FCFA 1N7TA 3DJ1A 1I92A 2H2CA 3GDVA 2H3LA 1WHDA 3SHUA 3EGHC 2KOMA 1GQ5A 1RY4A 2OMJA 5A2PA 2M0TA 1V62A 3GSLA 2AWWA 3KDGA 4JORA 2VPHA 1N7FA 3PS4A 1Y8TA 4PQWA 2EGKA 2F5YA 4NMQA 2EEJA 5E6PB 3K82A 3TSVA 1UM7A 4K78A 5EYZA 4P0CA 1UEWA 3PDVA 4H11A 1I16A 1NF3C 2RRMA 5IL9A 2AWUA 2PA1A 1T2MA 1W9EA 1OBYA 4NMOA 2I4SA 3ID3A 3MH4A 3WKMA 2JXOA 2Q3GA 2IWOA 2PDZA 2GZVA 2LC7A 3GABA 2DMZA 2QG1A 3GCOA 1UEQA 3RLEA 1U39A 2YUBA 1N6FA 2DM8A 2JOAA 3PV4A 1OZIA 1U38A 1X5NA 1VA8A 2FN5A 3AXAA 1UJUA 1X8SA 4YDPA 2G5MB 1M5ZA 3NFLA 2EDZA 1UM1A 4NMTA 4K72A 5H3JA 2GEFA 4Q2PA 5HDYA 1PDRA 1V5LA 2KPLA 5E1YA 2L4TA 3QE1A 5HFEA 2EGOA 4JOHA 1P1EA 1Z87A 2QKUA 1P1DA 2KBSA 5HF4A 1FC6A 3KDKA 3LNXA 2EAQA 2OPGA 1MC7A 4Q2OA 1QLCA 3KZEA 1GM1A 3TSZA 1ZUBA 1IU0A 3MH6A 4NNLA 1WI2A 1G9OA 2CSSA 3FY5A 2LC6A 2RCZA 2BYGA 1UJVA 2LUIA 3SOEA 2I04A 4LMMA 3QJMA 1X45A 4K6YA 3R68A 5D13A 3OU0A 2EDVA 3SUZA 4MPAA 3RL7A 4O06A 4Q2NA 3VQFA 1FC7A 2I0IA 2IWNA 2AWXA 3VQGA 2HE4A 2EEGA 3LNYA 1TP3A 1X5QA 5GNDA 2G2LA 4JOPA 2QT5A 2EGNA 4JJ3A 3HVQC 4GVCA 2ZPLA 1V5QA 2QKVA 3QJNA 5I7ZA 2PKTA 1WF8A 2R3YA 1U37A 5HEDA 3DJAA 3K1RA 2VZ5A 4NXQA 2DJTA 5F3XA 1QAUA 2VWRA 5EZ0A 3ID4A 2REYA 4KFWA 1N6DA 4OEPA 4FLNA 4KFVA 1ZOKA 3I4WA 1FCFA 5HF1A 2M3MA 1WHAA 4EDJA 3EGGC 1WF7A 2KOHA 3NGHA 2M10A 1Z86A 1KWAA 1KY9A 1Q3PA 2KYLA 3PV5A 5GLJA 3CH8A 4UU6A 4JJ0A 1V6BA 2YUYA 4WYUA 3ZRTA 2HGAA 4OAJA 1UITA 2MHOA 3SFJA 4OEOA 2Z9IA 4REYA 3GJ9A 3I1EA 1WIFA 1BFEA 1N6EA 2KV8A 3TMHA 2I6VA 4IC6A 1QAVA 2PKUA 3HPKA 1MFGA 4UU5A 5E22A 1N99A 1Y7NA 2K1ZA 1TP5A 2QKTA 2ENOA 4R2ZA 5ILBA 2E7KA 1UEPA 2KRGA 3ID2A 1RZXA 5HFCA 4JL7A 2YT8A 3CYYA 3ID1A 1VB7A 1MFLA 2W4FA 2VSVA 2H3MA 5FB8C 1R6JA 4RI0A 1SOZA 1NTEA 2EV8A 3E17A 2ZPMA 3QIKA 2Q9VA 2UZCA 4YYXA 1IU2A 1WH1A 2OZFA 4N6XA 2OCSA 1L6OA 1WG6A 4NXPA 1X6DA 2LOBA 2I0LA 2W7RA 2OSGA 4Q6HA 5HEBA 1TQ3A 4P2AB 4HOPA 2DLUA 1QAVB 2FE5A 2M0ZA 3R0HA 2KG2A 3CBXA 1B8QA 2KA9A 4E34A 4Q6SA 2V90A 2YT7A 2VSPA 3KZDA 3GCNA 2O2TA 4Q3HA 2CSJA 1RGRA 1W9OA 3JXTA 3O5NA 3NCVA 4Z8JA 5HJ1A 4K75A 1IHJA 2DB5A 3HPMA 4NMRA 1X9ZA 4NMPA 4FGMA 3SHWA 2PZDA 2KJKA 1SOTA 2V1WA 3CC0A 4WYTA 2VRFA 5G1DA 2M0VA 3CBZA 1VAEA 5HETA 3K50A 1BE9A 1OBZA 1YBOA 5JXBA 1WJLA 2OGPA 3I18A 2I1NA 2H2BA 5HFFA 2D92A 3O46A 2WL7A 2DKRA 4NXRA 1UHPA 3GGEA 3CBYA 1UF1A 5FHTA 1D5GA 1Q3OA 2X7ZA 5G1EA 3R69A 4JOGA 2L4SA 4G69A 4JOEA 2D90A 2EDPA 3GDUA 4HOPB 4NNMA 2YTWA 3GDSA 3PDZA 2DC2A 2FNEA 2EJYA 3RL8A 1VCWA 3B76A 2P3WA 2AINA 1WFGA 3QDOA 1X5RA 3KHFA 2DAZA 3DORA 2JILA 2DLSA 1K32A 1U3BA 2K20A 2KJDA 2EEHA 3L4FD 3CS0A 5E11A 2OQSA 1LCYA 1RGWA 4XHVA 3PV2A 2KL1A 2LA8A 5B42A 1W9QA 2KOJA 2EEIA 4F8KA 2JREA 2EHRA 1TE0A 2KQFA 2KAWA 1Q7XA 2CS5A 5F67A 3MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIN A;  3QGL A;  4NMS A;  4L8N A;  5B6L A;  3STJ A;  2Z17 A;  2JWE A;  2L97 A;  2EXG A;  3WKL A;  4JOJ A;  1V1T A;  1UFX A;  5HFD A;  3TSW A;  2IWP A;  5DTH A;  5HFB A;  1GQ4 A;  2M0U A;  1WI4 A;  3NFK A;  3QO6 A;  4JOF A;  1XZ9 A;  2OS6 A;  3BPU A;  1OBX A;  2KPK A;  1UEZ A;  4GHN A;  3DIW A;  1N7E A;  4K76 A;  4Q2Q A;  2KJP A;  1KEF A;  1FC9 A;  2HE2 A;  2QBW A;  4E3B A;  5HEY A;  4JOK A;  1VJ6 A;  3DJ3 A;  4E35 A;  4NMV A;  4GVD A;  2JIK A;  1WFV A;  1UJD A;  2PNT A;  2F0A A;  3OTP A;  2D8I A;  4AMH A;  4Z33 A;  2IWQ A;  2MX6 A;  2R4H A;  5E21 A;  2FCF A;  1N7T A;  3DJ1 A;  1I92 A;  2H2C A;  3GDV A;  2H3L A;  1WHD A;  3SHU A;  3EGH C;  2KOM A;  1GQ5 A;  1RY4 A;  2OMJ A;  5A2P A;  2M0T A;  1V62 A;  3GSL A;  2AWW A;  4JOR A;  2VPH A;  1N7F A;  3PS4 A;  1Y8T A;  4PQW A;  2EGK A;  2F5Y A;  4NMQ A;  2EEJ A;  5E6P B;  3K82 A;  3TSV A;  1UM7 A;  4K78 A;  5EYZ A;  4P0C A;  1UEW A;  3PDV A;  4H11 A;  1I16 A;  1NF3 C;  2RRM A;  2AWU A;  2PA1 A;  1T2M A;  1W9E A;  1OBY A;  4NMO A;  2I4S A;  3ID3 A;  3MH4 A;  3WKM A;  2JXO A;  2Q3G A;  2IWO A;  2PDZ A;  2GZV A;  2LC7 A;  2DMZ A;  2QG1 A;  3GCO A;  1UEQ A;  3RLE A;  1U39 A;  2YUB A;  1N6F A;  2DM8 A;  2JOA A;  3PV4 A;  1OZI A;  1U38 A;  1X5N A;  1VA8 A;  2FN5 A;  3AXA A;  1UJU A;  1X8S A;  4YDP A;  2G5M B;  1M5Z A;  3NFL A;  2EDZ A;  1UM1 A;  4NMT A;  4K72 A;  5H3J A;  4Q2P A;  5HDY A;  1PDR A;  1V5L A;  2KPL A;  5E1Y A;  2L4T A;  3QE1 A;  5HFE A;  2EGO A;  4JOH A;  1P1E A;  1Z87 A;  2QKU A;  1P1D A;  2KBS A;  5HF4 A;  1FC6 A;  3LNX A;  2EAQ A;  2OPG A;  1MC7 A;  4Q2O A;  1QLC A;  3KZE A;  1GM1 A;  3TSZ A;  1ZUB A;  1IU0 A;  3MH6 A;  4NNL A;  1WI2 A;  1G9O A;  2CSS A;  3FY5 A;  2LC6 A;  2RCZ A;  2BYG A;  1UJV A;  2LUI A;  3SOE A;  2I04 A;  4LMM A;  3QJM A;  1X45 A;  4K6Y A;  3R68 A;  5D13 A;  3OU0 A;  2EDV A;  3SUZ A;  4MPA A;  3RL7 A;  4O06 A;  4Q2N A;  3VQF A;  1FC7 A;  2I0I A;  2IWN A;  2AWX A;  3VQG A;  2HE4 A;  2EEG A;  3LNY A;  1TP3 A;  1X5Q A;  5GND A;  2G2L A;  4JOP A;  2QT5 A;  2EGN A;  3HVQ C;  4GVC A;  2ZPL A;  1V5Q A;  2QKV A;  3QJN A;  5I7Z A;  2PKT A;  1WF8 A;  2R3Y A;  1U37 A;  5HED A;  3DJA A;  3K1R A;  2VZ5 A;  4NXQ A;  2DJT A;  5F3X A;  1QAU A;  2VWR A;  5EZ0 A;  3ID4 A;  2REY A;  4KFW A;  1N6D A;  4OEP A;  4KFV A;  1ZOK A;  3I4W A;  1FCF A;  5HF1 A;  2M3M A;  1WHA A;  4EDJ A;  3EGG C;  1WF7 A;  2KOH A;  3NGH A;  2M10 A;  1Z86 A;  1KWA A;  1KY9 A;  1Q3P A;  2KYL A;  3PV5 A;  5GLJ A;  3CH8 A;  4UU6 A;  1V6B A;  2YUY A;  4WYU A;  3ZRT A;  2HGA A;  4OAJ A;  1UIT A;  2MHO A;  3SFJ A;  4OEO A;  2Z9I A;  4REY A;  3GJ9 A;  3I1E A;  1WIF A;  1BFE A;  1N6E A;  2KV8 A;  3TMH A;  2I6V A;  4IC6 A;  1QAV A;  2PKU A;  3HPK A;  1MFG A;  4UU5 A;  5E22 A;  1N99 A;  1Y7N A;  2K1Z A;  1TP5 A;  2QKT A;  2ENO A;  4R2Z A;  2E7K A;  1UEP A;  2KRG A;  3ID2 A;  1RZX A;  5HFC A;  4JL7 A;  2YT8 A;  3CYY A;  3ID1 A;  1VB7 A;  1MFL A;  2W4F A;  2VSV A;  2H3M A;  5FB8 C;  1R6J A;  4RI0 A;  1SOZ A;  1NTE A;  2EV8 A;  3E17 A;  2ZPM A;  3QIK A;  2Q9V A;  2UZC A;  4YYX A;  1IU2 A;  1WH1 A;  2OZF A;  4N6X A;  2OCS A;  1L6O A;  1WG6 A;  4NXP A;  1X6D A;  2LOB A;  2I0L A;  2W7R A;  2OSG A;  4Q6H A;  5HEB A;  1TQ3 A;  4P2A B;  4HOP A;  2DLU A;  1QAV B;  2FE5 A;  2M0Z A;  3R0H A;  2KG2 A;  3CBX A;  1B8Q A;  2KA9 A;  4E34 A;  4Q6S A;  2V90 A;  2YT7 A;  2VSP A;  3KZD A;  3GCN A;  2O2T A;  4Q3H A;  2CSJ A;  1RGR A;  1W9O A;  3JXT A;  3O5N A;  4Z8J A;  5HJ1 A;  4K75 A;  1IHJ A;  2DB5 A;  3HPM A;  4NMR A;  4NMP A;  4FGM A;  3SHW A;  2PZD A;  2KJK A;  1SOT A;  2V1W A;  3CC0 A;  4WYT A;  2VRF A;  5G1D A;  2M0V A;  3CBZ A;  1VAE A;  5HET A;  3K50 A;  1BE9 A;  1OBZ A;  1YBO A;  5JXB A;  1WJL A;  2OGP A;  3I18 A;  2I1N A;  2H2B A;  5HFF A;  2D92 A;  3O46 A;  2WL7 A;  2DKR A;  4NXR A;  1UHP A;  3GGE A;  3CBY A;  1UF1 A;  5FHT A;  1D5G A;  1Q3O A;  2X7Z A;  5G1E A;  3R69 A;  4JOG A;  2L4S A;  4G69 A;  4JOE A;  2D90 A;  2EDP A;  3GDU A;  4HOP B;  4NNM A;  2YTW A;  3GDS A;  3PDZ A;  2DC2 A;  2FNE A;  2EJY A;  3RL8 A;  1VCW A;  3B76 A;  2P3W A;  2AIN A;  1WFG A;  3QDO A;  1X5R A;  3KHF A;  2DAZ A;  3DOR A;  2JIL A;  2DLS A;  1K32 A;  1U3B A;  2K20 A;  2KJD A;  2EEH A;  3L4F D;  3CS0 A;  5E11 A;  2OQS A;  1LCY A;  1RGW A;  4XHV A;  3PV2 A;  2KL1 A;  2LA8 A;  1W9Q A;  2KOJ A;  2EEI A;  4F8K A;  2JRE A;  2EHR A;  1TE0 A;  2KQF A;  2KAW A;  1Q7X A;  2CS5 A;  5F67 A;  3MH7 A; 
#chains in the Genus database with same CATH topology
 2JIN A;  3QGL A;  4NMS A;  4L8N A;  5B6L A;  3STJ A;  2Z17 A;  2JWE A;  2L97 A;  2EXG A;  3WKL A;  4JOJ A;  1V1T A;  1UFX A;  5HFD A;  3TSW A;  2IWP A;  5DTH A;  5HFB A;  2JSN A;  1GQ4 A;  2M0U A;  1WI4 A;  3NFK A;  3QO6 A;  4JOF A;  1XZ9 A;  2OS6 A;  3BPU A;  1OBX A;  2KPK A;  1UEZ A;  4GHN A;  3DIW A;  1N7E A;  4K76 A;  4Q2Q A;  2KJP A;  1KEF A;  1FC9 A;  2HE2 A;  2QBW A;  4E3B A;  5HEY A;  4JOK A;  1VJ6 A;  3DJ3 A;  4E35 A;  4NMV A;  4GVD A;  2JIK A;  1WFV A;  1UJD A;  2PNT A;  2F0A A;  3OTP A;  2D8I A;  4AMH A;  4Z33 A;  2IWQ A;  2MX6 A;  2R4H A;  5E21 A;  2FCF A;  1N7T A;  3DJ1 A;  1I92 A;  2H2C A;  3GDV A;  2H3L A;  1WHD A;  3SHU A;  3EGH C;  2KOM A;  1GQ5 A;  1RY4 A;  2OMJ A;  5A2P A;  2M0T A;  1V62 A;  3GSL A;  2AWW A;  3KDG A;  4JOR A;  2VPH A;  1N7F A;  3PS4 A;  1Y8T A;  4PQW A;  2EGK A;  2F5Y A;  4NMQ A;  2EEJ A;  5E6P B;  3K82 A;  3TSV A;  1UM7 A;  4K78 A;  5EYZ A;  4P0C A;  1UEW A;  3PDV A;  4H11 A;  1I16 A;  1NF3 C;  2RRM A;  5IL9 A;  2AWU A;  2PA1 A;  1T2M A;  1W9E A;  1OBY A;  4NMO A;  2I4S A;  3ID3 A;  3MH4 A;  3WKM A;  2JXO A;  2Q3G A;  2IWO A;  2PDZ A;  2GZV A;  2LC7 A;  3GAB A;  2DMZ A;  2QG1 A;  3GCO A;  1UEQ A;  3RLE A;  1U39 A;  2YUB A;  1N6F A;  2DM8 A;  2JOA A;  3PV4 A;  1OZI A;  1U38 A;  1X5N A;  1VA8 A;  2FN5 A;  3AXA A;  1UJU A;  1X8S A;  4YDP A;  2G5M B;  1M5Z A;  3NFL A;  2EDZ A;  1UM1 A;  4NMT A;  4K72 A;  5H3J A;  2GEF A;  4Q2P A;  5HDY A;  1PDR A;  1V5L A;  2KPL A;  5E1Y A;  2L4T A;  3QE1 A;  5HFE A;  2EGO A;  4JOH A;  1P1E A;  1Z87 A;  2QKU A;  1P1D A;  2KBS A;  5HF4 A;  1FC6 A;  3KDK A;  3LNX A;  2EAQ A;  2OPG A;  1MC7 A;  4Q2O A;  1QLC A;  3KZE A;  1GM1 A;  3TSZ A;  1ZUB A;  1IU0 A;  3MH6 A;  4NNL A;  1WI2 A;  1G9O A;  2CSS A;  3FY5 A;  2LC6 A;  2RCZ A;  2BYG A;  1UJV A;  2LUI A;  3SOE A;  2I04 A;  4LMM A;  3QJM A;  1X45 A;  4K6Y A;  3R68 A;  5D13 A;  3OU0 A;  2EDV A;  3SUZ A;  4MPA A;  3RL7 A;  4O06 A;  4Q2N A;  3VQF A;  1FC7 A;  2I0I A;  2IWN A;  2AWX A;  3VQG A;  2HE4 A;  2EEG A;  3LNY A;  1TP3 A;  1X5Q A;  5GND A;  2G2L A;  4JOP A;  2QT5 A;  2EGN A;  4JJ3 A;  3HVQ C;  4GVC A;  2ZPL A;  1V5Q A;  2QKV A;  3QJN A;  5I7Z A;  2PKT A;  1WF8 A;  2R3Y A;  1U37 A;  5HED A;  3DJA A;  3K1R A;  2VZ5 A;  4NXQ A;  2DJT A;  5F3X A;  1QAU A;  2VWR A;  5EZ0 A;  3ID4 A;  2REY A;  4KFW A;  1N6D A;  4OEP A;  4FLN A;  4KFV A;  1ZOK A;  3I4W A;  1FCF A;  5HF1 A;  2M3M A;  1WHA A;  4EDJ A;  3EGG C;  1WF7 A;  2KOH A;  3NGH A;  2M10 A;  1Z86 A;  1KWA A;  1KY9 A;  1Q3P A;  2KYL A;  3PV5 A;  5GLJ A;  3CH8 A;  4UU6 A;  4JJ0 A;  1V6B A;  2YUY A;  4WYU A;  3ZRT A;  2HGA A;  4OAJ A;  1UIT A;  2MHO A;  3SFJ A;  4OEO A;  2Z9I A;  4REY A;  3GJ9 A;  3I1E A;  1WIF A;  1BFE A;  1N6E A;  2KV8 A;  3TMH A;  2I6V A;  4IC6 A;  1QAV A;  2PKU A;  3HPK A;  1MFG A;  4UU5 A;  5E22 A;  1N99 A;  1Y7N A;  2K1Z A;  1TP5 A;  2QKT A;  2ENO A;  4R2Z A;  5ILB A;  2E7K A;  1UEP A;  2KRG A;  3ID2 A;  1RZX A;  5HFC A;  4JL7 A;  2YT8 A;  3CYY A;  3ID1 A;  1VB7 A;  1MFL A;  2W4F A;  2VSV A;  2H3M A;  5FB8 C;  1R6J A;  4RI0 A;  1SOZ A;  1NTE A;  2EV8 A;  3E17 A;  2ZPM A;  3QIK A;  2Q9V A;  2UZC A;  4YYX A;  1IU2 A;  1WH1 A;  2OZF A;  4N6X A;  2OCS A;  1L6O A;  1WG6 A;  4NXP A;  1X6D A;  2LOB A;  2I0L A;  2W7R A;  2OSG A;  4Q6H A;  5HEB A;  1TQ3 A;  4P2A B;  4HOP A;  2DLU A;  1QAV B;  2FE5 A;  2M0Z A;  3R0H A;  2KG2 A;  3CBX A;  1B8Q A;  2KA9 A;  4E34 A;  4Q6S A;  2V90 A;  2YT7 A;  2VSP A;  3KZD A;  3GCN A;  2O2T A;  4Q3H A;  2CSJ A;  1RGR A;  1W9O A;  3JXT A;  3O5N A;  3NCV A;  4Z8J A;  5HJ1 A;  4K75 A;  1IHJ A;  2DB5 A;  3HPM A;  4NMR A;  1X9Z A;  4NMP A;  4FGM A;  3SHW A;  2PZD A;  2KJK A;  1SOT A;  2V1W A;  3CC0 A;  4WYT A;  2VRF A;  5G1D A;  2M0V A;  3CBZ A;  1VAE A;  5HET A;  3K50 A;  1BE9 A;  1OBZ A;  1YBO A;  5JXB A;  1WJL A;  2OGP A;  3I18 A;  2I1N A;  2H2B A;  5HFF A;  2D92 A;  3O46 A;  2WL7 A;  2DKR A;  4NXR A;  1UHP A;  3GGE A;  3CBY A;  1UF1 A;  5FHT A;  1D5G A;  1Q3O A;  2X7Z A;  5G1E A;  3R69 A;  4JOG A;  2L4S A;  4G69 A;  4JOE A;  2D90 A;  2EDP A;  3GDU A;  4HOP B;  4NNM A;  2YTW A;  3GDS A;  3PDZ A;  2DC2 A;  2FNE A;  2EJY A;  3RL8 A;  1VCW A;  3B76 A;  2P3W A;  2AIN A;  1WFG A;  3QDO A;  1X5R A;  3KHF A;  2DAZ A;  3DOR A;  2JIL A;  2DLS A;  1K32 A;  1U3B A;  2K20 A;  2KJD A;  2EEH A;  3L4F D;  3CS0 A;  5E11 A;  2OQS A;  1LCY A;  1RGW A;  4XHV A;  3PV2 A;  2KL1 A;  2LA8 A;  5B42 A;  1W9Q A;  2KOJ A;  2EEI A;  4F8K A;  2JRE A;  2EHR A;  1TE0 A;  2KQF A;  2KAW A;  1Q7X A;  2CS5 A;  5F67 A;  3MH7 A; 
#chains in the Genus database with same CATH homology
 2JIN A;  3QGL A;  4NMS A;  4L8N A;  5B6L A;  3STJ A;  2Z17 A;  2JWE A;  2L97 A;  2EXG A;  3WKL A;  4JOJ A;  1V1T A;  1UFX A;  5HFD A;  3TSW A;  2IWP A;  5DTH A;  5HFB A;  2JSN A;  1GQ4 A;  2M0U A;  1WI4 A;  3NFK A;  3QO6 A;  4JOF A;  1XZ9 A;  2OS6 A;  3BPU A;  1OBX A;  2KPK A;  1UEZ A;  4GHN A;  3DIW A;  1N7E A;  4K76 A;  4Q2Q A;  2KJP A;  1KEF A;  1FC9 A;  2HE2 A;  2QBW A;  4E3B A;  5HEY A;  4JOK A;  1VJ6 A;  3DJ3 A;  4E35 A;  4NMV A;  4GVD A;  2JIK A;  1WFV A;  1UJD A;  2PNT A;  2F0A A;  3OTP A;  2D8I A;  4AMH A;  4Z33 A;  2IWQ A;  2MX6 A;  2R4H A;  5E21 A;  2FCF A;  1N7T A;  3DJ1 A;  1I92 A;  2H2C A;  3GDV A;  2H3L A;  1WHD A;  3SHU A;  3EGH C;  2KOM A;  1GQ5 A;  1RY4 A;  2OMJ A;  5A2P A;  2M0T A;  1V62 A;  3GSL A;  2AWW A;  3KDG A;  4JOR A;  2VPH A;  1N7F A;  3PS4 A;  1Y8T A;  4PQW A;  2EGK A;  2F5Y A;  4NMQ A;  2EEJ A;  5E6P B;  3K82 A;  3TSV A;  1UM7 A;  4K78 A;  5EYZ A;  4P0C A;  1UEW A;  3PDV A;  4H11 A;  1I16 A;  1NF3 C;  2RRM A;  5IL9 A;  2AWU A;  2PA1 A;  1T2M A;  1W9E A;  1OBY A;  4NMO A;  2I4S A;  3ID3 A;  3MH4 A;  3WKM A;  2JXO A;  2Q3G A;  2IWO A;  2PDZ A;  2GZV A;  2LC7 A;  3GAB A;  2DMZ A;  2QG1 A;  3GCO A;  1UEQ A;  3RLE A;  1U39 A;  2YUB A;  1N6F A;  2DM8 A;  2JOA A;  3PV4 A;  1OZI A;  1U38 A;  1X5N A;  1VA8 A;  2FN5 A;  3AXA A;  1UJU A;  1X8S A;  4YDP A;  2G5M B;  1M5Z A;  3NFL A;  2EDZ A;  1UM1 A;  4NMT A;  4K72 A;  5H3J A;  2GEF A;  4Q2P A;  5HDY A;  1PDR A;  1V5L A;  2KPL A;  5E1Y A;  2L4T A;  3QE1 A;  5HFE A;  2EGO A;  4JOH A;  1P1E A;  1Z87 A;  2QKU A;  1P1D A;  2KBS A;  5HF4 A;  1FC6 A;  3KDK A;  3LNX A;  2EAQ A;  2OPG A;  1MC7 A;  4Q2O A;  1QLC A;  3KZE A;  1GM1 A;  3TSZ A;  1ZUB A;  1IU0 A;  3MH6 A;  4NNL A;  1WI2 A;  1G9O A;  2CSS A;  3FY5 A;  2LC6 A;  2RCZ A;  2BYG A;  1UJV A;  2LUI A;  3SOE A;  2I04 A;  4LMM A;  3QJM A;  1X45 A;  4K6Y A;  3R68 A;  5D13 A;  3OU0 A;  2EDV A;  3SUZ A;  4MPA A;  3RL7 A;  4O06 A;  4Q2N A;  3VQF A;  1FC7 A;  2I0I A;  2IWN A;  2AWX A;  3VQG A;  2HE4 A;  2EEG A;  3LNY A;  1TP3 A;  1X5Q A;  5GND A;  2G2L A;  4JOP A;  2QT5 A;  2EGN A;  4JJ3 A;  3HVQ C;  4GVC A;  2ZPL A;  1V5Q A;  2QKV A;  3QJN A;  5I7Z A;  2PKT A;  1WF8 A;  2R3Y A;  1U37 A;  5HED A;  3DJA A;  3K1R A;  2VZ5 A;  4NXQ A;  2DJT A;  5F3X A;  1QAU A;  2VWR A;  5EZ0 A;  3ID4 A;  2REY A;  4KFW A;  1N6D A;  4OEP A;  4FLN A;  4KFV A;  1ZOK A;  3I4W A;  1FCF A;  5HF1 A;  2M3M A;  1WHA A;  4EDJ A;  3EGG C;  1WF7 A;  2KOH A;  3NGH A;  2M10 A;  1Z86 A;  1KWA A;  1KY9 A;  1Q3P A;  2KYL A;  3PV5 A;  5GLJ A;  3CH8 A;  4UU6 A;  4JJ0 A;  1V6B A;  2YUY A;  4WYU A;  3ZRT A;  2HGA A;  4OAJ A;  1UIT A;  2MHO A;  3SFJ A;  4OEO A;  2Z9I A;  4REY A;  3GJ9 A;  3I1E A;  1WIF A;  1BFE A;  1N6E A;  2KV8 A;  3TMH A;  2I6V A;  4IC6 A;  1QAV A;  2PKU A;  3HPK A;  1MFG A;  4UU5 A;  5E22 A;  1N99 A;  1Y7N A;  2K1Z A;  1TP5 A;  2QKT A;  2ENO A;  4R2Z A;  5ILB A;  2E7K A;  1UEP A;  2KRG A;  3ID2 A;  1RZX A;  5HFC A;  4JL7 A;  2YT8 A;  3CYY A;  3ID1 A;  1VB7 A;  1MFL A;  2W4F A;  2VSV A;  2H3M A;  5FB8 C;  1R6J A;  4RI0 A;  1SOZ A;  1NTE A;  2EV8 A;  3E17 A;  2ZPM A;  3QIK A;  2Q9V A;  2UZC A;  4YYX A;  1IU2 A;  1WH1 A;  2OZF A;  4N6X A;  2OCS A;  1L6O A;  1WG6 A;  4NXP A;  1X6D A;  2LOB A;  2I0L A;  2W7R A;  2OSG A;  4Q6H A;  5HEB A;  1TQ3 A;  4P2A B;  4HOP A;  2DLU A;  1QAV B;  2FE5 A;  2M0Z A;  3R0H A;  2KG2 A;  3CBX A;  1B8Q A;  2KA9 A;  4E34 A;  4Q6S A;  2V90 A;  2YT7 A;  2VSP A;  3KZD A;  3GCN A;  2O2T A;  4Q3H A;  2CSJ A;  1RGR A;  1W9O A;  3JXT A;  3O5N A;  3NCV A;  4Z8J A;  5HJ1 A;  4K75 A;  1IHJ A;  2DB5 A;  3HPM A;  4NMR A;  1X9Z A;  4NMP A;  4FGM A;  3SHW A;  2PZD A;  2KJK A;  1SOT A;  2V1W A;  3CC0 A;  4WYT A;  2VRF A;  5G1D A;  2M0V A;  3CBZ A;  1VAE A;  5HET A;  3K50 A;  1BE9 A;  1OBZ A;  1YBO A;  5JXB A;  1WJL A;  2OGP A;  3I18 A;  2I1N A;  2H2B A;  5HFF A;  2D92 A;  3O46 A;  2WL7 A;  2DKR A;  4NXR A;  1UHP A;  3GGE A;  3CBY A;  1UF1 A;  5FHT A;  1D5G A;  1Q3O A;  2X7Z A;  5G1E A;  3R69 A;  4JOG A;  2L4S A;  4G69 A;  4JOE A;  2D90 A;  2EDP A;  3GDU A;  4HOP B;  4NNM A;  2YTW A;  3GDS A;  3PDZ A;  2DC2 A;  2FNE A;  2EJY A;  3RL8 A;  1VCW A;  3B76 A;  2P3W A;  2AIN A;  1WFG A;  3QDO A;  1X5R A;  3KHF A;  2DAZ A;  3DOR A;  2JIL A;  2DLS A;  1K32 A;  1U3B A;  2K20 A;  2KJD A;  2EEH A;  3L4F D;  3CS0 A;  5E11 A;  2OQS A;  1LCY A;  1RGW A;  4XHV A;  3PV2 A;  2KL1 A;  2LA8 A;  5B42 A;  1W9Q A;  2KOJ A;  2EEI A;  4F8K A;  2JRE A;  2EHR A;  1TE0 A;  2KQF A;  2KAW A;  1Q7X A;  2CS5 A;  5F67 A;  3MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...