4GVDA

Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz in complex with syndecan1 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
87
Chain Sequence
GAMGKVTHSIHIEKADTYGFSLSSVEEIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 1
publication title The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 87
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4gvdA00
1X8SA 5HEYA 3R68A 1M5ZA 2I04A 1TQ3A 1N6FA 4F8KA 3I18A 1V1TA 3LNXA 5HEDA 2EHRA 2DC2A 3SHWA 2JINA 4JOGA 2M0TA 2AWUA 4PQWA 1UM1A 5G1EA 1X6DA 1OBZA 2G5MB 1OBYA 3GCOA 2JREA 4N6XA 5HDYA 5G1DA 1D5GA 1GM1A 2OGPA 3O46A 3DJAA 4JOPA 2W7RA 2VWRA 1IU2A 3CBXA 4Q2QA 4Q6HA 2QKUA 3TSWA 4NXQA 3ID1A 5E21A 1I16A 5I7ZA 4R2ZA 2AWXA 2L97A 1BFEA 5HETA 2BYGA 2K20A 1I92A 2M0UA 5HFCA 5F3XA 2QBWA 3DIWA 4WYTA 2EXGA 1LCYA 4OEPA 2O2TA 1K32A 2GZVA 3QDOA 2H3MA 2JIKA 1FC9A 2IWQA 4JOKA 1TP5A 4HOPB 2M10A 3OTPA 1U3BA 3ID4A 4KFWA 2EGKA 2YUYA 4NMQA 3DJ3A 1FCFA 1U39A 1QAVB 3PV4A 2UZCA 4NMRA 4UU6A 1X5NA 2QT5A 2FCFA 3OU0A 5DTHA 1TP3A 3KHFA 4JL7A 3PS4A 3KZDA 2PZDA 1IHJA 5JXBA 1WFGA 2KAWA 2EAQA 3L4FD 2ZPLA 3QIKA 2KPLA 4K72A 4FGMA 1N7EA 2OCSA 1WJLA 2IWPA 1R6JA 2LA8A 2F5YA 2EDZA 2I0IA 1IU0A 5E1YA 2QKTA 1SOZA 1W9EA 3QJMA 1T2MA 5HJ1A 3GSLA 3NGHA 4JOEA 5EZ0A 1X5QA 1X45A 4NMOA 4NMPA 1QLCA 2RCZA 2FN5A 3NFKA 2PKUA 3CH8A 2VZ5A 1FC7A 2PKTA 1WH1A 2EEGA 1VB7A 4P2AB 2DAZA 1MFLA 3QO6A 4NXRA 1V6BA 3GDSA 5HF4A 2VSPA 2I4SA 1RY4A 2H2BA 1FC6A 1RGRA 2KV8A 1WIFA 2HGAA 1W9QA 2CS5A 2REYA 2M0VA 1V62A 2RRMA 2VRFA 2LOBA 1UEQA 2KL1A 1RGWA 2JWEA 2KJDA 1Q7XA 5FB8C 1UEZA 3K1RA 2KOJA 5EYZA 3GDUA 1WI2A 1SOTA 2LC6A 4JOHA 2JILA 4WYUA 5HFFA 4GVDA 2E7KA 2VSVA 3CYYA 5HFDA 2DLSA 3CBYA 4XHVA 2KJPA 3FY5A 3HPKA 1WF7A 3VQFA 1UFXA 1V5LA 2PNTA 3SUZA 1XZ9A 3TSVA 2KG2A 4UU5A 3K50A 3VQGA 1Z86A 1WFVA 1UHPA 2V90A 2VPHA 4P0CA 2PA1A 2CSSA 4Q6SA 2CSJA 1UEPA 2FNEA 2YT8A 2ENOA 2H2CA 5HEBA 1L6OA 1RZXA 2Z9IA 4Z33A 3RL8A 2IWNA 2KA9A 1VAEA 3STJA 1U37A 3SOEA 2WL7A 2EEHA 1UJUA 1NF3C 2I6VA 4IC6A 2I0LA 2L4TA 3LNYA 3PDZA 1WHAA 2EGNA 2EEIA 3MH7A 5F67A 1UF1A 1UJDA 4NMTA 2OPGA 1U38A 4L8NA 2OSGA 2DLUA 1KWAA 1N7TA 5FHTA 2F0AA 1KEFA 4NNLA 4Q2PA 5HFBA 2D90A 3EGGC 4Q2NA 1OBXA 1UJVA 4OEOA 2DM8A 4NXPA 2OZFA 1BE9A 2R4HA 2QG1A 3CC0A 3K82A 2EEJA 1P1EA 2QKVA 4E34A 3CBZA 4K76A 3WKMA 1WI4A 1Y7NA 2V1WA 3PDVA 4NMSA 2KOMA 1PDRA 3KZEA 4Q3HA 2YTWA 3ID2A 3SFJA 3BPUA 4GVCA 3SHUA 1V5QA 4E3BA 3R69A 1N6EA 5GNDA 4Q2OA 1G9OA 2K1ZA 3B76A 2D8IA 2KQFA 1VA8A 2KOHA 5D13A 2YT7A 1UM7A 1ZOKA 3HVQC 1ZUBA 2LUIA 2R3YA 4YYXA 2L4SA 3GDVA 5B6LA 3GJ9A 1UITA 5H3JA 2AWWA 1GQ5A 4LMMA 1X5RA 1TE0A 3QJNA 5E6PB 5A2PA 4YDPA 4REYA 5HF1A 2IWOA 2FE5A 2OQSA 2KRGA 3DJ1A 3TMHA 2HE2A 4O06A 2M3MA 1MFGA 3QE1A 2DKRA 3GCNA 2KJKA 4H11A 5E11A 3PV2A 2EDVA 3CS0A 2Z17A 2KPKA 2H3LA 3I4WA 1N6DA 1GQ4A 1VJ6A 3RLEA 4Z8JA 1N7FA 1Z87A 3E17A 2MX6A 4GHNA 4HOPA 5GLJA 4RI0A 2PDZA 1WF8A 2JOAA 1B8QA 2OMJA 1P1DA 3ID3A 1MC7A 4JORA 2KYLA 1OZIA 2LC7A 1QAVA 1VCWA 3HPMA 3MH6A 3ZRTA 2MHOA 1WHDA 3QGLA 4G69A 3GGEA 2AINA 4AMHA 3MH4A 3JXTA 3WKLA 1UEWA 1W9OA 5E22A 1Y8TA 1N99A 3EGHC 2YUBA 4NNMA 2EJYA 1KY9A 3R0HA 1Q3OA 2ZPMA 2Q9VA 4NMVA 3RL7A 2KBSA 2EDPA 3NFLA 2M0ZA 4JOJA 4JOFA 2OS6A 2D92A 1QAUA 2G2LA 2P3WA 1Q3PA 2JXOA 4EDJA 2EV8A 3O5NA 4OAJA 3PV5A 2DJTA 2X7ZA 4K78A 4K75A 2HE4A 4MPAA 1NTEA 2DB5A 2W4FA 3I1EA 4K6YA 2I1NA 2DMZA 1WG6A 4KFVA 5HFEA 3DORA 1YBOA 3AXAA 2Q3GA 2EGOA 4E35A 3TSZA
chains in the Genus database with same CATH superfamily
1X8SA 5HEYA 3R68A 1M5ZA 2I04A 1TQ3A 1N6FA 4F8KA 3I18A 1V1TA 3LNXA 5HEDA 2EHRA 2DC2A 3SHWA 2JINA 4JOGA 2M0TA 2AWUA 4FLNA 4PQWA 1UM1A 5G1EA 1X6DA 1OBZA 2G5MB 1OBYA 3GCOA 2JREA 4N6XA 5HDYA 5G1DA 1D5GA 1GM1A 2OGPA 3O46A 3DJAA 4JOPA 2W7RA 2VWRA 3NCVA 1IU2A 3CBXA 4Q2QA 4Q6HA 2QKUA 3TSWA 4NXQA 3ID1A 2GEFA 5E21A 1I16A 5I7ZA 4R2ZA 2AWXA 2L97A 1BFEA 5HETA 2BYGA 2K20A 1I92A 2M0UA 5HFCA 5F3XA 2QBWA 3DIWA 4WYTA 2EXGA 1LCYA 4OEPA 2O2TA 1K32A 2GZVA 3QDOA 2H3MA 2JIKA 1FC9A 2IWQA 4JOKA 1TP5A 4HOPB 2M10A 3OTPA 1U3BA 3ID4A 4JJ0A 4KFWA 2EGKA 2YUYA 4NMQA 3DJ3A 1FCFA 1U39A 1QAVB 3PV4A 2UZCA 4NMRA 4UU6A 1X5NA 2QT5A 2FCFA 3OU0A 5DTHA 1TP3A 3KHFA 4JL7A 3PS4A 3KZDA 2PZDA 1IHJA 5JXBA 1WFGA 2KAWA 2EAQA 3L4FD 2ZPLA 3QIKA 2KPLA 4K72A 4FGMA 1N7EA 2OCSA 1WJLA 2IWPA 1R6JA 2LA8A 2F5YA 2EDZA 2I0IA 1IU0A 5E1YA 2QKTA 1SOZA 1W9EA 3QJMA 1T2MA 5HJ1A 3GSLA 3NGHA 4JOEA 5EZ0A 1X5QA 1X45A 4NMOA 4NMPA 1QLCA 2RCZA 2FN5A 3NFKA 2PKUA 3CH8A 2VZ5A 5B42A 1FC7A 2PKTA 1WH1A 2EEGA 1VB7A 4P2AB 2DAZA 1MFLA 3QO6A 4NXRA 1V6BA 3GDSA 5HF4A 2VSPA 2I4SA 1RY4A 2H2BA 1FC6A 1RGRA 2KV8A 1WIFA 2HGAA 1W9QA 2CS5A 2REYA 2M0VA 1V62A 2RRMA 2VRFA 2LOBA 1UEQA 2KL1A 1RGWA 2JWEA 2KJDA 1Q7XA 5FB8C 1UEZA 3K1RA 2KOJA 5EYZA 3GDUA 1WI2A 1SOTA 2LC6A 4JOHA 2JILA 4WYUA 5HFFA 4GVDA 2E7KA 2VSVA 3CYYA 5HFDA 2DLSA 3CBYA 4XHVA 2KJPA 3FY5A 3HPKA 1WF7A 3VQFA 1UFXA 1V5LA 2PNTA 3SUZA 1XZ9A 3TSVA 2KG2A 4UU5A 3K50A 4JJ3A 3VQGA 1Z86A 1WFVA 1UHPA 2V90A 5ILBA 2VPHA 4P0CA 2PA1A 2CSSA 4Q6SA 2CSJA 1UEPA 2FNEA 2YT8A 2ENOA 2H2CA 5HEBA 1L6OA 1RZXA 2Z9IA 4Z33A 3RL8A 2IWNA 2JSNA 2KA9A 1X9ZA 1VAEA 3STJA 1U37A 3SOEA 2WL7A 2EEHA 1UJUA 1NF3C 2I6VA 4IC6A 2I0LA 2L4TA 3LNYA 3PDZA 1WHAA 2EGNA 2EEIA 3MH7A 5F67A 1UF1A 1UJDA 4NMTA 2OPGA 1U38A 4L8NA 2OSGA 2DLUA 1KWAA 1N7TA 5FHTA 2F0AA 1KEFA 4NNLA 4Q2PA 5HFBA 2D90A 3EGGC 4Q2NA 1OBXA 1UJVA 4OEOA 2DM8A 4NXPA 2OZFA 1BE9A 2R4HA 2QG1A 3CC0A 3K82A 2EEJA 1P1EA 2QKVA 4E34A 3CBZA 4K76A 3WKMA 1WI4A 1Y7NA 2V1WA 3PDVA 4NMSA 2KOMA 1PDRA 3KZEA 4Q3HA 2YTWA 3ID2A 5IL9A 3SFJA 3BPUA 4GVCA 3SHUA 1V5QA 4E3BA 3R69A 1N6EA 5GNDA 4Q2OA 1G9OA 2K1ZA 3B76A 2D8IA 2KQFA 1VA8A 2KOHA 5D13A 2YT7A 1UM7A 1ZOKA 3HVQC 1ZUBA 2LUIA 2R3YA 4YYXA 2L4SA 3GDVA 5B6LA 3GJ9A 1UITA 5H3JA 2AWWA 1GQ5A 4LMMA 1X5RA 1TE0A 3QJNA 5E6PB 5A2PA 4YDPA 4REYA 5HF1A 2IWOA 2FE5A 2OQSA 2KRGA 3DJ1A 3TMHA 2HE2A 4O06A 2M3MA 1MFGA 3QE1A 2DKRA 3GCNA 2KJKA 4H11A 5E11A 3PV2A 2EDVA 3CS0A 2Z17A 2KPKA 2H3LA 3I4WA 1N6DA 1GQ4A 1VJ6A 3RLEA 4Z8JA 1N7FA 3KDKA 1Z87A 3E17A 2MX6A 4GHNA 4HOPA 5GLJA 4RI0A 2PDZA 1WF8A 2JOAA 1B8QA 2OMJA 1P1DA 3ID3A 1MC7A 4JORA 2KYLA 1OZIA 2LC7A 1QAVA 1VCWA 3HPMA 3MH6A 3ZRTA 2MHOA 1WHDA 3QGLA 4G69A 3GGEA 2AINA 4AMHA 3MH4A 3JXTA 3WKLA 1UEWA 1W9OA 5E22A 1Y8TA 1N99A 3EGHC 2YUBA 4NNMA 2EJYA 1KY9A 3R0HA 1Q3OA 2ZPMA 2Q9VA 4NMVA 3RL7A 2KBSA 2EDPA 3NFLA 2M0ZA 4JOJA 4JOFA 2OS6A 2D92A 1QAUA 2G2LA 2P3WA 1Q3PA 2JXOA 4EDJA 2EV8A 3O5NA 4OAJA 3PV5A 2DJTA 2X7ZA 4K78A 4K75A 2HE4A 4MPAA 1NTEA 2DB5A 2W4FA 3I1EA 4K6YA 2I1NA 2DMZA 3KDGA 1WG6A 4KFVA 5HFEA 3DORA 1YBOA 3AXAA 2Q3GA 2EGOA 3GABA 4E35A 3TSZA
chains in the Genus database with same CATH topology
1X8SA 5HEYA 3R68A 1M5ZA 2I04A 1TQ3A 1N6FA 4F8KA 3I18A 1V1TA 3LNXA 5HEDA 2EHRA 2DC2A 3SHWA 2JINA 4JOGA 2M0TA 2AWUA 4FLNA 4PQWA 1UM1A 5G1EA 1X6DA 1OBZA 2G5MB 1OBYA 3GCOA 2JREA 4N6XA 5HDYA 5G1DA 1D5GA 1GM1A 2OGPA 3O46A 3DJAA 4JOPA 2W7RA 2VWRA 3NCVA 1IU2A 3CBXA 4Q2QA 4Q6HA 2QKUA 3TSWA 4NXQA 3ID1A 2GEFA 5E21A 1I16A 5I7ZA 4R2ZA 2AWXA 2L97A 1BFEA 5HETA 2BYGA 2K20A 1I92A 2M0UA 5HFCA 5F3XA 2QBWA 3DIWA 4WYTA 2EXGA 1LCYA 4OEPA 2O2TA 1K32A 2GZVA 3QDOA 2H3MA 2JIKA 1FC9A 2IWQA 4JOKA 1TP5A 4HOPB 2M10A 3OTPA 1U3BA 3ID4A 4JJ0A 4KFWA 2EGKA 2YUYA 4NMQA 3DJ3A 1FCFA 1U39A 1QAVB 3PV4A 2UZCA 4NMRA 4UU6A 1X5NA 2QT5A 2FCFA 3OU0A 5DTHA 1TP3A 3KHFA 4JL7A 3PS4A 3KZDA 2PZDA 1IHJA 5JXBA 1WFGA 2KAWA 2EAQA 3L4FD 2ZPLA 3QIKA 2KPLA 4K72A 4FGMA 1N7EA 2OCSA 1WJLA 2IWPA 1R6JA 2LA8A 2F5YA 2EDZA 2I0IA 1IU0A 5E1YA 2QKTA 1SOZA 1W9EA 3QJMA 1T2MA 5HJ1A 3GSLA 3NGHA 4JOEA 5EZ0A 1X5QA 1X45A 4NMOA 4NMPA 1QLCA 2RCZA 2FN5A 3NFKA 2PKUA 3CH8A 2VZ5A 5B42A 1FC7A 2PKTA 1WH1A 2EEGA 1VB7A 4P2AB 2DAZA 1MFLA 3QO6A 4NXRA 1V6BA 3GDSA 5HF4A 2VSPA 2I4SA 1RY4A 2H2BA 1FC6A 1RGRA 2KV8A 1WIFA 2HGAA 1W9QA 2CS5A 2REYA 2M0VA 1V62A 2RRMA 2VRFA 2LOBA 1UEQA 2KL1A 1RGWA 2JWEA 2KJDA 1Q7XA 5FB8C 1UEZA 3K1RA 2KOJA 5EYZA 3GDUA 1WI2A 1SOTA 2LC6A 4JOHA 2JILA 4WYUA 5HFFA 4GVDA 2E7KA 2VSVA 3CYYA 5HFDA 2DLSA 3CBYA 4XHVA 2KJPA 3FY5A 3HPKA 1WF7A 3VQFA 1UFXA 1V5LA 2PNTA 3SUZA 1XZ9A 3TSVA 2KG2A 4UU5A 3K50A 4JJ3A 3VQGA 1Z86A 1WFVA 1UHPA 2V90A 5ILBA 2VPHA 4P0CA 2PA1A 2CSSA 4Q6SA 2CSJA 1UEPA 2FNEA 2YT8A 2ENOA 2H2CA 5HEBA 1L6OA 1RZXA 2Z9IA 4Z33A 3RL8A 2IWNA 2JSNA 2KA9A 1X9ZA 1VAEA 3STJA 1U37A 3SOEA 2WL7A 2EEHA 1UJUA 1NF3C 2I6VA 4IC6A 2I0LA 2L4TA 3LNYA 3PDZA 1WHAA 2EGNA 2EEIA 3MH7A 5F67A 1UF1A 1UJDA 4NMTA 2OPGA 1U38A 4L8NA 2OSGA 2DLUA 1KWAA 1N7TA 5FHTA 2F0AA 1KEFA 4NNLA 4Q2PA 5HFBA 2D90A 3EGGC 4Q2NA 1OBXA 1UJVA 4OEOA 2DM8A 4NXPA 2OZFA 1BE9A 2R4HA 2QG1A 3CC0A 3K82A 2EEJA 1P1EA 2QKVA 4E34A 3CBZA 4K76A 3WKMA 1WI4A 1Y7NA 2V1WA 3PDVA 4NMSA 2KOMA 1PDRA 3KZEA 4Q3HA 2YTWA 3ID2A 5IL9A 3SFJA 3BPUA 4GVCA 3SHUA 1V5QA 4E3BA 3R69A 1N6EA 5GNDA 4Q2OA 1G9OA 2K1ZA 3B76A 2D8IA 2KQFA 1VA8A 2KOHA 5D13A 2YT7A 1UM7A 1ZOKA 3HVQC 1ZUBA 2LUIA 2R3YA 4YYXA 2L4SA 3GDVA 5B6LA 3GJ9A 1UITA 5H3JA 2AWWA 1GQ5A 4LMMA 1X5RA 1TE0A 3QJNA 5E6PB 5A2PA 4YDPA 4REYA 5HF1A 2IWOA 2FE5A 2OQSA 2KRGA 3DJ1A 3TMHA 2HE2A 4O06A 2M3MA 1MFGA 3QE1A 2DKRA 3GCNA 2KJKA 4H11A 5E11A 3PV2A 2EDVA 3CS0A 2Z17A 2KPKA 2H3LA 3I4WA 1N6DA 1GQ4A 1VJ6A 3RLEA 4Z8JA 1N7FA 3KDKA 1Z87A 3E17A 2MX6A 4GHNA 4HOPA 5GLJA 4RI0A 2PDZA 1WF8A 2JOAA 1B8QA 2OMJA 1P1DA 3ID3A 1MC7A 4JORA 2KYLA 1OZIA 2LC7A 1QAVA 1VCWA 3HPMA 3MH6A 3ZRTA 2MHOA 1WHDA 3QGLA 4G69A 3GGEA 2AINA 4AMHA 3MH4A 3JXTA 3WKLA 1UEWA 1W9OA 5E22A 1Y8TA 1N99A 3EGHC 2YUBA 4NNMA 2EJYA 1KY9A 3R0HA 1Q3OA 2ZPMA 2Q9VA 4NMVA 3RL7A 2KBSA 2EDPA 3NFLA 2M0ZA 4JOJA 4JOFA 2OS6A 2D92A 1QAUA 2G2LA 2P3WA 1Q3PA 2JXOA 4EDJA 2EV8A 3O5NA 4OAJA 3PV5A 2DJTA 2X7ZA 4K78A 4K75A 2HE4A 4MPAA 1NTEA 2DB5A 2W4FA 3I1EA 4K6YA 2I1NA 2DMZA 3KDGA 1WG6A 4KFVA 5HFEA 3DORA 1YBOA 3AXAA 2Q3GA 2EGOA 3GABA 4E35A 3TSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8S A;  5HEY A;  3R68 A;  1M5Z A;  2I04 A;  1TQ3 A;  1N6F A;  4F8K A;  3I18 A;  1V1T A;  3LNX A;  5HED A;  2EHR A;  2DC2 A;  3SHW A;  2JIN A;  4JOG A;  2M0T A;  2AWU A;  4PQW A;  1UM1 A;  5G1E A;  1X6D A;  1OBZ A;  2G5M B;  1OBY A;  3GCO A;  2JRE A;  4N6X A;  5HDY A;  5G1D A;  1D5G A;  1GM1 A;  2OGP A;  3O46 A;  3DJA A;  4JOP A;  2W7R A;  2VWR A;  1IU2 A;  3CBX A;  4Q2Q A;  4Q6H A;  2QKU A;  3TSW A;  4NXQ A;  3ID1 A;  5E21 A;  1I16 A;  5I7Z A;  4R2Z A;  2AWX A;  2L97 A;  1BFE A;  5HET A;  2BYG A;  2K20 A;  1I92 A;  2M0U A;  5HFC A;  5F3X A;  2QBW A;  3DIW A;  4WYT A;  2EXG A;  1LCY A;  4OEP A;  2O2T A;  1K32 A;  2GZV A;  3QDO A;  2H3M A;  2JIK A;  1FC9 A;  2IWQ A;  4JOK A;  1TP5 A;  4HOP B;  2M10 A;  3OTP A;  1U3B A;  3ID4 A;  4KFW A;  2EGK A;  2YUY A;  4NMQ A;  3DJ3 A;  1FCF A;  1U39 A;  1QAV B;  3PV4 A;  2UZC A;  4NMR A;  4UU6 A;  1X5N A;  2QT5 A;  2FCF A;  3OU0 A;  5DTH A;  1TP3 A;  3KHF A;  4JL7 A;  3PS4 A;  3KZD A;  2PZD A;  1IHJ A;  5JXB A;  1WFG A;  2KAW A;  2EAQ A;  3L4F D;  2ZPL A;  3QIK A;  2KPL A;  4K72 A;  4FGM A;  1N7E A;  2OCS A;  1WJL A;  2IWP A;  1R6J A;  2LA8 A;  2F5Y A;  2EDZ A;  2I0I A;  1IU0 A;  5E1Y A;  2QKT A;  1SOZ A;  1W9E A;  3QJM A;  1T2M A;  5HJ1 A;  3GSL A;  3NGH A;  4JOE A;  5EZ0 A;  1X5Q A;  1X45 A;  4NMO A;  4NMP A;  1QLC A;  2RCZ A;  2FN5 A;  3NFK A;  2PKU A;  3CH8 A;  2VZ5 A;  1FC7 A;  2PKT A;  1WH1 A;  2EEG A;  1VB7 A;  4P2A B;  2DAZ A;  1MFL A;  3QO6 A;  4NXR A;  1V6B A;  3GDS A;  5HF4 A;  2VSP A;  2I4S A;  1RY4 A;  2H2B A;  1FC6 A;  1RGR A;  2KV8 A;  1WIF A;  2HGA A;  1W9Q A;  2CS5 A;  2REY A;  2M0V A;  1V62 A;  2RRM A;  2VRF A;  2LOB A;  1UEQ A;  2KL1 A;  1RGW A;  2JWE A;  2KJD A;  1Q7X A;  5FB8 C;  1UEZ A;  3K1R A;  2KOJ A;  5EYZ A;  3GDU A;  1WI2 A;  1SOT A;  2LC6 A;  4JOH A;  2JIL A;  4WYU A;  5HFF A;  4GVD A;  2E7K A;  2VSV A;  3CYY A;  5HFD A;  2DLS A;  3CBY A;  4XHV A;  2KJP A;  3FY5 A;  3HPK A;  1WF7 A;  3VQF A;  1UFX A;  1V5L A;  2PNT A;  3SUZ A;  1XZ9 A;  3TSV A;  2KG2 A;  4UU5 A;  3K50 A;  3VQG A;  1Z86 A;  1WFV A;  1UHP A;  2V90 A;  2VPH A;  4P0C A;  2PA1 A;  2CSS A;  4Q6S A;  2CSJ A;  1UEP A;  2FNE A;  2YT8 A;  2ENO A;  2H2C A;  5HEB A;  1L6O A;  1RZX A;  2Z9I A;  4Z33 A;  3RL8 A;  2IWN A;  2KA9 A;  1VAE A;  3STJ A;  1U37 A;  3SOE A;  2WL7 A;  2EEH A;  1UJU A;  1NF3 C;  2I6V A;  4IC6 A;  2I0L A;  2L4T A;  3LNY A;  3PDZ A;  1WHA A;  2EGN A;  2EEI A;  3MH7 A;  5F67 A;  1UF1 A;  1UJD A;  4NMT A;  2OPG A;  1U38 A;  4L8N A;  2OSG A;  2DLU A;  1KWA A;  1N7T A;  5FHT A;  2F0A A;  1KEF A;  4NNL A;  4Q2P A;  5HFB A;  2D90 A;  3EGG C;  4Q2N A;  1OBX A;  1UJV A;  4OEO A;  2DM8 A;  4NXP A;  2OZF A;  1BE9 A;  2R4H A;  2QG1 A;  3CC0 A;  3K82 A;  2EEJ A;  1P1E A;  2QKV A;  4E34 A;  3CBZ A;  4K76 A;  3WKM A;  1WI4 A;  1Y7N A;  2V1W A;  3PDV A;  4NMS A;  2KOM A;  1PDR A;  3KZE A;  4Q3H A;  2YTW A;  3ID2 A;  3SFJ A;  3BPU A;  4GVC A;  3SHU A;  1V5Q A;  4E3B A;  3R69 A;  1N6E A;  5GND A;  4Q2O A;  1G9O A;  2K1Z A;  3B76 A;  2D8I A;  2KQF A;  1VA8 A;  2KOH A;  5D13 A;  2YT7 A;  1UM7 A;  1ZOK A;  3HVQ C;  1ZUB A;  2LUI A;  2R3Y A;  4YYX A;  2L4S A;  3GDV A;  5B6L A;  3GJ9 A;  1UIT A;  5H3J A;  2AWW A;  1GQ5 A;  4LMM A;  1X5R A;  1TE0 A;  3QJN A;  5E6P B;  5A2P A;  4YDP A;  4REY A;  5HF1 A;  2IWO A;  2FE5 A;  2OQS A;  2KRG A;  3DJ1 A;  3TMH A;  2HE2 A;  4O06 A;  2M3M A;  1MFG A;  3QE1 A;  2DKR A;  3GCN A;  2KJK A;  4H11 A;  5E11 A;  3PV2 A;  2EDV A;  3CS0 A;  2Z17 A;  2KPK A;  2H3L A;  3I4W A;  1N6D A;  1GQ4 A;  1VJ6 A;  3RLE A;  4Z8J A;  1N7F A;  1Z87 A;  3E17 A;  2MX6 A;  4GHN A;  4HOP A;  5GLJ A;  4RI0 A;  2PDZ A;  1WF8 A;  2JOA A;  1B8Q A;  2OMJ A;  1P1D A;  3ID3 A;  1MC7 A;  4JOR A;  2KYL A;  1OZI A;  2LC7 A;  1QAV A;  1VCW A;  3HPM A;  3MH6 A;  3ZRT A;  2MHO A;  1WHD A;  3QGL A;  4G69 A;  3GGE A;  2AIN A;  4AMH A;  3MH4 A;  3JXT A;  3WKL A;  1UEW A;  1W9O A;  5E22 A;  1Y8T A;  1N99 A;  3EGH C;  2YUB A;  4NNM A;  2EJY A;  1KY9 A;  3R0H A;  1Q3O A;  2ZPM A;  2Q9V A;  4NMV A;  3RL7 A;  2KBS A;  2EDP A;  3NFL A;  2M0Z A;  4JOJ A;  4JOF A;  2OS6 A;  2D92 A;  1QAU A;  2G2L A;  2P3W A;  1Q3P A;  2JXO A;  4EDJ A;  2EV8 A;  3O5N A;  4OAJ A;  3PV5 A;  2DJT A;  2X7Z A;  4K78 A;  4K75 A;  2HE4 A;  4MPA A;  1NTE A;  2DB5 A;  2W4F A;  3I1E A;  4K6Y A;  2I1N A;  2DMZ A;  1WG6 A;  4KFV A;  5HFE A;  3DOR A;  1YBO A;  3AXA A;  2Q3G A;  2EGO A;  4E35 A;  3TSZ A; 
#chains in the Genus database with same CATH topology
 1X8S A;  5HEY A;  3R68 A;  1M5Z A;  2I04 A;  1TQ3 A;  1N6F A;  4F8K A;  3I18 A;  1V1T A;  3LNX A;  5HED A;  2EHR A;  2DC2 A;  3SHW A;  2JIN A;  4JOG A;  2M0T A;  2AWU A;  4FLN A;  4PQW A;  1UM1 A;  5G1E A;  1X6D A;  1OBZ A;  2G5M B;  1OBY A;  3GCO A;  2JRE A;  4N6X A;  5HDY A;  5G1D A;  1D5G A;  1GM1 A;  2OGP A;  3O46 A;  3DJA A;  4JOP A;  2W7R A;  2VWR A;  3NCV A;  1IU2 A;  3CBX A;  4Q2Q A;  4Q6H A;  2QKU A;  3TSW A;  4NXQ A;  3ID1 A;  2GEF A;  5E21 A;  1I16 A;  5I7Z A;  4R2Z A;  2AWX A;  2L97 A;  1BFE A;  5HET A;  2BYG A;  2K20 A;  1I92 A;  2M0U A;  5HFC A;  5F3X A;  2QBW A;  3DIW A;  4WYT A;  2EXG A;  1LCY A;  4OEP A;  2O2T A;  1K32 A;  2GZV A;  3QDO A;  2H3M A;  2JIK A;  1FC9 A;  2IWQ A;  4JOK A;  1TP5 A;  4HOP B;  2M10 A;  3OTP A;  1U3B A;  3ID4 A;  4JJ0 A;  4KFW A;  2EGK A;  2YUY A;  4NMQ A;  3DJ3 A;  1FCF A;  1U39 A;  1QAV B;  3PV4 A;  2UZC A;  4NMR A;  4UU6 A;  1X5N A;  2QT5 A;  2FCF A;  3OU0 A;  5DTH A;  1TP3 A;  3KHF A;  4JL7 A;  3PS4 A;  3KZD A;  2PZD A;  1IHJ A;  5JXB A;  1WFG A;  2KAW A;  2EAQ A;  3L4F D;  2ZPL A;  3QIK A;  2KPL A;  4K72 A;  4FGM A;  1N7E A;  2OCS A;  1WJL A;  2IWP A;  1R6J A;  2LA8 A;  2F5Y A;  2EDZ A;  2I0I A;  1IU0 A;  5E1Y A;  2QKT A;  1SOZ A;  1W9E A;  3QJM A;  1T2M A;  5HJ1 A;  3GSL A;  3NGH A;  4JOE A;  5EZ0 A;  1X5Q A;  1X45 A;  4NMO A;  4NMP A;  1QLC A;  2RCZ A;  2FN5 A;  3NFK A;  2PKU A;  3CH8 A;  2VZ5 A;  5B42 A;  1FC7 A;  2PKT A;  1WH1 A;  2EEG A;  1VB7 A;  4P2A B;  2DAZ A;  1MFL A;  3QO6 A;  4NXR A;  1V6B A;  3GDS A;  5HF4 A;  2VSP A;  2I4S A;  1RY4 A;  2H2B A;  1FC6 A;  1RGR A;  2KV8 A;  1WIF A;  2HGA A;  1W9Q A;  2CS5 A;  2REY A;  2M0V A;  1V62 A;  2RRM A;  2VRF A;  2LOB A;  1UEQ A;  2KL1 A;  1RGW A;  2JWE A;  2KJD A;  1Q7X A;  5FB8 C;  1UEZ A;  3K1R A;  2KOJ A;  5EYZ A;  3GDU A;  1WI2 A;  1SOT A;  2LC6 A;  4JOH A;  2JIL A;  4WYU A;  5HFF A;  4GVD A;  2E7K A;  2VSV A;  3CYY A;  5HFD A;  2DLS A;  3CBY A;  4XHV A;  2KJP A;  3FY5 A;  3HPK A;  1WF7 A;  3VQF A;  1UFX A;  1V5L A;  2PNT A;  3SUZ A;  1XZ9 A;  3TSV A;  2KG2 A;  4UU5 A;  3K50 A;  4JJ3 A;  3VQG A;  1Z86 A;  1WFV A;  1UHP A;  2V90 A;  5ILB A;  2VPH A;  4P0C A;  2PA1 A;  2CSS A;  4Q6S A;  2CSJ A;  1UEP A;  2FNE A;  2YT8 A;  2ENO A;  2H2C A;  5HEB A;  1L6O A;  1RZX A;  2Z9I A;  4Z33 A;  3RL8 A;  2IWN A;  2JSN A;  2KA9 A;  1X9Z A;  1VAE A;  3STJ A;  1U37 A;  3SOE A;  2WL7 A;  2EEH A;  1UJU A;  1NF3 C;  2I6V A;  4IC6 A;  2I0L A;  2L4T A;  3LNY A;  3PDZ A;  1WHA A;  2EGN A;  2EEI A;  3MH7 A;  5F67 A;  1UF1 A;  1UJD A;  4NMT A;  2OPG A;  1U38 A;  4L8N A;  2OSG A;  2DLU A;  1KWA A;  1N7T A;  5FHT A;  2F0A A;  1KEF A;  4NNL A;  4Q2P A;  5HFB A;  2D90 A;  3EGG C;  4Q2N A;  1OBX A;  1UJV A;  4OEO A;  2DM8 A;  4NXP A;  2OZF A;  1BE9 A;  2R4H A;  2QG1 A;  3CC0 A;  3K82 A;  2EEJ A;  1P1E A;  2QKV A;  4E34 A;  3CBZ A;  4K76 A;  3WKM A;  1WI4 A;  1Y7N A;  2V1W A;  3PDV A;  4NMS A;  2KOM A;  1PDR A;  3KZE A;  4Q3H A;  2YTW A;  3ID2 A;  5IL9 A;  3SFJ A;  3BPU A;  4GVC A;  3SHU A;  1V5Q A;  4E3B A;  3R69 A;  1N6E A;  5GND A;  4Q2O A;  1G9O A;  2K1Z A;  3B76 A;  2D8I A;  2KQF A;  1VA8 A;  2KOH A;  5D13 A;  2YT7 A;  1UM7 A;  1ZOK A;  3HVQ C;  1ZUB A;  2LUI A;  2R3Y A;  4YYX A;  2L4S A;  3GDV A;  5B6L A;  3GJ9 A;  1UIT A;  5H3J A;  2AWW A;  1GQ5 A;  4LMM A;  1X5R A;  1TE0 A;  3QJN A;  5E6P B;  5A2P A;  4YDP A;  4REY A;  5HF1 A;  2IWO A;  2FE5 A;  2OQS A;  2KRG A;  3DJ1 A;  3TMH A;  2HE2 A;  4O06 A;  2M3M A;  1MFG A;  3QE1 A;  2DKR A;  3GCN A;  2KJK A;  4H11 A;  5E11 A;  3PV2 A;  2EDV A;  3CS0 A;  2Z17 A;  2KPK A;  2H3L A;  3I4W A;  1N6D A;  1GQ4 A;  1VJ6 A;  3RLE A;  4Z8J A;  1N7F A;  3KDK A;  1Z87 A;  3E17 A;  2MX6 A;  4GHN A;  4HOP A;  5GLJ A;  4RI0 A;  2PDZ A;  1WF8 A;  2JOA A;  1B8Q A;  2OMJ A;  1P1D A;  3ID3 A;  1MC7 A;  4JOR A;  2KYL A;  1OZI A;  2LC7 A;  1QAV A;  1VCW A;  3HPM A;  3MH6 A;  3ZRT A;  2MHO A;  1WHD A;  3QGL A;  4G69 A;  3GGE A;  2AIN A;  4AMH A;  3MH4 A;  3JXT A;  3WKL A;  1UEW A;  1W9O A;  5E22 A;  1Y8T A;  1N99 A;  3EGH C;  2YUB A;  4NNM A;  2EJY A;  1KY9 A;  3R0H A;  1Q3O A;  2ZPM A;  2Q9V A;  4NMV A;  3RL7 A;  2KBS A;  2EDP A;  3NFL A;  2M0Z A;  4JOJ A;  4JOF A;  2OS6 A;  2D92 A;  1QAU A;  2G2L A;  2P3W A;  1Q3P A;  2JXO A;  4EDJ A;  2EV8 A;  3O5N A;  4OAJ A;  3PV5 A;  2DJT A;  2X7Z A;  4K78 A;  4K75 A;  2HE4 A;  4MPA A;  1NTE A;  2DB5 A;  2W4F A;  3I1E A;  4K6Y A;  2I1N A;  2DMZ A;  3KDG A;  1WG6 A;  4KFV A;  5HFE A;  3DOR A;  1YBO A;  3AXA A;  2Q3G A;  2EGO A;  3GAB A;  4E35 A;  3TSZ A; 
#chains in the Genus database with same CATH homology
 1X8S A;  5HEY A;  3R68 A;  1M5Z A;  2I04 A;  1TQ3 A;  1N6F A;  4F8K A;  3I18 A;  1V1T A;  3LNX A;  5HED A;  2EHR A;  2DC2 A;  3SHW A;  2JIN A;  4JOG A;  2M0T A;  2AWU A;  4FLN A;  4PQW A;  1UM1 A;  5G1E A;  1X6D A;  1OBZ A;  2G5M B;  1OBY A;  3GCO A;  2JRE A;  4N6X A;  5HDY A;  5G1D A;  1D5G A;  1GM1 A;  2OGP A;  3O46 A;  3DJA A;  4JOP A;  2W7R A;  2VWR A;  3NCV A;  1IU2 A;  3CBX A;  4Q2Q A;  4Q6H A;  2QKU A;  3TSW A;  4NXQ A;  3ID1 A;  2GEF A;  5E21 A;  1I16 A;  5I7Z A;  4R2Z A;  2AWX A;  2L97 A;  1BFE A;  5HET A;  2BYG A;  2K20 A;  1I92 A;  2M0U A;  5HFC A;  5F3X A;  2QBW A;  3DIW A;  4WYT A;  2EXG A;  1LCY A;  4OEP A;  2O2T A;  1K32 A;  2GZV A;  3QDO A;  2H3M A;  2JIK A;  1FC9 A;  2IWQ A;  4JOK A;  1TP5 A;  4HOP B;  2M10 A;  3OTP A;  1U3B A;  3ID4 A;  4JJ0 A;  4KFW A;  2EGK A;  2YUY A;  4NMQ A;  3DJ3 A;  1FCF A;  1U39 A;  1QAV B;  3PV4 A;  2UZC A;  4NMR A;  4UU6 A;  1X5N A;  2QT5 A;  2FCF A;  3OU0 A;  5DTH A;  1TP3 A;  3KHF A;  4JL7 A;  3PS4 A;  3KZD A;  2PZD A;  1IHJ A;  5JXB A;  1WFG A;  2KAW A;  2EAQ A;  3L4F D;  2ZPL A;  3QIK A;  2KPL A;  4K72 A;  4FGM A;  1N7E A;  2OCS A;  1WJL A;  2IWP A;  1R6J A;  2LA8 A;  2F5Y A;  2EDZ A;  2I0I A;  1IU0 A;  5E1Y A;  2QKT A;  1SOZ A;  1W9E A;  3QJM A;  1T2M A;  5HJ1 A;  3GSL A;  3NGH A;  4JOE A;  5EZ0 A;  1X5Q A;  1X45 A;  4NMO A;  4NMP A;  1QLC A;  2RCZ A;  2FN5 A;  3NFK A;  2PKU A;  3CH8 A;  2VZ5 A;  5B42 A;  1FC7 A;  2PKT A;  1WH1 A;  2EEG A;  1VB7 A;  4P2A B;  2DAZ A;  1MFL A;  3QO6 A;  4NXR A;  1V6B A;  3GDS A;  5HF4 A;  2VSP A;  2I4S A;  1RY4 A;  2H2B A;  1FC6 A;  1RGR A;  2KV8 A;  1WIF A;  2HGA A;  1W9Q A;  2CS5 A;  2REY A;  2M0V A;  1V62 A;  2RRM A;  2VRF A;  2LOB A;  1UEQ A;  2KL1 A;  1RGW A;  2JWE A;  2KJD A;  1Q7X A;  5FB8 C;  1UEZ A;  3K1R A;  2KOJ A;  5EYZ A;  3GDU A;  1WI2 A;  1SOT A;  2LC6 A;  4JOH A;  2JIL A;  4WYU A;  5HFF A;  4GVD A;  2E7K A;  2VSV A;  3CYY A;  5HFD A;  2DLS A;  3CBY A;  4XHV A;  2KJP A;  3FY5 A;  3HPK A;  1WF7 A;  3VQF A;  1UFX A;  1V5L A;  2PNT A;  3SUZ A;  1XZ9 A;  3TSV A;  2KG2 A;  4UU5 A;  3K50 A;  4JJ3 A;  3VQG A;  1Z86 A;  1WFV A;  1UHP A;  2V90 A;  5ILB A;  2VPH A;  4P0C A;  2PA1 A;  2CSS A;  4Q6S A;  2CSJ A;  1UEP A;  2FNE A;  2YT8 A;  2ENO A;  2H2C A;  5HEB A;  1L6O A;  1RZX A;  2Z9I A;  4Z33 A;  3RL8 A;  2IWN A;  2JSN A;  2KA9 A;  1X9Z A;  1VAE A;  3STJ A;  1U37 A;  3SOE A;  2WL7 A;  2EEH A;  1UJU A;  1NF3 C;  2I6V A;  4IC6 A;  2I0L A;  2L4T A;  3LNY A;  3PDZ A;  1WHA A;  2EGN A;  2EEI A;  3MH7 A;  5F67 A;  1UF1 A;  1UJD A;  4NMT A;  2OPG A;  1U38 A;  4L8N A;  2OSG A;  2DLU A;  1KWA A;  1N7T A;  5FHT A;  2F0A A;  1KEF A;  4NNL A;  4Q2P A;  5HFB A;  2D90 A;  3EGG C;  4Q2N A;  1OBX A;  1UJV A;  4OEO A;  2DM8 A;  4NXP A;  2OZF A;  1BE9 A;  2R4H A;  2QG1 A;  3CC0 A;  3K82 A;  2EEJ A;  1P1E A;  2QKV A;  4E34 A;  3CBZ A;  4K76 A;  3WKM A;  1WI4 A;  1Y7N A;  2V1W A;  3PDV A;  4NMS A;  2KOM A;  1PDR A;  3KZE A;  4Q3H A;  2YTW A;  3ID2 A;  5IL9 A;  3SFJ A;  3BPU A;  4GVC A;  3SHU A;  1V5Q A;  4E3B A;  3R69 A;  1N6E A;  5GND A;  4Q2O A;  1G9O A;  2K1Z A;  3B76 A;  2D8I A;  2KQF A;  1VA8 A;  2KOH A;  5D13 A;  2YT7 A;  1UM7 A;  1ZOK A;  3HVQ C;  1ZUB A;  2LUI A;  2R3Y A;  4YYX A;  2L4S A;  3GDV A;  5B6L A;  3GJ9 A;  1UIT A;  5H3J A;  2AWW A;  1GQ5 A;  4LMM A;  1X5R A;  1TE0 A;  3QJN A;  5E6P B;  5A2P A;  4YDP A;  4REY A;  5HF1 A;  2IWO A;  2FE5 A;  2OQS A;  2KRG A;  3DJ1 A;  3TMH A;  2HE2 A;  4O06 A;  2M3M A;  1MFG A;  3QE1 A;  2DKR A;  3GCN A;  2KJK A;  4H11 A;  5E11 A;  3PV2 A;  2EDV A;  3CS0 A;  2Z17 A;  2KPK A;  2H3L A;  3I4W A;  1N6D A;  1GQ4 A;  1VJ6 A;  3RLE A;  4Z8J A;  1N7F A;  3KDK A;  1Z87 A;  3E17 A;  2MX6 A;  4GHN A;  4HOP A;  5GLJ A;  4RI0 A;  2PDZ A;  1WF8 A;  2JOA A;  1B8Q A;  2OMJ A;  1P1D A;  3ID3 A;  1MC7 A;  4JOR A;  2KYL A;  1OZI A;  2LC7 A;  1QAV A;  1VCW A;  3HPM A;  3MH6 A;  3ZRT A;  2MHO A;  1WHD A;  3QGL A;  4G69 A;  3GGE A;  2AIN A;  4AMH A;  3MH4 A;  3JXT A;  3WKL A;  1UEW A;  1W9O A;  5E22 A;  1Y8T A;  1N99 A;  3EGH C;  2YUB A;  4NNM A;  2EJY A;  1KY9 A;  3R0H A;  1Q3O A;  2ZPM A;  2Q9V A;  4NMV A;  3RL7 A;  2KBS A;  2EDP A;  3NFL A;  2M0Z A;  4JOJ A;  4JOF A;  2OS6 A;  2D92 A;  1QAU A;  2G2L A;  2P3W A;  1Q3P A;  2JXO A;  4EDJ A;  2EV8 A;  3O5N A;  4OAJ A;  3PV5 A;  2DJT A;  2X7Z A;  4K78 A;  4K75 A;  2HE4 A;  4MPA A;  1NTE A;  2DB5 A;  2W4F A;  3I1E A;  4K6Y A;  2I1N A;  2DMZ A;  3KDG A;  1WG6 A;  4KFV A;  5HFE A;  3DOR A;  1YBO A;  3AXA A;  2Q3G A;  2EGO A;  3GAB A;  4E35 A;  3TSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...