5JXBA

Psd-95 extended pdz3 in complex with syngap pbm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
122
structure length
117
Chain Sequence
b'FREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSFPPWVQQTRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4,SynGAP
publication title Phase Transition in Postsynaptic Densities Underlies Formation of Synaptic Complexes and Synaptic Plasticity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 122
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5jxbA00
3DJAA 1UEWA 3GJ9A 1WHDA 4LMMA 1NF3C 4K72A 1N7FA 4JORA 3E17A 4WYUA 4G69A 2MX6A 5HF4A 4FGMA 2KPLA 1GQ4A 3OU0A 1UJUA 1UEZA 1UITA 1N99A 1VB7A 4F8KA 1P1EA 1TE0A 2L97A 2Z9IA 1UJVA 2VSVA 3TMHA 4Q6HA 2EEIA 3NFKA 3RL7A 1N6EA 2YT8A 4JOJA 2OCSA 2LC6A 4Q2PA 3QO6A 3R0HA 5HEDA 2OZFA 3L4FD 2FNEA 1KEFA 2YT7A 3HVQC 1IU2A 5I7ZA 3HPMA 2D90A 3RL8A 2LOBA 3CBZA 2M0VA 2EJYA 1X8SA 2VRFA 4K78A 4H11A 4MPAA 1V1TA 1TP5A 2KYLA 2CSSA 2JWEA 4GVDA 1P1DA 2G5MB 5EYZA 4K76A 5HDYA 5HFBA 3GDUA 2EDZA 2W4FA 3CC0A 2H3LA 2FE5A 1WFGA 2V90A 3MH7A 1GQ5A 3DIWA 5EZ0A 2I0LA 2VWRA 2YTWA 1XZ9A 2R3YA 2M3MA 3QJNA 3OTPA 3O5NA 1X6DA 2AINA 4NMTA 3R68A 1L6OA 2PKUA 2ENOA 4NXPA 2IWOA 4JOKA 1I92A 2EEJA 2DLUA 1W9QA 2QKUA 5FB8C 1V62A 4Q2NA 2O2TA 2IWNA 2VPHA 4L8NA 3KHFA 1KWAA 3CBYA 2FCFA 5G1EA 1LCYA 1MFLA 4IC6A 2VSPA 4YYXA 3PV2A 1T2MA 2LC7A 1BE9A 5HFFA 2PA1A 1QLCA 1WHAA 3ZRTA 2I6VA 2DB5A 2ZPMA 1ZOKA 1UEQA 1M5ZA 2DC2A 1VJ6A 2PZDA 2Q9VA 4RI0A 1SOTA 2CS5A 1TP3A 4OEOA 5F67A 1UM7A 2ZPLA 3DORA 3ID2A 2K20A 3BPUA 1W9OA 1UF1A 4NXRA 2OGPA 5HFDA 4EDJA 2EHRA 1NTEA 2DMZA 3ID1A 1U39A 1Z86A 2PNTA 1R6JA 1SOZA 1KY9A 3VQGA 2MHOA 1ZUBA 3WKLA 3ID3A 2I4SA 2V1WA 4R2ZA 4JOGA 4PQWA 2G2LA 4O06A 2OMJA 3VQFA 4XHVA 4Q2QA 1VCWA 2HE4A 3TSWA 3MH6A 2KBSA 3GDVA 4NMVA 2JXOA 2DAZA 3DJ3A 1WIFA 2JREA 2EGKA 2KOJA 3GCNA 5HFCA 1OBXA 2JOAA 3GCOA 1VA8A 3WKMA 4N6XA 2EGOA 1X45A 3R69A 5E6PB 1VAEA 5DTHA 4KFVA 3SUZA 1W9EA 2E7KA 1RGWA 3K82A 1FC6A 2AWUA 2GZVA 4UU5A 3QIKA 1QAUA 4NMOA 4JOPA 2KOHA 2M0UA 2QG1A 4Q3HA 2QBWA 1GM1A 2JILA 2QKVA 1BFEA 3CBXA 5HETA 1Q3PA 5HF1A 4JOHA 1V6BA 1FC9A 1G9OA 1WG6A 1WI2A 1U3BA 3K1RA 5FHTA 2F0AA 3QGLA 4E34A 2X7ZA 2DJTA 1WF8A 1WFVA 1X5QA 2KAWA 4KFWA 2KQFA 1V5QA 4NNLA 3JXTA 4Z33A 1PDRA 1Y8TA 2DM8A 2H3MA 2DKRA 3AXAA 4NMSA 2EDPA 4GVCA 3PV5A 4JOEA 1FCFA 1Y7NA 3KZDA 2KJPA 3STJA 2M0TA 2Q3GA 1MC7A 2I04A 2OPGA 5JXBA 3PDZA 3CS0A 2R4HA 2M0ZA 3I18A 2DLSA 1RGRA 1U37A 1Q7XA 1UHPA 1OBYA 2AWXA 2OQSA 3QE1A 4YDPA 2W7RA 1MFGA 2I0IA 3SHUA 2L4TA 2QT5A 2F5YA 3GSLA 1IHJA 4AMHA 4GHNA 2Z17A 1D5GA 5A2PA 5B6LA 2D92A 2JIKA 5GLJA 2LUIA 1FC7A 2AWWA 1OBZA 4OAJA 2IWPA 3FY5A 2KPKA 2KRGA 3PV4A 1X5RA 2PKTA 1Z87A 2JINA 5HFEA 2CSJA 3SOEA 5F3XA 3QDOA 4NMRA 1N7TA 2P3WA 4NMQA 4Z8JA 1V5LA 2REYA 3I4WA 1UFXA 1U38A 1WJLA 1UEPA 1K32A 5HEBA 3NGHA 1WI4A 4NXQA 4NNMA 1UJDA 4K6YA 2YUBA 3LNYA 4K75A 3I1EA 4P2AB 4UU6A 5E21A 4OEPA 3ID4A 2D8IA 3EGGC 1QAVA 2K1ZA 5HJ1A 3TSVA 3DJ1A 3QJMA 3CYYA 2RCZA 3PDVA 1N7EA 3EGHC 3O46A 5H3JA 1OZIA 3KZEA 3SHWA 2KL1A 2M10A 3LNXA 1B8QA 2H2CA 2FN5A 5E11A 2HE2A 4HOPA 2EGNA 2I1NA 2EDVA 1YBOA 3SFJA 3RLEA 3K50A 3GDSA 4P0CA 1I16A 1QAVB 2PDZA 3NFLA 4NMPA 2UZCA 2VZ5A 2EEHA 4E3BA 2QKTA 5GNDA 5HEYA 2EEGA 1RY4A 2IWQA 1N6DA 1TQ3A 2L4SA 3GGEA 3PS4A 1WH1A 5E1YA 2OSGA 2EV8A 2H2BA 4HOPB 1N6FA 2WL7A 3TSZA 2EXGA 2EAQA 5D13A 4JL7A 4Q6SA 2LA8A 1IU0A 4WYTA 4REYA 3HPKA 3MH4A 2KG2A 1UM1A 2HGAA 1X5NA 1Q3OA 2RRMA 2KOMA 4E35A 2OS6A 5G1DA 4Q2OA 2KV8A 5E22A 1RZXA 2YUYA 1WF7A 3B76A 3CH8A 2KA9A 2BYGA 2KJKA 4JOFA 2KJDA
chains in the Genus database with same CATH superfamily
3DJAA 1UEWA 3GJ9A 1WHDA 4LMMA 1NF3C 4K72A 1N7FA 4JORA 3E17A 4WYUA 4G69A 2MX6A 5HF4A 4FGMA 2KPLA 1GQ4A 3OU0A 1UJUA 1UEZA 1UITA 1N99A 1VB7A 4F8KA 1P1EA 1TE0A 2L97A 2Z9IA 1UJVA 2VSVA 3TMHA 4Q6HA 2EEIA 3NFKA 3RL7A 1N6EA 2YT8A 4JOJA 2OCSA 2LC6A 4Q2PA 3QO6A 3R0HA 5HEDA 2OZFA 3L4FD 2FNEA 1KEFA 2YT7A 3HVQC 1IU2A 5I7ZA 3HPMA 2D90A 3RL8A 2LOBA 3CBZA 2M0VA 2EJYA 1X8SA 2VRFA 4K78A 4H11A 4MPAA 1V1TA 1TP5A 2KYLA 2CSSA 2JWEA 4GVDA 1P1DA 2G5MB 5EYZA 4K76A 5HDYA 5HFBA 3GDUA 2EDZA 2W4FA 3CC0A 2H3LA 2FE5A 1WFGA 2V90A 3MH7A 1GQ5A 3DIWA 5EZ0A 2I0LA 2VWRA 2YTWA 1XZ9A 2R3YA 2M3MA 3QJNA 3OTPA 3O5NA 1X6DA 2AINA 4NMTA 3R68A 1L6OA 2PKUA 2ENOA 4NXPA 2IWOA 4JOKA 1I92A 5ILBA 2EEJA 2DLUA 1W9QA 2QKUA 5FB8C 1V62A 4Q2NA 2O2TA 2IWNA 2VPHA 4L8NA 3KHFA 1KWAA 3CBYA 2FCFA 5G1EA 1LCYA 1MFLA 4IC6A 2VSPA 4YYXA 3PV2A 1T2MA 2LC7A 1BE9A 5HFFA 2PA1A 1QLCA 1WHAA 3ZRTA 2I6VA 2DB5A 2ZPMA 1ZOKA 1UEQA 1M5ZA 2DC2A 1VJ6A 2PZDA 2Q9VA 4RI0A 1SOTA 2CS5A 1TP3A 4OEOA 5F67A 1UM7A 2ZPLA 3DORA 3ID2A 2K20A 3BPUA 1W9OA 1UF1A 4NXRA 4JJ0A 2OGPA 5HFDA 4EDJA 2EHRA 1NTEA 2DMZA 3ID1A 3KDGA 1U39A 1Z86A 2PNTA 1X9ZA 1R6JA 1SOZA 1KY9A 3VQGA 2MHOA 1ZUBA 3WKLA 3ID3A 2I4SA 2V1WA 4R2ZA 4JOGA 4PQWA 2G2LA 4O06A 2OMJA 3VQFA 4XHVA 4Q2QA 1VCWA 2HE4A 3TSWA 3MH6A 2KBSA 3GDVA 4NMVA 2JXOA 2DAZA 3DJ3A 1WIFA 2JREA 2EGKA 2KOJA 3GCNA 5HFCA 1OBXA 2JOAA 3GCOA 1VA8A 3WKMA 4N6XA 2JSNA 2EGOA 1X45A 3R69A 5E6PB 1VAEA 5DTHA 4KFVA 3SUZA 3NCVA 1W9EA 2E7KA 1RGWA 3K82A 3KDKA 1FC6A 2AWUA 2GZVA 4UU5A 3QIKA 1QAUA 4NMOA 4JOPA 2KOHA 2M0UA 2QG1A 4Q3HA 2QBWA 1GM1A 2JILA 2QKVA 1BFEA 3CBXA 5HETA 1Q3PA 5HF1A 4JOHA 1V6BA 1FC9A 1G9OA 1WG6A 1WI2A 1U3BA 3K1RA 5FHTA 2F0AA 3QGLA 4E34A 2X7ZA 2DJTA 1WF8A 4FLNA 1WFVA 1X5QA 2KAWA 4KFWA 2KQFA 1V5QA 4NNLA 3JXTA 4Z33A 1PDRA 1Y8TA 2DM8A 2H3MA 2DKRA 3AXAA 4NMSA 2EDPA 4GVCA 3PV5A 4JOEA 1FCFA 1Y7NA 3KZDA 2KJPA 3STJA 2M0TA 2Q3GA 1MC7A 2I04A 2OPGA 4JJ3A 5JXBA 3PDZA 3CS0A 2R4HA 2M0ZA 3I18A 2DLSA 1RGRA 1U37A 1Q7XA 1UHPA 1OBYA 2AWXA 2OQSA 3QE1A 4YDPA 2W7RA 1MFGA 2I0IA 3SHUA 2L4TA 2QT5A 2F5YA 3GSLA 1IHJA 4AMHA 4GHNA 2Z17A 1D5GA 5A2PA 5B6LA 2D92A 2JIKA 5GLJA 2LUIA 1FC7A 2AWWA 1OBZA 4OAJA 2IWPA 3FY5A 2KPKA 2KRGA 3PV4A 1X5RA 2PKTA 1Z87A 2JINA 5HFEA 2CSJA 3SOEA 5F3XA 3QDOA 4NMRA 1N7TA 2P3WA 4NMQA 4Z8JA 3GABA 1V5LA 2REYA 3I4WA 1UFXA 1U38A 1WJLA 1UEPA 1K32A 5HEBA 3NGHA 1WI4A 4NXQA 4NNMA 1UJDA 4K6YA 2YUBA 3LNYA 4K75A 3I1EA 4P2AB 4UU6A 5E21A 4OEPA 5B42A 3ID4A 2D8IA 3EGGC 1QAVA 2K1ZA 5HJ1A 3TSVA 3DJ1A 3QJMA 5IL9A 3CYYA 2RCZA 3PDVA 1N7EA 3EGHC 3O46A 5H3JA 1OZIA 3KZEA 3SHWA 2KL1A 2M10A 3LNXA 1B8QA 2H2CA 2FN5A 5E11A 2HE2A 4HOPA 2EGNA 2I1NA 2EDVA 1YBOA 3SFJA 3RLEA 3K50A 3GDSA 4P0CA 1I16A 1QAVB 2PDZA 3NFLA 4NMPA 2UZCA 2VZ5A 2EEHA 4E3BA 2QKTA 5GNDA 5HEYA 2EEGA 1RY4A 2IWQA 1N6DA 1TQ3A 2L4SA 3GGEA 3PS4A 1WH1A 5E1YA 2OSGA 2EV8A 2H2BA 4HOPB 1N6FA 2WL7A 3TSZA 2EXGA 2EAQA 5D13A 4JL7A 4Q6SA 2LA8A 1IU0A 4WYTA 4REYA 3HPKA 2GEFA 3MH4A 2KG2A 1UM1A 2HGAA 1X5NA 1Q3OA 2RRMA 2KOMA 4E35A 2OS6A 5G1DA 4Q2OA 2KV8A 5E22A 1RZXA 2YUYA 1WF7A 3B76A 3CH8A 2KA9A 2BYGA 2KJKA 4JOFA 2KJDA
chains in the Genus database with same CATH topology
3DJAA 1UEWA 3GJ9A 1WHDA 4LMMA 1NF3C 4K72A 1N7FA 4JORA 3E17A 4WYUA 4G69A 2MX6A 5HF4A 4FGMA 2KPLA 1GQ4A 3OU0A 1UJUA 1UEZA 1UITA 1N99A 1VB7A 4F8KA 1P1EA 1TE0A 2L97A 2Z9IA 1UJVA 2VSVA 3TMHA 4Q6HA 2EEIA 3NFKA 3RL7A 1N6EA 2YT8A 4JOJA 2OCSA 2LC6A 4Q2PA 3QO6A 3R0HA 5HEDA 2OZFA 3L4FD 2FNEA 1KEFA 2YT7A 3HVQC 1IU2A 5I7ZA 3HPMA 2D90A 3RL8A 2LOBA 3CBZA 2M0VA 2EJYA 1X8SA 2VRFA 4K78A 4H11A 4MPAA 1V1TA 1TP5A 2KYLA 2CSSA 2JWEA 4GVDA 1P1DA 2G5MB 5EYZA 4K76A 5HDYA 5HFBA 3GDUA 2EDZA 2W4FA 3CC0A 2H3LA 2FE5A 1WFGA 2V90A 3MH7A 1GQ5A 3DIWA 5EZ0A 2I0LA 2VWRA 2YTWA 1XZ9A 2R3YA 2M3MA 3QJNA 3OTPA 3O5NA 1X6DA 2AINA 4NMTA 3R68A 1L6OA 2PKUA 2ENOA 4NXPA 2IWOA 4JOKA 1I92A 5ILBA 2EEJA 2DLUA 1W9QA 2QKUA 5FB8C 1V62A 4Q2NA 2O2TA 2IWNA 2VPHA 4L8NA 3KHFA 1KWAA 3CBYA 2FCFA 5G1EA 1LCYA 1MFLA 4IC6A 2VSPA 4YYXA 3PV2A 1T2MA 2LC7A 1BE9A 5HFFA 2PA1A 1QLCA 1WHAA 3ZRTA 2I6VA 2DB5A 2ZPMA 1ZOKA 1UEQA 1M5ZA 2DC2A 1VJ6A 2PZDA 2Q9VA 4RI0A 1SOTA 2CS5A 1TP3A 4OEOA 5F67A 1UM7A 2ZPLA 3DORA 3ID2A 2K20A 3BPUA 1W9OA 1UF1A 4NXRA 4JJ0A 2OGPA 5HFDA 4EDJA 2EHRA 1NTEA 2DMZA 3ID1A 3KDGA 1U39A 1Z86A 2PNTA 1X9ZA 1R6JA 1SOZA 1KY9A 3VQGA 2MHOA 1ZUBA 3WKLA 3ID3A 2I4SA 2V1WA 4R2ZA 4JOGA 4PQWA 2G2LA 4O06A 2OMJA 3VQFA 4XHVA 4Q2QA 1VCWA 2HE4A 3TSWA 3MH6A 2KBSA 3GDVA 4NMVA 2JXOA 2DAZA 3DJ3A 1WIFA 2JREA 2EGKA 2KOJA 3GCNA 5HFCA 1OBXA 2JOAA 3GCOA 1VA8A 3WKMA 4N6XA 2JSNA 2EGOA 1X45A 3R69A 5E6PB 1VAEA 5DTHA 4KFVA 3SUZA 3NCVA 1W9EA 2E7KA 1RGWA 3K82A 3KDKA 1FC6A 2AWUA 2GZVA 4UU5A 3QIKA 1QAUA 4NMOA 4JOPA 2KOHA 2M0UA 2QG1A 4Q3HA 2QBWA 1GM1A 2JILA 2QKVA 1BFEA 3CBXA 5HETA 1Q3PA 5HF1A 4JOHA 1V6BA 1FC9A 1G9OA 1WG6A 1WI2A 1U3BA 3K1RA 5FHTA 2F0AA 3QGLA 4E34A 2X7ZA 2DJTA 1WF8A 4FLNA 1WFVA 1X5QA 2KAWA 4KFWA 2KQFA 1V5QA 4NNLA 3JXTA 4Z33A 1PDRA 1Y8TA 2DM8A 2H3MA 2DKRA 3AXAA 4NMSA 2EDPA 4GVCA 3PV5A 4JOEA 1FCFA 1Y7NA 3KZDA 2KJPA 3STJA 2M0TA 2Q3GA 1MC7A 2I04A 2OPGA 4JJ3A 5JXBA 3PDZA 3CS0A 2R4HA 2M0ZA 3I18A 2DLSA 1RGRA 1U37A 1Q7XA 1UHPA 1OBYA 2AWXA 2OQSA 3QE1A 4YDPA 2W7RA 1MFGA 2I0IA 3SHUA 2L4TA 2QT5A 2F5YA 3GSLA 1IHJA 4AMHA 4GHNA 2Z17A 1D5GA 5A2PA 5B6LA 2D92A 2JIKA 5GLJA 2LUIA 1FC7A 2AWWA 1OBZA 4OAJA 2IWPA 3FY5A 2KPKA 2KRGA 3PV4A 1X5RA 2PKTA 1Z87A 2JINA 5HFEA 2CSJA 3SOEA 5F3XA 3QDOA 4NMRA 1N7TA 2P3WA 4NMQA 4Z8JA 3GABA 1V5LA 2REYA 3I4WA 1UFXA 1U38A 1WJLA 1UEPA 1K32A 5HEBA 3NGHA 1WI4A 4NXQA 4NNMA 1UJDA 4K6YA 2YUBA 3LNYA 4K75A 3I1EA 4P2AB 4UU6A 5E21A 4OEPA 5B42A 3ID4A 2D8IA 3EGGC 1QAVA 2K1ZA 5HJ1A 3TSVA 3DJ1A 3QJMA 5IL9A 3CYYA 2RCZA 3PDVA 1N7EA 3EGHC 3O46A 5H3JA 1OZIA 3KZEA 3SHWA 2KL1A 2M10A 3LNXA 1B8QA 2H2CA 2FN5A 5E11A 2HE2A 4HOPA 2EGNA 2I1NA 2EDVA 1YBOA 3SFJA 3RLEA 3K50A 3GDSA 4P0CA 1I16A 1QAVB 2PDZA 3NFLA 4NMPA 2UZCA 2VZ5A 2EEHA 4E3BA 2QKTA 5GNDA 5HEYA 2EEGA 1RY4A 2IWQA 1N6DA 1TQ3A 2L4SA 3GGEA 3PS4A 1WH1A 5E1YA 2OSGA 2EV8A 2H2BA 4HOPB 1N6FA 2WL7A 3TSZA 2EXGA 2EAQA 5D13A 4JL7A 4Q6SA 2LA8A 1IU0A 4WYTA 4REYA 3HPKA 2GEFA 3MH4A 2KG2A 1UM1A 2HGAA 1X5NA 1Q3OA 2RRMA 2KOMA 4E35A 2OS6A 5G1DA 4Q2OA 2KV8A 5E22A 1RZXA 2YUYA 1WF7A 3B76A 3CH8A 2KA9A 2BYGA 2KJKA 4JOFA 2KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJA A;  1UEW A;  3GJ9 A;  1WHD A;  4LMM A;  1NF3 C;  4K72 A;  1N7F A;  4JOR A;  3E17 A;  4WYU A;  4G69 A;  2MX6 A;  5HF4 A;  4FGM A;  2KPL A;  1GQ4 A;  3OU0 A;  1UJU A;  1UEZ A;  1UIT A;  1N99 A;  1VB7 A;  4F8K A;  1P1E A;  1TE0 A;  2L97 A;  2Z9I A;  1UJV A;  2VSV A;  3TMH A;  4Q6H A;  2EEI A;  3NFK A;  3RL7 A;  1N6E A;  2YT8 A;  4JOJ A;  2OCS A;  2LC6 A;  4Q2P A;  3QO6 A;  3R0H A;  5HED A;  2OZF A;  3L4F D;  2FNE A;  1KEF A;  2YT7 A;  3HVQ C;  1IU2 A;  5I7Z A;  3HPM A;  2D90 A;  3RL8 A;  2LOB A;  3CBZ A;  2M0V A;  2EJY A;  1X8S A;  2VRF A;  4K78 A;  4H11 A;  4MPA A;  1V1T A;  1TP5 A;  2KYL A;  2CSS A;  2JWE A;  4GVD A;  1P1D A;  2G5M B;  5EYZ A;  4K76 A;  5HDY A;  5HFB A;  3GDU A;  2EDZ A;  2W4F A;  3CC0 A;  2H3L A;  2FE5 A;  1WFG A;  2V90 A;  3MH7 A;  1GQ5 A;  3DIW A;  5EZ0 A;  2I0L A;  2VWR A;  2YTW A;  1XZ9 A;  2R3Y A;  2M3M A;  3QJN A;  3OTP A;  3O5N A;  1X6D A;  2AIN A;  4NMT A;  3R68 A;  1L6O A;  2PKU A;  2ENO A;  4NXP A;  2IWO A;  4JOK A;  1I92 A;  2EEJ A;  2DLU A;  1W9Q A;  2QKU A;  5FB8 C;  1V62 A;  4Q2N A;  2O2T A;  2IWN A;  2VPH A;  4L8N A;  3KHF A;  1KWA A;  3CBY A;  2FCF A;  5G1E A;  1LCY A;  1MFL A;  4IC6 A;  2VSP A;  4YYX A;  3PV2 A;  1T2M A;  2LC7 A;  1BE9 A;  5HFF A;  2PA1 A;  1QLC A;  1WHA A;  3ZRT A;  2I6V A;  2DB5 A;  2ZPM A;  1ZOK A;  1UEQ A;  1M5Z A;  2DC2 A;  1VJ6 A;  2PZD A;  2Q9V A;  4RI0 A;  1SOT A;  2CS5 A;  1TP3 A;  4OEO A;  5F67 A;  1UM7 A;  2ZPL A;  3DOR A;  3ID2 A;  2K20 A;  3BPU A;  1W9O A;  1UF1 A;  4NXR A;  2OGP A;  5HFD A;  4EDJ A;  2EHR A;  1NTE A;  2DMZ A;  3ID1 A;  1U39 A;  1Z86 A;  2PNT A;  1R6J A;  1SOZ A;  1KY9 A;  3VQG A;  2MHO A;  1ZUB A;  3WKL A;  3ID3 A;  2I4S A;  2V1W A;  4R2Z A;  4JOG A;  4PQW A;  2G2L A;  4O06 A;  2OMJ A;  3VQF A;  4XHV A;  4Q2Q A;  1VCW A;  2HE4 A;  3TSW A;  3MH6 A;  2KBS A;  3GDV A;  4NMV A;  2JXO A;  2DAZ A;  3DJ3 A;  1WIF A;  2JRE A;  2EGK A;  2KOJ A;  3GCN A;  5HFC A;  1OBX A;  2JOA A;  3GCO A;  1VA8 A;  3WKM A;  4N6X A;  2EGO A;  1X45 A;  3R69 A;  5E6P B;  1VAE A;  5DTH A;  4KFV A;  3SUZ A;  1W9E A;  2E7K A;  1RGW A;  3K82 A;  1FC6 A;  2AWU A;  2GZV A;  4UU5 A;  3QIK A;  1QAU A;  4NMO A;  4JOP A;  2KOH A;  2M0U A;  2QG1 A;  4Q3H A;  2QBW A;  1GM1 A;  2JIL A;  2QKV A;  1BFE A;  3CBX A;  5HET A;  1Q3P A;  5HF1 A;  4JOH A;  1V6B A;  1FC9 A;  1G9O A;  1WG6 A;  1WI2 A;  1U3B A;  3K1R A;  5FHT A;  2F0A A;  3QGL A;  4E34 A;  2X7Z A;  2DJT A;  1WF8 A;  1WFV A;  1X5Q A;  2KAW A;  4KFW A;  2KQF A;  1V5Q A;  4NNL A;  3JXT A;  4Z33 A;  1PDR A;  1Y8T A;  2DM8 A;  2H3M A;  2DKR A;  3AXA A;  4NMS A;  2EDP A;  4GVC A;  3PV5 A;  4JOE A;  1FCF A;  1Y7N A;  3KZD A;  2KJP A;  3STJ A;  2M0T A;  2Q3G A;  1MC7 A;  2I04 A;  2OPG A;  5JXB A;  3PDZ A;  3CS0 A;  2R4H A;  2M0Z A;  3I18 A;  2DLS A;  1RGR A;  1U37 A;  1Q7X A;  1UHP A;  1OBY A;  2AWX A;  2OQS A;  3QE1 A;  4YDP A;  2W7R A;  1MFG A;  2I0I A;  3SHU A;  2L4T A;  2QT5 A;  2F5Y A;  3GSL A;  1IHJ A;  4AMH A;  4GHN A;  2Z17 A;  1D5G A;  5A2P A;  5B6L A;  2D92 A;  2JIK A;  5GLJ A;  2LUI A;  1FC7 A;  2AWW A;  1OBZ A;  4OAJ A;  2IWP A;  3FY5 A;  2KPK A;  2KRG A;  3PV4 A;  1X5R A;  2PKT A;  1Z87 A;  2JIN A;  5HFE A;  2CSJ A;  3SOE A;  5F3X A;  3QDO A;  4NMR A;  1N7T A;  2P3W A;  4NMQ A;  4Z8J A;  1V5L A;  2REY A;  3I4W A;  1UFX A;  1U38 A;  1WJL A;  1UEP A;  1K32 A;  5HEB A;  3NGH A;  1WI4 A;  4NXQ A;  4NNM A;  1UJD A;  4K6Y A;  2YUB A;  3LNY A;  4K75 A;  3I1E A;  4P2A B;  4UU6 A;  5E21 A;  4OEP A;  3ID4 A;  2D8I A;  3EGG C;  1QAV A;  2K1Z A;  5HJ1 A;  3TSV A;  3DJ1 A;  3QJM A;  3CYY A;  2RCZ A;  3PDV A;  1N7E A;  3EGH C;  3O46 A;  5H3J A;  1OZI A;  3KZE A;  3SHW A;  2KL1 A;  2M10 A;  3LNX A;  1B8Q A;  2H2C A;  2FN5 A;  5E11 A;  2HE2 A;  4HOP A;  2EGN A;  2I1N A;  2EDV A;  1YBO A;  3SFJ A;  3RLE A;  3K50 A;  3GDS A;  4P0C A;  1I16 A;  1QAV B;  2PDZ A;  3NFL A;  4NMP A;  2UZC A;  2VZ5 A;  2EEH A;  4E3B A;  2QKT A;  5GND A;  5HEY A;  2EEG A;  1RY4 A;  2IWQ A;  1N6D A;  1TQ3 A;  2L4S A;  3GGE A;  3PS4 A;  1WH1 A;  5E1Y A;  2OSG A;  2EV8 A;  2H2B A;  4HOP B;  1N6F A;  2WL7 A;  3TSZ A;  2EXG A;  2EAQ A;  5D13 A;  4JL7 A;  4Q6S A;  2LA8 A;  1IU0 A;  4WYT A;  4REY A;  3HPK A;  3MH4 A;  2KG2 A;  1UM1 A;  2HGA A;  1X5N A;  1Q3O A;  2RRM A;  2KOM A;  4E35 A;  2OS6 A;  5G1D A;  4Q2O A;  2KV8 A;  5E22 A;  1RZX A;  2YUY A;  1WF7 A;  3B76 A;  3CH8 A;  2KA9 A;  2BYG A;  2KJK A;  4JOF A;  2KJD A; 
#chains in the Genus database with same CATH topology
 3DJA A;  1UEW A;  3GJ9 A;  1WHD A;  4LMM A;  1NF3 C;  4K72 A;  1N7F A;  4JOR A;  3E17 A;  4WYU A;  4G69 A;  2MX6 A;  5HF4 A;  4FGM A;  2KPL A;  1GQ4 A;  3OU0 A;  1UJU A;  1UEZ A;  1UIT A;  1N99 A;  1VB7 A;  4F8K A;  1P1E A;  1TE0 A;  2L97 A;  2Z9I A;  1UJV A;  2VSV A;  3TMH A;  4Q6H A;  2EEI A;  3NFK A;  3RL7 A;  1N6E A;  2YT8 A;  4JOJ A;  2OCS A;  2LC6 A;  4Q2P A;  3QO6 A;  3R0H A;  5HED A;  2OZF A;  3L4F D;  2FNE A;  1KEF A;  2YT7 A;  3HVQ C;  1IU2 A;  5I7Z A;  3HPM A;  2D90 A;  3RL8 A;  2LOB A;  3CBZ A;  2M0V A;  2EJY A;  1X8S A;  2VRF A;  4K78 A;  4H11 A;  4MPA A;  1V1T A;  1TP5 A;  2KYL A;  2CSS A;  2JWE A;  4GVD A;  1P1D A;  2G5M B;  5EYZ A;  4K76 A;  5HDY A;  5HFB A;  3GDU A;  2EDZ A;  2W4F A;  3CC0 A;  2H3L A;  2FE5 A;  1WFG A;  2V90 A;  3MH7 A;  1GQ5 A;  3DIW A;  5EZ0 A;  2I0L A;  2VWR A;  2YTW A;  1XZ9 A;  2R3Y A;  2M3M A;  3QJN A;  3OTP A;  3O5N A;  1X6D A;  2AIN A;  4NMT A;  3R68 A;  1L6O A;  2PKU A;  2ENO A;  4NXP A;  2IWO A;  4JOK A;  1I92 A;  5ILB A;  2EEJ A;  2DLU A;  1W9Q A;  2QKU A;  5FB8 C;  1V62 A;  4Q2N A;  2O2T A;  2IWN A;  2VPH A;  4L8N A;  3KHF A;  1KWA A;  3CBY A;  2FCF A;  5G1E A;  1LCY A;  1MFL A;  4IC6 A;  2VSP A;  4YYX A;  3PV2 A;  1T2M A;  2LC7 A;  1BE9 A;  5HFF A;  2PA1 A;  1QLC A;  1WHA A;  3ZRT A;  2I6V A;  2DB5 A;  2ZPM A;  1ZOK A;  1UEQ A;  1M5Z A;  2DC2 A;  1VJ6 A;  2PZD A;  2Q9V A;  4RI0 A;  1SOT A;  2CS5 A;  1TP3 A;  4OEO A;  5F67 A;  1UM7 A;  2ZPL A;  3DOR A;  3ID2 A;  2K20 A;  3BPU A;  1W9O A;  1UF1 A;  4NXR A;  4JJ0 A;  2OGP A;  5HFD A;  4EDJ A;  2EHR A;  1NTE A;  2DMZ A;  3ID1 A;  3KDG A;  1U39 A;  1Z86 A;  2PNT A;  1X9Z A;  1R6J A;  1SOZ A;  1KY9 A;  3VQG A;  2MHO A;  1ZUB A;  3WKL A;  3ID3 A;  2I4S A;  2V1W A;  4R2Z A;  4JOG A;  4PQW A;  2G2L A;  4O06 A;  2OMJ A;  3VQF A;  4XHV A;  4Q2Q A;  1VCW A;  2HE4 A;  3TSW A;  3MH6 A;  2KBS A;  3GDV A;  4NMV A;  2JXO A;  2DAZ A;  3DJ3 A;  1WIF A;  2JRE A;  2EGK A;  2KOJ A;  3GCN A;  5HFC A;  1OBX A;  2JOA A;  3GCO A;  1VA8 A;  3WKM A;  4N6X A;  2JSN A;  2EGO A;  1X45 A;  3R69 A;  5E6P B;  1VAE A;  5DTH A;  4KFV A;  3SUZ A;  3NCV A;  1W9E A;  2E7K A;  1RGW A;  3K82 A;  3KDK A;  1FC6 A;  2AWU A;  2GZV A;  4UU5 A;  3QIK A;  1QAU A;  4NMO A;  4JOP A;  2KOH A;  2M0U A;  2QG1 A;  4Q3H A;  2QBW A;  1GM1 A;  2JIL A;  2QKV A;  1BFE A;  3CBX A;  5HET A;  1Q3P A;  5HF1 A;  4JOH A;  1V6B A;  1FC9 A;  1G9O A;  1WG6 A;  1WI2 A;  1U3B A;  3K1R A;  5FHT A;  2F0A A;  3QGL A;  4E34 A;  2X7Z A;  2DJT A;  1WF8 A;  4FLN A;  1WFV A;  1X5Q A;  2KAW A;  4KFW A;  2KQF A;  1V5Q A;  4NNL A;  3JXT A;  4Z33 A;  1PDR A;  1Y8T A;  2DM8 A;  2H3M A;  2DKR A;  3AXA A;  4NMS A;  2EDP A;  4GVC A;  3PV5 A;  4JOE A;  1FCF A;  1Y7N A;  3KZD A;  2KJP A;  3STJ A;  2M0T A;  2Q3G A;  1MC7 A;  2I04 A;  2OPG A;  4JJ3 A;  5JXB A;  3PDZ A;  3CS0 A;  2R4H A;  2M0Z A;  3I18 A;  2DLS A;  1RGR A;  1U37 A;  1Q7X A;  1UHP A;  1OBY A;  2AWX A;  2OQS A;  3QE1 A;  4YDP A;  2W7R A;  1MFG A;  2I0I A;  3SHU A;  2L4T A;  2QT5 A;  2F5Y A;  3GSL A;  1IHJ A;  4AMH A;  4GHN A;  2Z17 A;  1D5G A;  5A2P A;  5B6L A;  2D92 A;  2JIK A;  5GLJ A;  2LUI A;  1FC7 A;  2AWW A;  1OBZ A;  4OAJ A;  2IWP A;  3FY5 A;  2KPK A;  2KRG A;  3PV4 A;  1X5R A;  2PKT A;  1Z87 A;  2JIN A;  5HFE A;  2CSJ A;  3SOE A;  5F3X A;  3QDO A;  4NMR A;  1N7T A;  2P3W A;  4NMQ A;  4Z8J A;  3GAB A;  1V5L A;  2REY A;  3I4W A;  1UFX A;  1U38 A;  1WJL A;  1UEP A;  1K32 A;  5HEB A;  3NGH A;  1WI4 A;  4NXQ A;  4NNM A;  1UJD A;  4K6Y A;  2YUB A;  3LNY A;  4K75 A;  3I1E A;  4P2A B;  4UU6 A;  5E21 A;  4OEP A;  5B42 A;  3ID4 A;  2D8I A;  3EGG C;  1QAV A;  2K1Z A;  5HJ1 A;  3TSV A;  3DJ1 A;  3QJM A;  5IL9 A;  3CYY A;  2RCZ A;  3PDV A;  1N7E A;  3EGH C;  3O46 A;  5H3J A;  1OZI A;  3KZE A;  3SHW A;  2KL1 A;  2M10 A;  3LNX A;  1B8Q A;  2H2C A;  2FN5 A;  5E11 A;  2HE2 A;  4HOP A;  2EGN A;  2I1N A;  2EDV A;  1YBO A;  3SFJ A;  3RLE A;  3K50 A;  3GDS A;  4P0C A;  1I16 A;  1QAV B;  2PDZ A;  3NFL A;  4NMP A;  2UZC A;  2VZ5 A;  2EEH A;  4E3B A;  2QKT A;  5GND A;  5HEY A;  2EEG A;  1RY4 A;  2IWQ A;  1N6D A;  1TQ3 A;  2L4S A;  3GGE A;  3PS4 A;  1WH1 A;  5E1Y A;  2OSG A;  2EV8 A;  2H2B A;  4HOP B;  1N6F A;  2WL7 A;  3TSZ A;  2EXG A;  2EAQ A;  5D13 A;  4JL7 A;  4Q6S A;  2LA8 A;  1IU0 A;  4WYT A;  4REY A;  3HPK A;  2GEF A;  3MH4 A;  2KG2 A;  1UM1 A;  2HGA A;  1X5N A;  1Q3O A;  2RRM A;  2KOM A;  4E35 A;  2OS6 A;  5G1D A;  4Q2O A;  2KV8 A;  5E22 A;  1RZX A;  2YUY A;  1WF7 A;  3B76 A;  3CH8 A;  2KA9 A;  2BYG A;  2KJK A;  4JOF A;  2KJD A; 
#chains in the Genus database with same CATH homology
 3DJA A;  1UEW A;  3GJ9 A;  1WHD A;  4LMM A;  1NF3 C;  4K72 A;  1N7F A;  4JOR A;  3E17 A;  4WYU A;  4G69 A;  2MX6 A;  5HF4 A;  4FGM A;  2KPL A;  1GQ4 A;  3OU0 A;  1UJU A;  1UEZ A;  1UIT A;  1N99 A;  1VB7 A;  4F8K A;  1P1E A;  1TE0 A;  2L97 A;  2Z9I A;  1UJV A;  2VSV A;  3TMH A;  4Q6H A;  2EEI A;  3NFK A;  3RL7 A;  1N6E A;  2YT8 A;  4JOJ A;  2OCS A;  2LC6 A;  4Q2P A;  3QO6 A;  3R0H A;  5HED A;  2OZF A;  3L4F D;  2FNE A;  1KEF A;  2YT7 A;  3HVQ C;  1IU2 A;  5I7Z A;  3HPM A;  2D90 A;  3RL8 A;  2LOB A;  3CBZ A;  2M0V A;  2EJY A;  1X8S A;  2VRF A;  4K78 A;  4H11 A;  4MPA A;  1V1T A;  1TP5 A;  2KYL A;  2CSS A;  2JWE A;  4GVD A;  1P1D A;  2G5M B;  5EYZ A;  4K76 A;  5HDY A;  5HFB A;  3GDU A;  2EDZ A;  2W4F A;  3CC0 A;  2H3L A;  2FE5 A;  1WFG A;  2V90 A;  3MH7 A;  1GQ5 A;  3DIW A;  5EZ0 A;  2I0L A;  2VWR A;  2YTW A;  1XZ9 A;  2R3Y A;  2M3M A;  3QJN A;  3OTP A;  3O5N A;  1X6D A;  2AIN A;  4NMT A;  3R68 A;  1L6O A;  2PKU A;  2ENO A;  4NXP A;  2IWO A;  4JOK A;  1I92 A;  5ILB A;  2EEJ A;  2DLU A;  1W9Q A;  2QKU A;  5FB8 C;  1V62 A;  4Q2N A;  2O2T A;  2IWN A;  2VPH A;  4L8N A;  3KHF A;  1KWA A;  3CBY A;  2FCF A;  5G1E A;  1LCY A;  1MFL A;  4IC6 A;  2VSP A;  4YYX A;  3PV2 A;  1T2M A;  2LC7 A;  1BE9 A;  5HFF A;  2PA1 A;  1QLC A;  1WHA A;  3ZRT A;  2I6V A;  2DB5 A;  2ZPM A;  1ZOK A;  1UEQ A;  1M5Z A;  2DC2 A;  1VJ6 A;  2PZD A;  2Q9V A;  4RI0 A;  1SOT A;  2CS5 A;  1TP3 A;  4OEO A;  5F67 A;  1UM7 A;  2ZPL A;  3DOR A;  3ID2 A;  2K20 A;  3BPU A;  1W9O A;  1UF1 A;  4NXR A;  4JJ0 A;  2OGP A;  5HFD A;  4EDJ A;  2EHR A;  1NTE A;  2DMZ A;  3ID1 A;  3KDG A;  1U39 A;  1Z86 A;  2PNT A;  1X9Z A;  1R6J A;  1SOZ A;  1KY9 A;  3VQG A;  2MHO A;  1ZUB A;  3WKL A;  3ID3 A;  2I4S A;  2V1W A;  4R2Z A;  4JOG A;  4PQW A;  2G2L A;  4O06 A;  2OMJ A;  3VQF A;  4XHV A;  4Q2Q A;  1VCW A;  2HE4 A;  3TSW A;  3MH6 A;  2KBS A;  3GDV A;  4NMV A;  2JXO A;  2DAZ A;  3DJ3 A;  1WIF A;  2JRE A;  2EGK A;  2KOJ A;  3GCN A;  5HFC A;  1OBX A;  2JOA A;  3GCO A;  1VA8 A;  3WKM A;  4N6X A;  2JSN A;  2EGO A;  1X45 A;  3R69 A;  5E6P B;  1VAE A;  5DTH A;  4KFV A;  3SUZ A;  3NCV A;  1W9E A;  2E7K A;  1RGW A;  3K82 A;  3KDK A;  1FC6 A;  2AWU A;  2GZV A;  4UU5 A;  3QIK A;  1QAU A;  4NMO A;  4JOP A;  2KOH A;  2M0U A;  2QG1 A;  4Q3H A;  2QBW A;  1GM1 A;  2JIL A;  2QKV A;  1BFE A;  3CBX A;  5HET A;  1Q3P A;  5HF1 A;  4JOH A;  1V6B A;  1FC9 A;  1G9O A;  1WG6 A;  1WI2 A;  1U3B A;  3K1R A;  5FHT A;  2F0A A;  3QGL A;  4E34 A;  2X7Z A;  2DJT A;  1WF8 A;  4FLN A;  1WFV A;  1X5Q A;  2KAW A;  4KFW A;  2KQF A;  1V5Q A;  4NNL A;  3JXT A;  4Z33 A;  1PDR A;  1Y8T A;  2DM8 A;  2H3M A;  2DKR A;  3AXA A;  4NMS A;  2EDP A;  4GVC A;  3PV5 A;  4JOE A;  1FCF A;  1Y7N A;  3KZD A;  2KJP A;  3STJ A;  2M0T A;  2Q3G A;  1MC7 A;  2I04 A;  2OPG A;  4JJ3 A;  5JXB A;  3PDZ A;  3CS0 A;  2R4H A;  2M0Z A;  3I18 A;  2DLS A;  1RGR A;  1U37 A;  1Q7X A;  1UHP A;  1OBY A;  2AWX A;  2OQS A;  3QE1 A;  4YDP A;  2W7R A;  1MFG A;  2I0I A;  3SHU A;  2L4T A;  2QT5 A;  2F5Y A;  3GSL A;  1IHJ A;  4AMH A;  4GHN A;  2Z17 A;  1D5G A;  5A2P A;  5B6L A;  2D92 A;  2JIK A;  5GLJ A;  2LUI A;  1FC7 A;  2AWW A;  1OBZ A;  4OAJ A;  2IWP A;  3FY5 A;  2KPK A;  2KRG A;  3PV4 A;  1X5R A;  2PKT A;  1Z87 A;  2JIN A;  5HFE A;  2CSJ A;  3SOE A;  5F3X A;  3QDO A;  4NMR A;  1N7T A;  2P3W A;  4NMQ A;  4Z8J A;  3GAB A;  1V5L A;  2REY A;  3I4W A;  1UFX A;  1U38 A;  1WJL A;  1UEP A;  1K32 A;  5HEB A;  3NGH A;  1WI4 A;  4NXQ A;  4NNM A;  1UJD A;  4K6Y A;  2YUB A;  3LNY A;  4K75 A;  3I1E A;  4P2A B;  4UU6 A;  5E21 A;  4OEP A;  5B42 A;  3ID4 A;  2D8I A;  3EGG C;  1QAV A;  2K1Z A;  5HJ1 A;  3TSV A;  3DJ1 A;  3QJM A;  5IL9 A;  3CYY A;  2RCZ A;  3PDV A;  1N7E A;  3EGH C;  3O46 A;  5H3J A;  1OZI A;  3KZE A;  3SHW A;  2KL1 A;  2M10 A;  3LNX A;  1B8Q A;  2H2C A;  2FN5 A;  5E11 A;  2HE2 A;  4HOP A;  2EGN A;  2I1N A;  2EDV A;  1YBO A;  3SFJ A;  3RLE A;  3K50 A;  3GDS A;  4P0C A;  1I16 A;  1QAV B;  2PDZ A;  3NFL A;  4NMP A;  2UZC A;  2VZ5 A;  2EEH A;  4E3B A;  2QKT A;  5GND A;  5HEY A;  2EEG A;  1RY4 A;  2IWQ A;  1N6D A;  1TQ3 A;  2L4S A;  3GGE A;  3PS4 A;  1WH1 A;  5E1Y A;  2OSG A;  2EV8 A;  2H2B A;  4HOP B;  1N6F A;  2WL7 A;  3TSZ A;  2EXG A;  2EAQ A;  5D13 A;  4JL7 A;  4Q6S A;  2LA8 A;  1IU0 A;  4WYT A;  4REY A;  3HPK A;  2GEF A;  3MH4 A;  2KG2 A;  1UM1 A;  2HGA A;  1X5N A;  1Q3O A;  2RRM A;  2KOM A;  4E35 A;  2OS6 A;  5G1D A;  4Q2O A;  2KV8 A;  5E22 A;  1RZX A;  2YUY A;  1WF7 A;  3B76 A;  3CH8 A;  2KA9 A;  2BYG A;  2KJK A;  4JOF A;  2KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...