3LNYA

Second pdz domain from human ptp1e in complex with ra-gef2 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 13
publication title Crystallographic and nuclear magnetic resonance evaluation of the impact of peptide binding to the second PDZ domain of protein tyrosine phosphatase 1E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 19
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3lnyA00
2FE5A 5HETA 2KYLA 1WI4A 1QAVA 1WF7A 3QIKA 3TSWA 1R6JA 2KQFA 4N6XA 3DJ3A 3GCOA 3MH4A 4Q3HA 2KBSA 3CBXA 4L8NA 1V6BA 3ZRTA 3R68A 1X5QA 2WL7A 4Z33A 2HE4A 1V1TA 1IU2A 1NTEA 1N6FA 3STJA 2KPKA 3PS4A 5EYZA 2CSJA 2KJDA 1G9OA 1N6DA 2EEIA 1Z86A 4JORA 1WFVA 3GGEA 1OBYA 3K82A 3DORA 2DAZA 3DJAA 2RRMA 2EGKA 1KWAA 1UJUA 1V62A 3CYYA 1NF3C 2FCFA 2VWRA 4NMPA 1VAEA 2D92A 1VB7A 4P0CA 4Z8JA 4JOKA 3SUZA 5A2PA 1UEWA 2AWUA 2Q3GA 2HE2A 3RL7A 2I0IA 2PKUA 4UU6A 5F67A 2W7RA 4NMVA 2JOAA 3HVQC 1TE0A 3CBZA 5EZ0A 2IWPA 2V1WA 2VSPA 1UFXA 2JIKA 5HJ1A 1U38A 3WKMA 1Q7XA 1QAUA 4IC6A 3CC0A 3NFLA 3HPKA 2DJTA 2PA1A 2H2BA 5HFDA 1WFGA 2R3YA 4K6YA 5HFBA 1Q3PA 2DM8A 1W9OA 4NMSA 2I6VA 1W9EA 1BFEA 2CS5A 4KFWA 2HGAA 2W4FA 1XZ9A 3GCNA 2YT7A 5HEBA 1MFLA 2ENOA 2L4TA 2M0UA 4MPAA 1WG6A 3QJNA 4E35A 1SOZA 4JOFA 2ZPLA 2OS6A 1Q3OA 2REYA 5H3JA 4O06A 2M3MA 2EDPA 1QLCA 4RI0A 2PDZA 4REYA 5F3XA 1UEQA 2AWWA 2OQSA 3KZDA 2QKUA 4HOPA 1UITA 2Z17A 1UM1A 3SHUA 4KFVA 1X5RA 2MHOA 4Q2PA 3ID1A 2M0VA 4NMOA 4Q6SA 2OPGA 4JOEA 3ID3A 2PNTA 2RCZA 2F5YA 4NMTA 1RGWA 1GM1A 4E34A 5HEYA 3OU0A 2EAQA 2X7ZA 2YUYA 5G1EA 2I04A 2DKRA 1VJ6A 2EXGA 3NFKA 3MH7A 2K20A 1N7EA 3QGLA 3WKLA 3CBYA 2IWQA 2K1ZA 2BYGA 2EGNA 3PV5A 1P1EA 2PZDA 1KY9A 1UF1A 4OAJA 1WF8A 2L4SA 2QG1A 1B8QA 1M5ZA 4PQWA 2M0TA 5D13A 2FN5A 1BE9A 3OTPA 1LCYA 1GQ5A 3EGGC 3VQFA 4K72A 4G69A 2D90A 1RZXA 4WYTA 4NNLA 2LC7A 3NGHA 5HFFA 4JOJA 2EEHA 4UU5A 4Q2OA 2H2CA 1N6EA 1T2MA 5GLJA 1VA8A 1Y7NA 2OSGA 2QBWA 1X5NA 2QKTA 2QT5A 3I4WA 3R69A 1UM7A 2KOHA 4JL7A 2JWEA 3FY5A 4NXRA 4EDJA 2VZ5A 2VSVA 4YDPA 3O5NA 5FHTA 4FGMA 1OBZA 1N99A 1SOTA 2KL1A 2OZFA 2KRGA 3GJ9A 1WHDA 4JOPA 2G5MB 2YTWA 3B76A 3PDVA 5HDYA 2I0LA 4OEPA 5B6LA 3E17A 2OMJA 2L97A 5HFEA 3O46A 4NXPA 1OZIA 3TMHA 3GDUA 4K78A 3K50A 1X8SA 2EEJA 1WJLA 2JREA 2GZVA 1L6OA 3I18A 1UEPA 3BPUA 2YUBA 2KJKA 2KPLA 3KZEA 4XHVA 1N7TA 1QAVB 1W9QA 4LMMA 1V5QA 5G1DA 3EGHC 1X45A 3R0HA 1IU0A 1X6DA 2AINA 4E3BA 2IWOA 5E11A 2EV8A 2V90A 2QKVA 3AXAA 2D8IA 5HEDA 3DJ1A 3SOEA 5HF4A 3TSZA 4P2AB 3HPMA 2I4SA 3PDZA 2DC2A 1GQ4A 5GNDA 2M10A 4R2ZA 1D5GA 3QO6A 3SHWA 1IHJA 2CSSA 2JINA 1Y8TA 5I7ZA 2OGPA 3ID4A 5E22A 4OEOA 1MFGA 1UJDA 3DIWA 4JOHA 1TQ3A 2EHRA 1WI2A 2EGOA 4JOGA 1YBOA 5JXBA 2F0AA 4NNMA 5E21A 2DLUA 3GDSA 2IWNA 4K76A 1UHPA 2EEGA 3ID2A 1FC7A 2EDVA 4AMHA 2KJPA 3RLEA 4NMQA 1RY4A 3JXTA 3QJMA 1WH1A 2UZCA 3I1EA 5E6PB 1FC6A 2DLSA 3TSVA 2ZPMA 2OCSA 1TP5A 1PDRA 1WHAA 2KA9A 2EJYA 4YYXA 2KAWA 4WYUA 3MH6A 3PV2A 1V5LA 2FNEA 2O2TA 1P1DA 1TP3A 2E7KA 2M0ZA 3SFJA 1MC7A 1ZUBA 2MX6A 2KV8A 1UJVA 2Z9IA 4NXQA 3CH8A 3VQGA 2H3MA 3KHFA 1Z87A 2JXOA 1U37A 3QE1A 2H3LA 5DTHA 1U39A 5FB8C 5HF1A 3K1RA 2YT8A 1WIFA 2AWXA 2JILA 4GVCA 2LUIA 4Q6HA 2KOJA 2VRFA 2KG2A 2LOBA 2PKTA 4NMRA 4F8KA 3L4FD 2R4HA 1RGRA 1VCWA 2DMZA 3PV4A 1FC9A 1UEZA 1ZOKA 2Q9VA 1K32A 1U3BA 4Q2NA 1I92A 3RL8A 1N7FA 2G2LA 4GHNA 4GVDA 4HOPB 4K75A 1KEFA 3QDOA 2VPHA 2DB5A 5E1YA 2LA8A 2P3WA 4Q2QA 2EDZA 4H11A 2LC6A 2I1NA 1OBXA 3GDVA 2KOMA 3GSLA 1FCFA 3CS0A 3LNXA 3LNYA 5HFCA 1I16A
chains in the Genus database with same CATH superfamily
2FE5A 5HETA 2KYLA 1WI4A 1QAVA 1WF7A 3QIKA 3TSWA 1R6JA 2KQFA 4N6XA 3DJ3A 3GCOA 3MH4A 4Q3HA 2KBSA 3CBXA 4L8NA 1V6BA 3ZRTA 3R68A 1X5QA 2WL7A 4Z33A 2HE4A 1V1TA 1IU2A 1NTEA 1N6FA 3STJA 2KPKA 3PS4A 5EYZA 2CSJA 2KJDA 1G9OA 1N6DA 2EEIA 1Z86A 5IL9A 4JORA 1WFVA 3GGEA 1OBYA 3K82A 3DORA 3GABA 2DAZA 3DJAA 2RRMA 2EGKA 1KWAA 1UJUA 1V62A 3CYYA 1NF3C 2FCFA 2VWRA 4NMPA 1VAEA 2D92A 1VB7A 4P0CA 4Z8JA 4JOKA 5ILBA 3SUZA 5A2PA 1UEWA 2AWUA 2Q3GA 2HE2A 3RL7A 2I0IA 2PKUA 4UU6A 5F67A 2W7RA 4NMVA 2JOAA 3HVQC 1TE0A 3CBZA 5EZ0A 2IWPA 2V1WA 2VSPA 1UFXA 2JIKA 5HJ1A 1U38A 3WKMA 1Q7XA 1QAUA 4IC6A 3CC0A 3NFLA 3HPKA 2DJTA 2PA1A 2H2BA 5HFDA 1WFGA 2R3YA 4K6YA 5HFBA 1Q3PA 2DM8A 1W9OA 4NMSA 2I6VA 1W9EA 1BFEA 2CS5A 4KFWA 2HGAA 2W4FA 1XZ9A 3GCNA 2YT7A 5HEBA 1MFLA 2ENOA 2L4TA 5B42A 2M0UA 4MPAA 1WG6A 3QJNA 4E35A 1SOZA 4JOFA 2ZPLA 2OS6A 1Q3OA 2REYA 5H3JA 4O06A 2M3MA 2EDPA 1QLCA 4RI0A 2PDZA 4REYA 5F3XA 1UEQA 2AWWA 2OQSA 3KZDA 2QKUA 4HOPA 1UITA 3KDGA 2Z17A 1UM1A 3SHUA 4KFVA 1X5RA 2MHOA 4Q2PA 3ID1A 2M0VA 4NMOA 4Q6SA 2OPGA 4JOEA 3ID3A 2PNTA 2RCZA 2F5YA 4NMTA 1RGWA 1GM1A 4E34A 5HEYA 3OU0A 2EAQA 2X7ZA 2YUYA 5G1EA 2I04A 2DKRA 1VJ6A 2EXGA 3NFKA 3MH7A 2K20A 1N7EA 2GEFA 3QGLA 3WKLA 3CBYA 2IWQA 2K1ZA 2BYGA 2EGNA 3PV5A 1P1EA 2PZDA 1KY9A 1UF1A 4OAJA 1WF8A 2L4SA 2QG1A 1B8QA 1M5ZA 4PQWA 2M0TA 5D13A 2FN5A 1BE9A 3OTPA 1LCYA 1GQ5A 3EGGC 3VQFA 4K72A 4G69A 2D90A 3KDKA 1RZXA 4WYTA 4NNLA 2LC7A 3NGHA 5HFFA 4JOJA 2EEHA 4UU5A 4Q2OA 2H2CA 1N6EA 1T2MA 5GLJA 1VA8A 1Y7NA 2OSGA 2QBWA 1X5NA 2QKTA 2QT5A 3I4WA 3R69A 1UM7A 2KOHA 4JL7A 2JWEA 3FY5A 4NXRA 4EDJA 2VZ5A 2VSVA 4YDPA 3O5NA 5FHTA 4FGMA 1OBZA 1N99A 1SOTA 2KL1A 2OZFA 2KRGA 3GJ9A 1WHDA 4JOPA 2G5MB 2YTWA 3B76A 3PDVA 5HDYA 2I0LA 4JJ0A 4OEPA 5B6LA 3E17A 1X9ZA 2L97A 2OMJA 5HFEA 3O46A 4NXPA 4JJ3A 1OZIA 3TMHA 3GDUA 4K78A 3K50A 1X8SA 2EEJA 1WJLA 2JREA 2GZVA 1L6OA 3I18A 1UEPA 3BPUA 2YUBA 2KJKA 2KPLA 3KZEA 4XHVA 1N7TA 1QAVB 1W9QA 4LMMA 1V5QA 5G1DA 3EGHC 1X45A 3R0HA 1IU0A 1X6DA 2AINA 4E3BA 2IWOA 5E11A 2EV8A 2V90A 2QKVA 3AXAA 2D8IA 5HEDA 3DJ1A 3SOEA 5HF4A 3TSZA 4P2AB 3HPMA 2I4SA 3PDZA 2DC2A 1GQ4A 5GNDA 2M10A 4R2ZA 1D5GA 3QO6A 3SHWA 1IHJA 2CSSA 2JINA 1Y8TA 5I7ZA 2OGPA 3ID4A 5E22A 4OEOA 1MFGA 1UJDA 3DIWA 4JOHA 1TQ3A 2EHRA 1WI2A 2EGOA 4JOGA 1YBOA 5JXBA 2F0AA 4NNMA 5E21A 2DLUA 3GDSA 2IWNA 4K76A 1UHPA 2EEGA 2JSNA 3ID2A 1FC7A 2EDVA 4AMHA 2KJPA 3RLEA 4NMQA 1RY4A 3JXTA 3QJMA 1WH1A 2UZCA 3I1EA 5E6PB 1FC6A 2DLSA 3TSVA 2ZPMA 2OCSA 1TP5A 1PDRA 1WHAA 2KA9A 2EJYA 4YYXA 2KAWA 4WYUA 3MH6A 3PV2A 1V5LA 2FNEA 2O2TA 1P1DA 1TP3A 2E7KA 2M0ZA 3SFJA 1MC7A 1ZUBA 2MX6A 2KV8A 1UJVA 2Z9IA 4NXQA 3CH8A 3VQGA 2H3MA 3KHFA 1Z87A 2JXOA 1U37A 3QE1A 2H3LA 5DTHA 1U39A 5FB8C 5HF1A 3K1RA 2YT8A 1WIFA 2AWXA 2JILA 4GVCA 2LUIA 4Q6HA 2KOJA 2VRFA 2KG2A 2LOBA 2PKTA 4NMRA 4F8KA 3L4FD 2R4HA 1RGRA 1VCWA 2DMZA 3PV4A 1FC9A 1UEZA 1ZOKA 2Q9VA 1K32A 3NCVA 1U3BA 4Q2NA 1I92A 3RL8A 1N7FA 2G2LA 4GHNA 4GVDA 4HOPB 4K75A 1KEFA 4FLNA 3QDOA 2VPHA 2DB5A 5E1YA 2LA8A 2P3WA 4Q2QA 2EDZA 4H11A 2LC6A 2I1NA 1OBXA 3GDVA 2KOMA 3GSLA 1FCFA 3CS0A 3LNXA 3LNYA 5HFCA 1I16A
chains in the Genus database with same CATH topology
2FE5A 5HETA 2KYLA 1WI4A 1QAVA 1WF7A 3QIKA 3TSWA 1R6JA 2KQFA 4N6XA 3DJ3A 3GCOA 3MH4A 4Q3HA 2KBSA 3CBXA 4L8NA 1V6BA 3ZRTA 3R68A 1X5QA 2WL7A 4Z33A 2HE4A 1V1TA 1IU2A 1NTEA 1N6FA 3STJA 2KPKA 3PS4A 5EYZA 2CSJA 2KJDA 1G9OA 1N6DA 2EEIA 1Z86A 5IL9A 4JORA 1WFVA 3GGEA 1OBYA 3K82A 3DORA 3GABA 2DAZA 3DJAA 2RRMA 2EGKA 1KWAA 1UJUA 1V62A 3CYYA 1NF3C 2FCFA 2VWRA 4NMPA 1VAEA 2D92A 1VB7A 4P0CA 4Z8JA 4JOKA 5ILBA 3SUZA 5A2PA 1UEWA 2AWUA 2Q3GA 2HE2A 3RL7A 2I0IA 2PKUA 4UU6A 5F67A 2W7RA 4NMVA 2JOAA 3HVQC 1TE0A 3CBZA 5EZ0A 2IWPA 2V1WA 2VSPA 1UFXA 2JIKA 5HJ1A 1U38A 3WKMA 1Q7XA 1QAUA 4IC6A 3CC0A 3NFLA 3HPKA 2DJTA 2PA1A 2H2BA 5HFDA 1WFGA 2R3YA 4K6YA 5HFBA 1Q3PA 2DM8A 1W9OA 4NMSA 2I6VA 1W9EA 1BFEA 2CS5A 4KFWA 2HGAA 2W4FA 1XZ9A 3GCNA 2YT7A 5HEBA 1MFLA 2ENOA 2L4TA 5B42A 2M0UA 4MPAA 1WG6A 3QJNA 4E35A 1SOZA 4JOFA 2ZPLA 2OS6A 1Q3OA 2REYA 5H3JA 4O06A 2M3MA 2EDPA 1QLCA 4RI0A 2PDZA 4REYA 5F3XA 1UEQA 2AWWA 2OQSA 3KZDA 2QKUA 4HOPA 1UITA 3KDGA 2Z17A 1UM1A 3SHUA 4KFVA 1X5RA 2MHOA 4Q2PA 3ID1A 2M0VA 4NMOA 4Q6SA 2OPGA 4JOEA 3ID3A 2PNTA 2RCZA 2F5YA 4NMTA 1RGWA 1GM1A 4E34A 5HEYA 3OU0A 2EAQA 2X7ZA 2YUYA 5G1EA 2I04A 2DKRA 1VJ6A 2EXGA 3NFKA 3MH7A 2K20A 1N7EA 2GEFA 3QGLA 3WKLA 3CBYA 2IWQA 2K1ZA 2BYGA 2EGNA 3PV5A 1P1EA 2PZDA 1KY9A 1UF1A 4OAJA 1WF8A 2L4SA 2QG1A 1B8QA 1M5ZA 4PQWA 2M0TA 5D13A 2FN5A 1BE9A 3OTPA 1LCYA 1GQ5A 3EGGC 3VQFA 4K72A 4G69A 2D90A 3KDKA 1RZXA 4WYTA 4NNLA 2LC7A 3NGHA 5HFFA 4JOJA 2EEHA 4UU5A 4Q2OA 2H2CA 1N6EA 1T2MA 5GLJA 1VA8A 1Y7NA 2OSGA 2QBWA 1X5NA 2QKTA 2QT5A 3I4WA 3R69A 1UM7A 2KOHA 4JL7A 2JWEA 3FY5A 4NXRA 4EDJA 2VZ5A 2VSVA 4YDPA 3O5NA 5FHTA 4FGMA 1OBZA 1N99A 1SOTA 2KL1A 2OZFA 2KRGA 3GJ9A 1WHDA 4JOPA 2G5MB 2YTWA 3B76A 3PDVA 5HDYA 2I0LA 4JJ0A 4OEPA 5B6LA 3E17A 1X9ZA 2L97A 2OMJA 5HFEA 3O46A 4NXPA 4JJ3A 1OZIA 3TMHA 3GDUA 4K78A 3K50A 1X8SA 2EEJA 1WJLA 2JREA 2GZVA 1L6OA 3I18A 1UEPA 3BPUA 2YUBA 2KJKA 2KPLA 3KZEA 4XHVA 1N7TA 1QAVB 1W9QA 4LMMA 1V5QA 5G1DA 3EGHC 1X45A 3R0HA 1IU0A 1X6DA 2AINA 4E3BA 2IWOA 5E11A 2EV8A 2V90A 2QKVA 3AXAA 2D8IA 5HEDA 3DJ1A 3SOEA 5HF4A 3TSZA 4P2AB 3HPMA 2I4SA 3PDZA 2DC2A 1GQ4A 5GNDA 2M10A 4R2ZA 1D5GA 3QO6A 3SHWA 1IHJA 2CSSA 2JINA 1Y8TA 5I7ZA 2OGPA 3ID4A 5E22A 4OEOA 1MFGA 1UJDA 3DIWA 4JOHA 1TQ3A 2EHRA 1WI2A 2EGOA 4JOGA 1YBOA 5JXBA 2F0AA 4NNMA 5E21A 2DLUA 3GDSA 2IWNA 4K76A 1UHPA 2EEGA 2JSNA 3ID2A 1FC7A 2EDVA 4AMHA 2KJPA 3RLEA 4NMQA 1RY4A 3JXTA 3QJMA 1WH1A 2UZCA 3I1EA 5E6PB 1FC6A 2DLSA 3TSVA 2ZPMA 2OCSA 1TP5A 1PDRA 1WHAA 2KA9A 2EJYA 4YYXA 2KAWA 4WYUA 3MH6A 3PV2A 1V5LA 2FNEA 2O2TA 1P1DA 1TP3A 2E7KA 2M0ZA 3SFJA 1MC7A 1ZUBA 2MX6A 2KV8A 1UJVA 2Z9IA 4NXQA 3CH8A 3VQGA 2H3MA 3KHFA 1Z87A 2JXOA 1U37A 3QE1A 2H3LA 5DTHA 1U39A 5FB8C 5HF1A 3K1RA 2YT8A 1WIFA 2AWXA 2JILA 4GVCA 2LUIA 4Q6HA 2KOJA 2VRFA 2KG2A 2LOBA 2PKTA 4NMRA 4F8KA 3L4FD 2R4HA 1RGRA 1VCWA 2DMZA 3PV4A 1FC9A 1UEZA 1ZOKA 2Q9VA 1K32A 3NCVA 1U3BA 4Q2NA 1I92A 3RL8A 1N7FA 2G2LA 4GHNA 4GVDA 4HOPB 4K75A 1KEFA 4FLNA 3QDOA 2VPHA 2DB5A 5E1YA 2LA8A 2P3WA 4Q2QA 2EDZA 4H11A 2LC6A 2I1NA 1OBXA 3GDVA 2KOMA 3GSLA 1FCFA 3CS0A 3LNXA 3LNYA 5HFCA 1I16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE5 A;  5HET A;  2KYL A;  1WI4 A;  1QAV A;  1WF7 A;  3QIK A;  3TSW A;  1R6J A;  2KQF A;  4N6X A;  3DJ3 A;  3GCO A;  3MH4 A;  4Q3H A;  2KBS A;  3CBX A;  4L8N A;  1V6B A;  3ZRT A;  3R68 A;  1X5Q A;  2WL7 A;  4Z33 A;  2HE4 A;  1V1T A;  1IU2 A;  1NTE A;  1N6F A;  3STJ A;  2KPK A;  3PS4 A;  5EYZ A;  2CSJ A;  2KJD A;  1G9O A;  1N6D A;  2EEI A;  1Z86 A;  4JOR A;  1WFV A;  3GGE A;  1OBY A;  3K82 A;  3DOR A;  2DAZ A;  3DJA A;  2RRM A;  2EGK A;  1KWA A;  1UJU A;  1V62 A;  3CYY A;  1NF3 C;  2FCF A;  2VWR A;  4NMP A;  1VAE A;  2D92 A;  1VB7 A;  4P0C A;  4Z8J A;  4JOK A;  3SUZ A;  5A2P A;  1UEW A;  2AWU A;  2Q3G A;  2HE2 A;  3RL7 A;  2I0I A;  2PKU A;  4UU6 A;  5F67 A;  2W7R A;  4NMV A;  2JOA A;  3HVQ C;  1TE0 A;  3CBZ A;  5EZ0 A;  2IWP A;  2V1W A;  2VSP A;  1UFX A;  2JIK A;  5HJ1 A;  1U38 A;  3WKM A;  1Q7X A;  1QAU A;  4IC6 A;  3CC0 A;  3NFL A;  3HPK A;  2DJT A;  2PA1 A;  2H2B A;  5HFD A;  1WFG A;  2R3Y A;  4K6Y A;  5HFB A;  1Q3P A;  2DM8 A;  1W9O A;  4NMS A;  2I6V A;  1W9E A;  1BFE A;  2CS5 A;  4KFW A;  2HGA A;  2W4F A;  1XZ9 A;  3GCN A;  2YT7 A;  5HEB A;  1MFL A;  2ENO A;  2L4T A;  2M0U A;  4MPA A;  1WG6 A;  3QJN A;  4E35 A;  1SOZ A;  4JOF A;  2ZPL A;  2OS6 A;  1Q3O A;  2REY A;  5H3J A;  4O06 A;  2M3M A;  2EDP A;  1QLC A;  4RI0 A;  2PDZ A;  4REY A;  5F3X A;  1UEQ A;  2AWW A;  2OQS A;  3KZD A;  2QKU A;  4HOP A;  1UIT A;  2Z17 A;  1UM1 A;  3SHU A;  4KFV A;  1X5R A;  2MHO A;  4Q2P A;  3ID1 A;  2M0V A;  4NMO A;  4Q6S A;  2OPG A;  4JOE A;  3ID3 A;  2PNT A;  2RCZ A;  2F5Y A;  4NMT A;  1RGW A;  1GM1 A;  4E34 A;  5HEY A;  3OU0 A;  2EAQ A;  2X7Z A;  2YUY A;  5G1E A;  2I04 A;  2DKR A;  1VJ6 A;  2EXG A;  3NFK A;  3MH7 A;  2K20 A;  1N7E A;  3QGL A;  3WKL A;  3CBY A;  2IWQ A;  2K1Z A;  2BYG A;  2EGN A;  3PV5 A;  1P1E A;  2PZD A;  1KY9 A;  1UF1 A;  4OAJ A;  1WF8 A;  2L4S A;  2QG1 A;  1B8Q A;  1M5Z A;  4PQW A;  2M0T A;  5D13 A;  2FN5 A;  1BE9 A;  3OTP A;  1LCY A;  1GQ5 A;  3EGG C;  3VQF A;  4K72 A;  4G69 A;  2D90 A;  1RZX A;  4WYT A;  4NNL A;  2LC7 A;  3NGH A;  5HFF A;  4JOJ A;  2EEH A;  4UU5 A;  4Q2O A;  2H2C A;  1N6E A;  1T2M A;  5GLJ A;  1VA8 A;  1Y7N A;  2OSG A;  2QBW A;  1X5N A;  2QKT A;  2QT5 A;  3I4W A;  3R69 A;  1UM7 A;  2KOH A;  4JL7 A;  2JWE A;  3FY5 A;  4NXR A;  4EDJ A;  2VZ5 A;  2VSV A;  4YDP A;  3O5N A;  5FHT A;  4FGM A;  1OBZ A;  1N99 A;  1SOT A;  2KL1 A;  2OZF A;  2KRG A;  3GJ9 A;  1WHD A;  4JOP A;  2G5M B;  2YTW A;  3B76 A;  3PDV A;  5HDY A;  2I0L A;  4OEP A;  5B6L A;  3E17 A;  2OMJ A;  2L97 A;  5HFE A;  3O46 A;  4NXP A;  1OZI A;  3TMH A;  3GDU A;  4K78 A;  3K50 A;  1X8S A;  2EEJ A;  1WJL A;  2JRE A;  2GZV A;  1L6O A;  3I18 A;  1UEP A;  3BPU A;  2YUB A;  2KJK A;  2KPL A;  3KZE A;  4XHV A;  1N7T A;  1QAV B;  1W9Q A;  4LMM A;  1V5Q A;  5G1D A;  3EGH C;  1X45 A;  3R0H A;  1IU0 A;  1X6D A;  2AIN A;  4E3B A;  2IWO A;  5E11 A;  2EV8 A;  2V90 A;  2QKV A;  3AXA A;  2D8I A;  5HED A;  3DJ1 A;  3SOE A;  5HF4 A;  3TSZ A;  4P2A B;  3HPM A;  2I4S A;  3PDZ A;  2DC2 A;  1GQ4 A;  5GND A;  2M10 A;  4R2Z A;  1D5G A;  3QO6 A;  3SHW A;  1IHJ A;  2CSS A;  2JIN A;  1Y8T A;  5I7Z A;  2OGP A;  3ID4 A;  5E22 A;  4OEO A;  1MFG A;  1UJD A;  3DIW A;  4JOH A;  1TQ3 A;  2EHR A;  1WI2 A;  2EGO A;  4JOG A;  1YBO A;  5JXB A;  2F0A A;  4NNM A;  5E21 A;  2DLU A;  3GDS A;  2IWN A;  4K76 A;  1UHP A;  2EEG A;  3ID2 A;  1FC7 A;  2EDV A;  4AMH A;  2KJP A;  3RLE A;  4NMQ A;  1RY4 A;  3JXT A;  3QJM A;  1WH1 A;  2UZC A;  3I1E A;  5E6P B;  1FC6 A;  2DLS A;  3TSV A;  2ZPM A;  2OCS A;  1TP5 A;  1PDR A;  1WHA A;  2KA9 A;  2EJY A;  4YYX A;  2KAW A;  4WYU A;  3MH6 A;  3PV2 A;  1V5L A;  2FNE A;  2O2T A;  1P1D A;  1TP3 A;  2E7K A;  2M0Z A;  3SFJ A;  1MC7 A;  1ZUB A;  2MX6 A;  2KV8 A;  1UJV A;  2Z9I A;  4NXQ A;  3CH8 A;  3VQG A;  2H3M A;  3KHF A;  1Z87 A;  2JXO A;  1U37 A;  3QE1 A;  2H3L A;  5DTH A;  1U39 A;  5FB8 C;  5HF1 A;  3K1R A;  2YT8 A;  1WIF A;  2AWX A;  2JIL A;  4GVC A;  2LUI A;  4Q6H A;  2KOJ A;  2VRF A;  2KG2 A;  2LOB A;  2PKT A;  4NMR A;  4F8K A;  3L4F D;  2R4H A;  1RGR A;  1VCW A;  2DMZ A;  3PV4 A;  1FC9 A;  1UEZ A;  1ZOK A;  2Q9V A;  1K32 A;  1U3B A;  4Q2N A;  1I92 A;  3RL8 A;  1N7F A;  2G2L A;  4GHN A;  4GVD A;  4HOP B;  4K75 A;  1KEF A;  3QDO A;  2VPH A;  2DB5 A;  5E1Y A;  2LA8 A;  2P3W A;  4Q2Q A;  2EDZ A;  4H11 A;  2LC6 A;  2I1N A;  1OBX A;  3GDV A;  2KOM A;  3GSL A;  1FCF A;  3CS0 A;  3LNX A;  3LNY A;  5HFC A;  1I16 A; 
#chains in the Genus database with same CATH topology
 2FE5 A;  5HET A;  2KYL A;  1WI4 A;  1QAV A;  1WF7 A;  3QIK A;  3TSW A;  1R6J A;  2KQF A;  4N6X A;  3DJ3 A;  3GCO A;  3MH4 A;  4Q3H A;  2KBS A;  3CBX A;  4L8N A;  1V6B A;  3ZRT A;  3R68 A;  1X5Q A;  2WL7 A;  4Z33 A;  2HE4 A;  1V1T A;  1IU2 A;  1NTE A;  1N6F A;  3STJ A;  2KPK A;  3PS4 A;  5EYZ A;  2CSJ A;  2KJD A;  1G9O A;  1N6D A;  2EEI A;  1Z86 A;  5IL9 A;  4JOR A;  1WFV A;  3GGE A;  1OBY A;  3K82 A;  3DOR A;  3GAB A;  2DAZ A;  3DJA A;  2RRM A;  2EGK A;  1KWA A;  1UJU A;  1V62 A;  3CYY A;  1NF3 C;  2FCF A;  2VWR A;  4NMP A;  1VAE A;  2D92 A;  1VB7 A;  4P0C A;  4Z8J A;  4JOK A;  5ILB A;  3SUZ A;  5A2P A;  1UEW A;  2AWU A;  2Q3G A;  2HE2 A;  3RL7 A;  2I0I A;  2PKU A;  4UU6 A;  5F67 A;  2W7R A;  4NMV A;  2JOA A;  3HVQ C;  1TE0 A;  3CBZ A;  5EZ0 A;  2IWP A;  2V1W A;  2VSP A;  1UFX A;  2JIK A;  5HJ1 A;  1U38 A;  3WKM A;  1Q7X A;  1QAU A;  4IC6 A;  3CC0 A;  3NFL A;  3HPK A;  2DJT A;  2PA1 A;  2H2B A;  5HFD A;  1WFG A;  2R3Y A;  4K6Y A;  5HFB A;  1Q3P A;  2DM8 A;  1W9O A;  4NMS A;  2I6V A;  1W9E A;  1BFE A;  2CS5 A;  4KFW A;  2HGA A;  2W4F A;  1XZ9 A;  3GCN A;  2YT7 A;  5HEB A;  1MFL A;  2ENO A;  2L4T A;  5B42 A;  2M0U A;  4MPA A;  1WG6 A;  3QJN A;  4E35 A;  1SOZ A;  4JOF A;  2ZPL A;  2OS6 A;  1Q3O A;  2REY A;  5H3J A;  4O06 A;  2M3M A;  2EDP A;  1QLC A;  4RI0 A;  2PDZ A;  4REY A;  5F3X A;  1UEQ A;  2AWW A;  2OQS A;  3KZD A;  2QKU A;  4HOP A;  1UIT A;  3KDG A;  2Z17 A;  1UM1 A;  3SHU A;  4KFV A;  1X5R A;  2MHO A;  4Q2P A;  3ID1 A;  2M0V A;  4NMO A;  4Q6S A;  2OPG A;  4JOE A;  3ID3 A;  2PNT A;  2RCZ A;  2F5Y A;  4NMT A;  1RGW A;  1GM1 A;  4E34 A;  5HEY A;  3OU0 A;  2EAQ A;  2X7Z A;  2YUY A;  5G1E A;  2I04 A;  2DKR A;  1VJ6 A;  2EXG A;  3NFK A;  3MH7 A;  2K20 A;  1N7E A;  2GEF A;  3QGL A;  3WKL A;  3CBY A;  2IWQ A;  2K1Z A;  2BYG A;  2EGN A;  3PV5 A;  1P1E A;  2PZD A;  1KY9 A;  1UF1 A;  4OAJ A;  1WF8 A;  2L4S A;  2QG1 A;  1B8Q A;  1M5Z A;  4PQW A;  2M0T A;  5D13 A;  2FN5 A;  1BE9 A;  3OTP A;  1LCY A;  1GQ5 A;  3EGG C;  3VQF A;  4K72 A;  4G69 A;  2D90 A;  3KDK A;  1RZX A;  4WYT A;  4NNL A;  2LC7 A;  3NGH A;  5HFF A;  4JOJ A;  2EEH A;  4UU5 A;  4Q2O A;  2H2C A;  1N6E A;  1T2M A;  5GLJ A;  1VA8 A;  1Y7N A;  2OSG A;  2QBW A;  1X5N A;  2QKT A;  2QT5 A;  3I4W A;  3R69 A;  1UM7 A;  2KOH A;  4JL7 A;  2JWE A;  3FY5 A;  4NXR A;  4EDJ A;  2VZ5 A;  2VSV A;  4YDP A;  3O5N A;  5FHT A;  4FGM A;  1OBZ A;  1N99 A;  1SOT A;  2KL1 A;  2OZF A;  2KRG A;  3GJ9 A;  1WHD A;  4JOP A;  2G5M B;  2YTW A;  3B76 A;  3PDV A;  5HDY A;  2I0L A;  4JJ0 A;  4OEP A;  5B6L A;  3E17 A;  1X9Z A;  2L97 A;  2OMJ A;  5HFE A;  3O46 A;  4NXP A;  4JJ3 A;  1OZI A;  3TMH A;  3GDU A;  4K78 A;  3K50 A;  1X8S A;  2EEJ A;  1WJL A;  2JRE A;  2GZV A;  1L6O A;  3I18 A;  1UEP A;  3BPU A;  2YUB A;  2KJK A;  2KPL A;  3KZE A;  4XHV A;  1N7T A;  1QAV B;  1W9Q A;  4LMM A;  1V5Q A;  5G1D A;  3EGH C;  1X45 A;  3R0H A;  1IU0 A;  1X6D A;  2AIN A;  4E3B A;  2IWO A;  5E11 A;  2EV8 A;  2V90 A;  2QKV A;  3AXA A;  2D8I A;  5HED A;  3DJ1 A;  3SOE A;  5HF4 A;  3TSZ A;  4P2A B;  3HPM A;  2I4S A;  3PDZ A;  2DC2 A;  1GQ4 A;  5GND A;  2M10 A;  4R2Z A;  1D5G A;  3QO6 A;  3SHW A;  1IHJ A;  2CSS A;  2JIN A;  1Y8T A;  5I7Z A;  2OGP A;  3ID4 A;  5E22 A;  4OEO A;  1MFG A;  1UJD A;  3DIW A;  4JOH A;  1TQ3 A;  2EHR A;  1WI2 A;  2EGO A;  4JOG A;  1YBO A;  5JXB A;  2F0A A;  4NNM A;  5E21 A;  2DLU A;  3GDS A;  2IWN A;  4K76 A;  1UHP A;  2EEG A;  2JSN A;  3ID2 A;  1FC7 A;  2EDV A;  4AMH A;  2KJP A;  3RLE A;  4NMQ A;  1RY4 A;  3JXT A;  3QJM A;  1WH1 A;  2UZC A;  3I1E A;  5E6P B;  1FC6 A;  2DLS A;  3TSV A;  2ZPM A;  2OCS A;  1TP5 A;  1PDR A;  1WHA A;  2KA9 A;  2EJY A;  4YYX A;  2KAW A;  4WYU A;  3MH6 A;  3PV2 A;  1V5L A;  2FNE A;  2O2T A;  1P1D A;  1TP3 A;  2E7K A;  2M0Z A;  3SFJ A;  1MC7 A;  1ZUB A;  2MX6 A;  2KV8 A;  1UJV A;  2Z9I A;  4NXQ A;  3CH8 A;  3VQG A;  2H3M A;  3KHF A;  1Z87 A;  2JXO A;  1U37 A;  3QE1 A;  2H3L A;  5DTH A;  1U39 A;  5FB8 C;  5HF1 A;  3K1R A;  2YT8 A;  1WIF A;  2AWX A;  2JIL A;  4GVC A;  2LUI A;  4Q6H A;  2KOJ A;  2VRF A;  2KG2 A;  2LOB A;  2PKT A;  4NMR A;  4F8K A;  3L4F D;  2R4H A;  1RGR A;  1VCW A;  2DMZ A;  3PV4 A;  1FC9 A;  1UEZ A;  1ZOK A;  2Q9V A;  1K32 A;  3NCV A;  1U3B A;  4Q2N A;  1I92 A;  3RL8 A;  1N7F A;  2G2L A;  4GHN A;  4GVD A;  4HOP B;  4K75 A;  1KEF A;  4FLN A;  3QDO A;  2VPH A;  2DB5 A;  5E1Y A;  2LA8 A;  2P3W A;  4Q2Q A;  2EDZ A;  4H11 A;  2LC6 A;  2I1N A;  1OBX A;  3GDV A;  2KOM A;  3GSL A;  1FCF A;  3CS0 A;  3LNX A;  3LNY A;  5HFC A;  1I16 A; 
#chains in the Genus database with same CATH homology
 2FE5 A;  5HET A;  2KYL A;  1WI4 A;  1QAV A;  1WF7 A;  3QIK A;  3TSW A;  1R6J A;  2KQF A;  4N6X A;  3DJ3 A;  3GCO A;  3MH4 A;  4Q3H A;  2KBS A;  3CBX A;  4L8N A;  1V6B A;  3ZRT A;  3R68 A;  1X5Q A;  2WL7 A;  4Z33 A;  2HE4 A;  1V1T A;  1IU2 A;  1NTE A;  1N6F A;  3STJ A;  2KPK A;  3PS4 A;  5EYZ A;  2CSJ A;  2KJD A;  1G9O A;  1N6D A;  2EEI A;  1Z86 A;  5IL9 A;  4JOR A;  1WFV A;  3GGE A;  1OBY A;  3K82 A;  3DOR A;  3GAB A;  2DAZ A;  3DJA A;  2RRM A;  2EGK A;  1KWA A;  1UJU A;  1V62 A;  3CYY A;  1NF3 C;  2FCF A;  2VWR A;  4NMP A;  1VAE A;  2D92 A;  1VB7 A;  4P0C A;  4Z8J A;  4JOK A;  5ILB A;  3SUZ A;  5A2P A;  1UEW A;  2AWU A;  2Q3G A;  2HE2 A;  3RL7 A;  2I0I A;  2PKU A;  4UU6 A;  5F67 A;  2W7R A;  4NMV A;  2JOA A;  3HVQ C;  1TE0 A;  3CBZ A;  5EZ0 A;  2IWP A;  2V1W A;  2VSP A;  1UFX A;  2JIK A;  5HJ1 A;  1U38 A;  3WKM A;  1Q7X A;  1QAU A;  4IC6 A;  3CC0 A;  3NFL A;  3HPK A;  2DJT A;  2PA1 A;  2H2B A;  5HFD A;  1WFG A;  2R3Y A;  4K6Y A;  5HFB A;  1Q3P A;  2DM8 A;  1W9O A;  4NMS A;  2I6V A;  1W9E A;  1BFE A;  2CS5 A;  4KFW A;  2HGA A;  2W4F A;  1XZ9 A;  3GCN A;  2YT7 A;  5HEB A;  1MFL A;  2ENO A;  2L4T A;  5B42 A;  2M0U A;  4MPA A;  1WG6 A;  3QJN A;  4E35 A;  1SOZ A;  4JOF A;  2ZPL A;  2OS6 A;  1Q3O A;  2REY A;  5H3J A;  4O06 A;  2M3M A;  2EDP A;  1QLC A;  4RI0 A;  2PDZ A;  4REY A;  5F3X A;  1UEQ A;  2AWW A;  2OQS A;  3KZD A;  2QKU A;  4HOP A;  1UIT A;  3KDG A;  2Z17 A;  1UM1 A;  3SHU A;  4KFV A;  1X5R A;  2MHO A;  4Q2P A;  3ID1 A;  2M0V A;  4NMO A;  4Q6S A;  2OPG A;  4JOE A;  3ID3 A;  2PNT A;  2RCZ A;  2F5Y A;  4NMT A;  1RGW A;  1GM1 A;  4E34 A;  5HEY A;  3OU0 A;  2EAQ A;  2X7Z A;  2YUY A;  5G1E A;  2I04 A;  2DKR A;  1VJ6 A;  2EXG A;  3NFK A;  3MH7 A;  2K20 A;  1N7E A;  2GEF A;  3QGL A;  3WKL A;  3CBY A;  2IWQ A;  2K1Z A;  2BYG A;  2EGN A;  3PV5 A;  1P1E A;  2PZD A;  1KY9 A;  1UF1 A;  4OAJ A;  1WF8 A;  2L4S A;  2QG1 A;  1B8Q A;  1M5Z A;  4PQW A;  2M0T A;  5D13 A;  2FN5 A;  1BE9 A;  3OTP A;  1LCY A;  1GQ5 A;  3EGG C;  3VQF A;  4K72 A;  4G69 A;  2D90 A;  3KDK A;  1RZX A;  4WYT A;  4NNL A;  2LC7 A;  3NGH A;  5HFF A;  4JOJ A;  2EEH A;  4UU5 A;  4Q2O A;  2H2C A;  1N6E A;  1T2M A;  5GLJ A;  1VA8 A;  1Y7N A;  2OSG A;  2QBW A;  1X5N A;  2QKT A;  2QT5 A;  3I4W A;  3R69 A;  1UM7 A;  2KOH A;  4JL7 A;  2JWE A;  3FY5 A;  4NXR A;  4EDJ A;  2VZ5 A;  2VSV A;  4YDP A;  3O5N A;  5FHT A;  4FGM A;  1OBZ A;  1N99 A;  1SOT A;  2KL1 A;  2OZF A;  2KRG A;  3GJ9 A;  1WHD A;  4JOP A;  2G5M B;  2YTW A;  3B76 A;  3PDV A;  5HDY A;  2I0L A;  4JJ0 A;  4OEP A;  5B6L A;  3E17 A;  1X9Z A;  2L97 A;  2OMJ A;  5HFE A;  3O46 A;  4NXP A;  4JJ3 A;  1OZI A;  3TMH A;  3GDU A;  4K78 A;  3K50 A;  1X8S A;  2EEJ A;  1WJL A;  2JRE A;  2GZV A;  1L6O A;  3I18 A;  1UEP A;  3BPU A;  2YUB A;  2KJK A;  2KPL A;  3KZE A;  4XHV A;  1N7T A;  1QAV B;  1W9Q A;  4LMM A;  1V5Q A;  5G1D A;  3EGH C;  1X45 A;  3R0H A;  1IU0 A;  1X6D A;  2AIN A;  4E3B A;  2IWO A;  5E11 A;  2EV8 A;  2V90 A;  2QKV A;  3AXA A;  2D8I A;  5HED A;  3DJ1 A;  3SOE A;  5HF4 A;  3TSZ A;  4P2A B;  3HPM A;  2I4S A;  3PDZ A;  2DC2 A;  1GQ4 A;  5GND A;  2M10 A;  4R2Z A;  1D5G A;  3QO6 A;  3SHW A;  1IHJ A;  2CSS A;  2JIN A;  1Y8T A;  5I7Z A;  2OGP A;  3ID4 A;  5E22 A;  4OEO A;  1MFG A;  1UJD A;  3DIW A;  4JOH A;  1TQ3 A;  2EHR A;  1WI2 A;  2EGO A;  4JOG A;  1YBO A;  5JXB A;  2F0A A;  4NNM A;  5E21 A;  2DLU A;  3GDS A;  2IWN A;  4K76 A;  1UHP A;  2EEG A;  2JSN A;  3ID2 A;  1FC7 A;  2EDV A;  4AMH A;  2KJP A;  3RLE A;  4NMQ A;  1RY4 A;  3JXT A;  3QJM A;  1WH1 A;  2UZC A;  3I1E A;  5E6P B;  1FC6 A;  2DLS A;  3TSV A;  2ZPM A;  2OCS A;  1TP5 A;  1PDR A;  1WHA A;  2KA9 A;  2EJY A;  4YYX A;  2KAW A;  4WYU A;  3MH6 A;  3PV2 A;  1V5L A;  2FNE A;  2O2T A;  1P1D A;  1TP3 A;  2E7K A;  2M0Z A;  3SFJ A;  1MC7 A;  1ZUB A;  2MX6 A;  2KV8 A;  1UJV A;  2Z9I A;  4NXQ A;  3CH8 A;  3VQG A;  2H3M A;  3KHF A;  1Z87 A;  2JXO A;  1U37 A;  3QE1 A;  2H3L A;  5DTH A;  1U39 A;  5FB8 C;  5HF1 A;  3K1R A;  2YT8 A;  1WIF A;  2AWX A;  2JIL A;  4GVC A;  2LUI A;  4Q6H A;  2KOJ A;  2VRF A;  2KG2 A;  2LOB A;  2PKT A;  4NMR A;  4F8K A;  3L4F D;  2R4H A;  1RGR A;  1VCW A;  2DMZ A;  3PV4 A;  1FC9 A;  1UEZ A;  1ZOK A;  2Q9V A;  1K32 A;  3NCV A;  1U3B A;  4Q2N A;  1I92 A;  3RL8 A;  1N7F A;  2G2L A;  4GHN A;  4GVD A;  4HOP B;  4K75 A;  1KEF A;  4FLN A;  3QDO A;  2VPH A;  2DB5 A;  5E1Y A;  2LA8 A;  2P3W A;  4Q2Q A;  2EDZ A;  4H11 A;  2LC6 A;  2I1N A;  1OBX A;  3GDV A;  2KOM A;  3GSL A;  1FCF A;  3CS0 A;  3LNX A;  3LNY A;  5HFC A;  1I16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...