5G1DA

The complex structure of syntenin-1 pdz domain with c-terminal extension
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
168
Chain Sequence
QGIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTENIN-1
publication title New Structural Insight of C-Terminal Region of Syntenin-1, Enhancing the Molecular Dimerization and Inhibitory Function Related on Syndecan-4 Signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 38
structure length 168
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5g1dA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5g1dA01
3NFKA 2OPGA 3L4FD 3KZEA 2G2LA 3CYYA 1BE9A 1LCYA 4KFWA 3ID4A 4NNMA 5H3JA 2QT5A 3K1RA 3RL8A 2X7ZA 2DC2A 3QO6A 4G69A 2REYA 3ZRTA 1N7EA 4Q6HA 3SHUA 1UEQA 1IU0A 1UEWA 2YT7A 1OBZA 1WH1A 1TP3A 2EV8A 1U38A 2KOMA 4UU6A 1YBOA 2I0IA 1FCFA 2L97A 2BYGA 3O46A 2KYLA 1D5GA 5HEBA 3SOEA 4L8NA 1W9QA 3B76A 1XZ9A 2M0ZA 1WF8A 2KOHA 4Q2PA 2HE2A 5HFFA 3QDOA 2VWRA 2EDZA 3CBXA 2AWUA 5FB8C 4JOEA 2OQSA 2YUYA 1X5NA 3KHFA 3CBYA 2MX6A 4XHVA 5A2PA 3TSZA 4NXQA 1V6BA 2EEIA 5EZ0A 2JWEA 2QBWA 4NMVA 5I7ZA 2KJDA 2JOAA 2H3MA 1VB7A 4MPAA 4IC6A 2V1WA 2PZDA 1UITA 3DJAA 1W9OA 3CS0A 2KRGA 4LMMA 5DTHA 2YT8A 4YDPA 2DLSA 3I1EA 3MH4A 2FN5A 2OMJA 3R0HA 2F5YA 4FGMA 3R68A 1X5QA 2IWOA 4UU5A 1ZUBA 3GDVA 4K78A 1UFXA 4PQWA 3SUZA 4JORA 3AXAA 1Z86A 3VQGA 4Q6SA 5G1DA 1Y7NA 4OAJA 1FC7A 1WFVA 3I4WA 2I4SA 2I04A 4GHNA 3DORA 4F8KA 2HGAA 2KJKA 1VAEA 3HPMA 4P0CA 3OU0A 2DMZA 2KOJA 1U39A 4Q3HA 2QKVA 2WL7A 1QAUA 2OCSA 2KL1A 3NGHA 2CSSA 1FC6A 1WIFA 2EGKA 2EGNA 2P3WA 5HEYA 4NNLA 5E1YA 2CSJA 5GNDA 1VCWA 1I16A 3TSVA 2EAQA 2AWXA 5HFBA 3STJA 5JXBA 2Q3GA 2EHRA 5F3XA 3QE1A 2AINA 4OEPA 1WFGA 1QAVB 3ID1A 2D8IA 2PNTA 4P2AB 4WYUA 2ENOA 1K32A 1UM7A 2FNEA 1NTEA 3ID2A 3GSLA 1SOTA 2KV8A 2K20A 2DJTA 1OBYA 3HVQC 1RGWA 3RL7A 3GJ9A 1V1TA 2G5MB 3EGGC 1RY4A 2EEJA 2DAZA 1UEZA 1VJ6A 2K1ZA 4HOPB 1WHAA 4NMTA 2UZCA 1N6FA 3DIWA 2DB5A 3QJMA 2VSPA 5G1EA 1GQ4A 2L4SA 3MH6A 1SOZA 2PDZA 2KAWA 1UJUA 3TSWA 3QIKA 4JL7A 3LNXA 4GVDA 1M5ZA 4N6XA 2EEGA 2KBSA 3O5NA 3E17A 5EYZA 4E35A 4JOHA 2OGPA 1X5RA 2ZPLA 2QKTA 2RRMA 3PV5A 3PDVA 4NMSA 5E11A 1L6OA 1WHDA 1I92A 3DJ3A 1KEFA 4JOFA 1WG6A 2OZFA 2HE4A 1N7FA 3SFJA 2RCZA 1BFEA 1Q3OA 2M0VA 1RGRA 2IWNA 2PA1A 3RLEA 3NFLA 1MFGA 3ID3A 4NXRA 2CS5A 2LC7A 5HEDA 3GCOA 2KQFA 1U3BA 3GDUA 3VQFA 1B8QA 4REYA 3QGLA 4E3BA 1U37A 2DKRA 2KA9A 2Z17A 1G9OA 4WYTA 1R6JA 1TQ3A 2EEHA 5E6PB 4Q2QA 1N99A 2DM8A 4EDJA 4JOKA 1W9EA 1TE0A 5F67A 2QKUA 5D13A 1WI2A 1V5QA 2W7RA 2M0UA 2H3LA 3K82A 3CBZA 1RZXA 4Z8JA 5HDYA 2D92A 2I0LA 1Q7XA 1UF1A 2EGOA 3CH8A 2EDVA 3FY5A 2GZVA 1Y8TA 3QJNA 4NXPA 1PDRA 2FE5A 5HJ1A 2JINA 3DJ1A 1P1DA 4H11A 4NMPA 1IHJA 4JOGA 2VPHA 3K50A 4NMRA 1OBXA 1NF3C 1N7TA 2IWQA 1IU2A 1WJLA 2JILA 3I18A 2KJPA 2PKTA 2L4TA 2AWWA 5E21A 4YYXA 2H2BA 2EXGA 2JIKA 2W4FA 1WI4A 4Q2NA 5HF4A 3HPKA 1V62A 2JREA 2OS6A 2V90A 2MHOA 1P1EA 3CC0A 3TMHA 4RI0A 2Z9IA 2I1NA 2ZPMA 5E22A 3BPUA 3LNYA 2R3YA 4R2ZA 1TP5A 1X45A 4Z33A 2LA8A 4E34A 5HFDA 4O06A 4AMHA 4K75A 2LC6A 2F0AA 5HFEA 2FCFA 4KFVA 1WF7A 1Q3PA 4K72A 1KWAA 1X8SA 3GCNA 2VSVA 3KZDA 1V5LA 4OEOA 2KPLA 3MH7A 4NMQA 3SHWA 1UM1A 2EDPA 1UEPA 3WKMA 1UHPA 2H2CA 4JOJA 3PS4A 2M10A 1KY9A 3GDSA 5HF1A 1MC7A 1X6DA 1N6EA 4K76A 1UJVA 2R4HA 2I6VA 2OSGA 1MFLA 1Z87A 5HETA 2LUIA 4NMOA 5HFCA 2YUBA 3R69A 2QG1A 1T2MA 2KPKA 2PKUA 2M0TA 2LOBA 2KG2A 2Q9VA 2D90A 1FC9A 1UJDA 1GQ5A 2E7KA 2VZ5A 5B6LA 2YTWA 1QAVA 2IWPA 2O2TA 3OTPA 1OZIA 3GGEA 3PV4A 1N6DA 4Q2OA 3EGHC 1VA8A 4JOPA 2DLUA 1QLCA 3JXTA 2EJYA 4K6YA 1GM1A 2VRFA 4GVCA 3WKLA 5GLJA 4HOPA 5FHTA 3PV2A 3PDZA 1ZOKA 2JXOA 2M3MA
chains in the Genus database with same CATH superfamily
3NFKA 2OPGA 3L4FD 3KZEA 2G2LA 3CYYA 1BE9A 1LCYA 4KFWA 3ID4A 4NNMA 5H3JA 2QT5A 3K1RA 2JSNA 3RL8A 2X7ZA 2DC2A 3QO6A 4G69A 2REYA 3ZRTA 1N7EA 4Q6HA 3SHUA 1UEQA 1IU0A 1UEWA 2YT7A 1OBZA 1WH1A 1TP3A 2EV8A 1U38A 2KOMA 4UU6A 1YBOA 2I0IA 1FCFA 3GABA 2L97A 2BYGA 3O46A 2KYLA 1D5GA 5HEBA 3SOEA 4L8NA 1W9QA 3B76A 1XZ9A 2M0ZA 1WF8A 2KOHA 4Q2PA 2HE2A 5HFFA 3QDOA 2VWRA 2EDZA 3CBXA 2AWUA 5FB8C 4JOEA 2OQSA 2YUYA 1X5NA 3KHFA 3CBYA 2MX6A 4XHVA 5A2PA 3TSZA 4NXQA 1V6BA 2EEIA 5EZ0A 2JWEA 2QBWA 4NMVA 5I7ZA 2KJDA 2JOAA 2H3MA 1VB7A 4MPAA 4IC6A 2V1WA 2PZDA 1UITA 3DJAA 1W9OA 4JJ3A 3CS0A 2KRGA 4LMMA 5DTHA 2YT8A 4YDPA 2DLSA 3I1EA 3MH4A 2FN5A 2OMJA 3R0HA 2F5YA 4FGMA 3R68A 1X5QA 2IWOA 3KDKA 4UU5A 1ZUBA 3GDVA 4K78A 1UFXA 4PQWA 3SUZA 4JORA 3AXAA 1Z86A 3VQGA 4Q6SA 5G1DA 1Y7NA 4OAJA 1FC7A 1WFVA 3I4WA 2I4SA 2I04A 4GHNA 3DORA 4F8KA 2HGAA 2KJKA 1VAEA 3HPMA 4P0CA 3OU0A 2DMZA 2KOJA 1U39A 4Q3HA 2QKVA 2WL7A 1QAUA 2OCSA 2KL1A 3NGHA 2CSSA 1FC6A 1WIFA 2EGKA 2EGNA 2P3WA 5HEYA 4NNLA 5E1YA 2CSJA 5GNDA 1VCWA 1I16A 3TSVA 2EAQA 2AWXA 5HFBA 3STJA 5JXBA 5ILBA 2Q3GA 2EHRA 5F3XA 3QE1A 2AINA 4OEPA 1WFGA 1QAVB 3ID1A 2D8IA 2PNTA 4P2AB 4WYUA 2ENOA 1K32A 1UM7A 2FNEA 1NTEA 3ID2A 3GSLA 1SOTA 2KV8A 2K20A 2DJTA 1OBYA 3HVQC 1RGWA 3RL7A 3GJ9A 1V1TA 2G5MB 3EGGC 1RY4A 2EEJA 2DAZA 1UEZA 1VJ6A 2GEFA 2K1ZA 4HOPB 1WHAA 4NMTA 2UZCA 1N6FA 3DIWA 2DB5A 3QJMA 2VSPA 5G1EA 1GQ4A 2L4SA 3MH6A 1SOZA 2PDZA 2KAWA 1UJUA 3TSWA 3QIKA 4JL7A 3LNXA 4GVDA 1M5ZA 4N6XA 2EEGA 2KBSA 3O5NA 3E17A 5EYZA 4E35A 4JOHA 2OGPA 1X5RA 2ZPLA 2QKTA 2RRMA 3PV5A 3PDVA 4NMSA 5E11A 1L6OA 1WHDA 1I92A 3DJ3A 1KEFA 4JOFA 1WG6A 2OZFA 2HE4A 1N7FA 3SFJA 2RCZA 1BFEA 1Q3OA 2M0VA 1RGRA 2IWNA 2PA1A 3RLEA 3NFLA 1MFGA 3ID3A 4NXRA 2CS5A 2LC7A 5HEDA 3GCOA 2KQFA 1U3BA 3GDUA 3VQFA 1B8QA 4REYA 3QGLA 4E3BA 1U37A 2DKRA 2KA9A 2Z17A 1G9OA 4WYTA 1R6JA 1TQ3A 2EEHA 5E6PB 4Q2QA 1N99A 2DM8A 4EDJA 4JOKA 1W9EA 1TE0A 5F67A 2QKUA 5D13A 1WI2A 1V5QA 2W7RA 2M0UA 2H3LA 3K82A 3CBZA 1RZXA 4Z8JA 5HDYA 4JJ0A 2D92A 2I0LA 1Q7XA 1UF1A 2EGOA 3CH8A 2EDVA 3FY5A 2GZVA 1Y8TA 3QJNA 4NXPA 1PDRA 2FE5A 5HJ1A 2JINA 3DJ1A 1P1DA 4H11A 4NMPA 1IHJA 4JOGA 2VPHA 3K50A 4NMRA 1OBXA 1NF3C 3NCVA 1N7TA 2IWQA 1IU2A 1WJLA 2JILA 3I18A 2KJPA 2PKTA 2L4TA 2AWWA 5E21A 4YYXA 2H2BA 2EXGA 2JIKA 2W4FA 1WI4A 4Q2NA 5HF4A 3HPKA 1V62A 5B42A 2JREA 2OS6A 2V90A 2MHOA 1P1EA 3CC0A 3TMHA 4RI0A 2Z9IA 2I1NA 2ZPMA 5E22A 3BPUA 3LNYA 2R3YA 4R2ZA 1TP5A 1X45A 4Z33A 2LA8A 4E34A 5HFDA 4O06A 4AMHA 4K75A 2LC6A 2F0AA 5HFEA 3KDGA 2FCFA 4KFVA 1WF7A 1Q3PA 4K72A 1KWAA 1X8SA 3GCNA 2VSVA 3KZDA 1V5LA 4OEOA 2KPLA 3MH7A 4NMQA 3SHWA 1UM1A 2EDPA 1X9ZA 1UEPA 3WKMA 1UHPA 2H2CA 4JOJA 3PS4A 2M10A 1KY9A 3GDSA 5HF1A 1MC7A 1X6DA 1N6EA 4K76A 1UJVA 4FLNA 2R4HA 2I6VA 2OSGA 1MFLA 1Z87A 5HETA 2LUIA 4NMOA 5HFCA 2YUBA 3R69A 2QG1A 1T2MA 2KPKA 2PKUA 2M0TA 2LOBA 2KG2A 2Q9VA 2D90A 1FC9A 1UJDA 1GQ5A 2E7KA 2VZ5A 5B6LA 2YTWA 1QAVA 2IWPA 2O2TA 3OTPA 1OZIA 3GGEA 3PV4A 5IL9A 1N6DA 4Q2OA 3EGHC 1VA8A 4JOPA 2DLUA 1QLCA 3JXTA 2EJYA 4K6YA 1GM1A 2VRFA 4GVCA 3WKLA 5GLJA 4HOPA 5FHTA 3PV2A 3PDZA 1ZOKA 2JXOA 2M3MA
chains in the Genus database with same CATH topology
3NFKA 2OPGA 3L4FD 3KZEA 2G2LA 3CYYA 1BE9A 1LCYA 4KFWA 3ID4A 4NNMA 5H3JA 2QT5A 3K1RA 2JSNA 3RL8A 2X7ZA 2DC2A 3QO6A 4G69A 2REYA 3ZRTA 1N7EA 4Q6HA 3SHUA 1UEQA 1IU0A 1UEWA 2YT7A 1OBZA 1WH1A 1TP3A 2EV8A 1U38A 2KOMA 4UU6A 1YBOA 2I0IA 1FCFA 3GABA 2L97A 2BYGA 3O46A 2KYLA 1D5GA 5HEBA 3SOEA 4L8NA 1W9QA 3B76A 1XZ9A 2M0ZA 1WF8A 2KOHA 4Q2PA 2HE2A 5HFFA 3QDOA 2VWRA 2EDZA 3CBXA 2AWUA 5FB8C 4JOEA 2OQSA 2YUYA 1X5NA 3KHFA 3CBYA 2MX6A 4XHVA 5A2PA 3TSZA 4NXQA 1V6BA 2EEIA 5EZ0A 2JWEA 2QBWA 4NMVA 5I7ZA 2KJDA 2JOAA 2H3MA 1VB7A 4MPAA 4IC6A 2V1WA 2PZDA 1UITA 3DJAA 1W9OA 4JJ3A 3CS0A 2KRGA 4LMMA 5DTHA 2YT8A 4YDPA 2DLSA 3I1EA 3MH4A 2FN5A 2OMJA 3R0HA 2F5YA 4FGMA 3R68A 1X5QA 2IWOA 3KDKA 4UU5A 1ZUBA 3GDVA 4K78A 1UFXA 4PQWA 3SUZA 4JORA 3AXAA 1Z86A 3VQGA 4Q6SA 5G1DA 1Y7NA 4OAJA 1FC7A 1WFVA 3I4WA 2I4SA 2I04A 4GHNA 3DORA 4F8KA 2HGAA 2KJKA 1VAEA 3HPMA 4P0CA 3OU0A 2DMZA 2KOJA 1U39A 4Q3HA 2QKVA 2WL7A 1QAUA 2OCSA 2KL1A 3NGHA 2CSSA 1FC6A 1WIFA 2EGKA 2EGNA 2P3WA 5HEYA 4NNLA 5E1YA 2CSJA 5GNDA 1VCWA 1I16A 3TSVA 2EAQA 2AWXA 5HFBA 3STJA 5JXBA 5ILBA 2Q3GA 2EHRA 5F3XA 3QE1A 2AINA 4OEPA 1WFGA 1QAVB 3ID1A 2D8IA 2PNTA 4P2AB 4WYUA 2ENOA 1K32A 1UM7A 2FNEA 1NTEA 3ID2A 3GSLA 1SOTA 2KV8A 2K20A 2DJTA 1OBYA 3HVQC 1RGWA 3RL7A 3GJ9A 1V1TA 2G5MB 3EGGC 1RY4A 2EEJA 2DAZA 1UEZA 1VJ6A 2GEFA 2K1ZA 4HOPB 1WHAA 4NMTA 2UZCA 1N6FA 3DIWA 2DB5A 3QJMA 2VSPA 5G1EA 1GQ4A 2L4SA 3MH6A 1SOZA 2PDZA 2KAWA 1UJUA 3TSWA 3QIKA 4JL7A 3LNXA 4GVDA 1M5ZA 4N6XA 2EEGA 2KBSA 3O5NA 3E17A 5EYZA 4E35A 4JOHA 2OGPA 1X5RA 2ZPLA 2QKTA 2RRMA 3PV5A 3PDVA 4NMSA 5E11A 1L6OA 1WHDA 1I92A 3DJ3A 1KEFA 4JOFA 1WG6A 2OZFA 2HE4A 1N7FA 3SFJA 2RCZA 1BFEA 1Q3OA 2M0VA 1RGRA 2IWNA 2PA1A 3RLEA 3NFLA 1MFGA 3ID3A 4NXRA 2CS5A 2LC7A 5HEDA 3GCOA 2KQFA 1U3BA 3GDUA 3VQFA 1B8QA 4REYA 3QGLA 4E3BA 1U37A 2DKRA 2KA9A 2Z17A 1G9OA 4WYTA 1R6JA 1TQ3A 2EEHA 5E6PB 4Q2QA 1N99A 2DM8A 4EDJA 4JOKA 1W9EA 1TE0A 5F67A 2QKUA 5D13A 1WI2A 1V5QA 2W7RA 2M0UA 2H3LA 3K82A 3CBZA 1RZXA 4Z8JA 5HDYA 4JJ0A 2D92A 2I0LA 1Q7XA 1UF1A 2EGOA 3CH8A 2EDVA 3FY5A 2GZVA 1Y8TA 3QJNA 4NXPA 1PDRA 2FE5A 5HJ1A 2JINA 3DJ1A 1P1DA 4H11A 4NMPA 1IHJA 4JOGA 2VPHA 3K50A 4NMRA 1OBXA 1NF3C 3NCVA 1N7TA 2IWQA 1IU2A 1WJLA 2JILA 3I18A 2KJPA 2PKTA 2L4TA 2AWWA 5E21A 4YYXA 2H2BA 2EXGA 2JIKA 2W4FA 1WI4A 4Q2NA 5HF4A 3HPKA 1V62A 5B42A 2JREA 2OS6A 2V90A 2MHOA 1P1EA 3CC0A 3TMHA 4RI0A 2Z9IA 2I1NA 2ZPMA 5E22A 3BPUA 3LNYA 2R3YA 4R2ZA 1TP5A 1X45A 4Z33A 2LA8A 4E34A 5HFDA 4O06A 4AMHA 4K75A 2LC6A 2F0AA 5HFEA 3KDGA 2FCFA 4KFVA 1WF7A 1Q3PA 4K72A 1KWAA 1X8SA 3GCNA 2VSVA 3KZDA 1V5LA 4OEOA 2KPLA 3MH7A 4NMQA 3SHWA 1UM1A 2EDPA 1X9ZA 1UEPA 3WKMA 1UHPA 2H2CA 4JOJA 3PS4A 2M10A 1KY9A 3GDSA 5HF1A 1MC7A 1X6DA 1N6EA 4K76A 1UJVA 4FLNA 2R4HA 2I6VA 2OSGA 1MFLA 1Z87A 5HETA 2LUIA 4NMOA 5HFCA 2YUBA 3R69A 2QG1A 1T2MA 2KPKA 2PKUA 2M0TA 2LOBA 2KG2A 2Q9VA 2D90A 1FC9A 1UJDA 1GQ5A 2E7KA 2VZ5A 5B6LA 2YTWA 1QAVA 2IWPA 2O2TA 3OTPA 1OZIA 3GGEA 3PV4A 5IL9A 1N6DA 4Q2OA 3EGHC 1VA8A 4JOPA 2DLUA 1QLCA 3JXTA 2EJYA 4K6YA 1GM1A 2VRFA 4GVCA 3WKLA 5GLJA 4HOPA 5FHTA 3PV2A 3PDZA 1ZOKA 2JXOA 2M3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFK A;  2OPG A;  3L4F D;  3KZE A;  2G2L A;  3CYY A;  1BE9 A;  1LCY A;  4KFW A;  3ID4 A;  4NNM A;  5H3J A;  2QT5 A;  3K1R A;  3RL8 A;  2X7Z A;  2DC2 A;  3QO6 A;  4G69 A;  2REY A;  3ZRT A;  1N7E A;  4Q6H A;  3SHU A;  1UEQ A;  1IU0 A;  1UEW A;  2YT7 A;  1OBZ A;  1WH1 A;  1TP3 A;  2EV8 A;  1U38 A;  2KOM A;  4UU6 A;  1YBO A;  2I0I A;  1FCF A;  2L97 A;  2BYG A;  3O46 A;  2KYL A;  1D5G A;  5HEB A;  3SOE A;  4L8N A;  1W9Q A;  3B76 A;  1XZ9 A;  2M0Z A;  1WF8 A;  2KOH A;  4Q2P A;  2HE2 A;  5HFF A;  3QDO A;  2VWR A;  2EDZ A;  3CBX A;  2AWU A;  5FB8 C;  4JOE A;  2OQS A;  2YUY A;  1X5N A;  3KHF A;  3CBY A;  2MX6 A;  4XHV A;  5A2P A;  3TSZ A;  4NXQ A;  1V6B A;  2EEI A;  5EZ0 A;  2JWE A;  2QBW A;  4NMV A;  5I7Z A;  2KJD A;  2JOA A;  2H3M A;  1VB7 A;  4MPA A;  4IC6 A;  2V1W A;  2PZD A;  1UIT A;  3DJA A;  1W9O A;  3CS0 A;  2KRG A;  4LMM A;  5DTH A;  2YT8 A;  4YDP A;  2DLS A;  3I1E A;  3MH4 A;  2FN5 A;  2OMJ A;  3R0H A;  2F5Y A;  4FGM A;  3R68 A;  1X5Q A;  2IWO A;  4UU5 A;  1ZUB A;  3GDV A;  4K78 A;  1UFX A;  4PQW A;  3SUZ A;  4JOR A;  3AXA A;  1Z86 A;  3VQG A;  4Q6S A;  5G1D A;  1Y7N A;  4OAJ A;  1FC7 A;  1WFV A;  3I4W A;  2I4S A;  2I04 A;  4GHN A;  3DOR A;  4F8K A;  2HGA A;  2KJK A;  1VAE A;  3HPM A;  4P0C A;  3OU0 A;  2DMZ A;  2KOJ A;  1U39 A;  4Q3H A;  2QKV A;  2WL7 A;  1QAU A;  2OCS A;  2KL1 A;  3NGH A;  2CSS A;  1FC6 A;  1WIF A;  2EGK A;  2EGN A;  2P3W A;  5HEY A;  4NNL A;  5E1Y A;  2CSJ A;  5GND A;  1VCW A;  1I16 A;  3TSV A;  2EAQ A;  2AWX A;  5HFB A;  3STJ A;  5JXB A;  2Q3G A;  2EHR A;  5F3X A;  3QE1 A;  2AIN A;  4OEP A;  1WFG A;  1QAV B;  3ID1 A;  2D8I A;  2PNT A;  4P2A B;  4WYU A;  2ENO A;  1K32 A;  1UM7 A;  2FNE A;  1NTE A;  3ID2 A;  3GSL A;  1SOT A;  2KV8 A;  2K20 A;  2DJT A;  1OBY A;  3HVQ C;  1RGW A;  3RL7 A;  3GJ9 A;  1V1T A;  2G5M B;  3EGG C;  1RY4 A;  2EEJ A;  2DAZ A;  1UEZ A;  1VJ6 A;  2K1Z A;  4HOP B;  1WHA A;  4NMT A;  2UZC A;  1N6F A;  3DIW A;  2DB5 A;  3QJM A;  2VSP A;  5G1E A;  1GQ4 A;  2L4S A;  3MH6 A;  1SOZ A;  2PDZ A;  2KAW A;  1UJU A;  3TSW A;  3QIK A;  4JL7 A;  3LNX A;  4GVD A;  1M5Z A;  4N6X A;  2EEG A;  2KBS A;  3O5N A;  3E17 A;  5EYZ A;  4E35 A;  4JOH A;  2OGP A;  1X5R A;  2ZPL A;  2QKT A;  2RRM A;  3PV5 A;  3PDV A;  4NMS A;  5E11 A;  1L6O A;  1WHD A;  1I92 A;  3DJ3 A;  1KEF A;  4JOF A;  1WG6 A;  2OZF A;  2HE4 A;  1N7F A;  3SFJ A;  2RCZ A;  1BFE A;  1Q3O A;  2M0V A;  1RGR A;  2IWN A;  2PA1 A;  3RLE A;  3NFL A;  1MFG A;  3ID3 A;  4NXR A;  2CS5 A;  2LC7 A;  5HED A;  3GCO A;  2KQF A;  1U3B A;  3GDU A;  3VQF A;  1B8Q A;  4REY A;  3QGL A;  4E3B A;  1U37 A;  2DKR A;  2KA9 A;  2Z17 A;  1G9O A;  4WYT A;  1R6J A;  1TQ3 A;  2EEH A;  5E6P B;  4Q2Q A;  1N99 A;  2DM8 A;  4EDJ A;  4JOK A;  1W9E A;  1TE0 A;  5F67 A;  2QKU A;  5D13 A;  1WI2 A;  1V5Q A;  2W7R A;  2M0U A;  2H3L A;  3K82 A;  3CBZ A;  1RZX A;  4Z8J A;  5HDY A;  2D92 A;  2I0L A;  1Q7X A;  1UF1 A;  2EGO A;  3CH8 A;  2EDV A;  3FY5 A;  2GZV A;  1Y8T A;  3QJN A;  4NXP A;  1PDR A;  2FE5 A;  5HJ1 A;  2JIN A;  3DJ1 A;  1P1D A;  4H11 A;  4NMP A;  1IHJ A;  4JOG A;  2VPH A;  3K50 A;  4NMR A;  1OBX A;  1NF3 C;  1N7T A;  2IWQ A;  1IU2 A;  1WJL A;  2JIL A;  3I18 A;  2KJP A;  2PKT A;  2L4T A;  2AWW A;  5E21 A;  4YYX A;  2H2B A;  2EXG A;  2JIK A;  2W4F A;  1WI4 A;  4Q2N A;  5HF4 A;  3HPK A;  1V62 A;  2JRE A;  2OS6 A;  2V90 A;  2MHO A;  1P1E A;  3CC0 A;  3TMH A;  4RI0 A;  2Z9I A;  2I1N A;  2ZPM A;  5E22 A;  3BPU A;  3LNY A;  2R3Y A;  4R2Z A;  1TP5 A;  1X45 A;  4Z33 A;  2LA8 A;  4E34 A;  5HFD A;  4O06 A;  4AMH A;  4K75 A;  2LC6 A;  2F0A A;  5HFE A;  2FCF A;  4KFV A;  1WF7 A;  1Q3P A;  4K72 A;  1KWA A;  1X8S A;  3GCN A;  2VSV A;  3KZD A;  1V5L A;  4OEO A;  2KPL A;  3MH7 A;  4NMQ A;  3SHW A;  1UM1 A;  2EDP A;  1UEP A;  3WKM A;  1UHP A;  2H2C A;  4JOJ A;  3PS4 A;  2M10 A;  1KY9 A;  3GDS A;  5HF1 A;  1MC7 A;  1X6D A;  1N6E A;  4K76 A;  1UJV A;  2R4H A;  2I6V A;  2OSG A;  1MFL A;  1Z87 A;  5HET A;  2LUI A;  4NMO A;  5HFC A;  2YUB A;  3R69 A;  2QG1 A;  1T2M A;  2KPK A;  2PKU A;  2M0T A;  2LOB A;  2KG2 A;  2Q9V A;  2D90 A;  1FC9 A;  1UJD A;  1GQ5 A;  2E7K A;  2VZ5 A;  5B6L A;  2YTW A;  1QAV A;  2IWP A;  2O2T A;  3OTP A;  1OZI A;  3GGE A;  3PV4 A;  1N6D A;  4Q2O A;  3EGH C;  1VA8 A;  4JOP A;  2DLU A;  1QLC A;  3JXT A;  2EJY A;  4K6Y A;  1GM1 A;  2VRF A;  4GVC A;  3WKL A;  5GLJ A;  4HOP A;  5FHT A;  3PV2 A;  3PDZ A;  1ZOK A;  2JXO A;  2M3M A; 
#chains in the Genus database with same CATH topology
 3NFK A;  2OPG A;  3L4F D;  3KZE A;  2G2L A;  3CYY A;  1BE9 A;  1LCY A;  4KFW A;  3ID4 A;  4NNM A;  5H3J A;  2QT5 A;  3K1R A;  2JSN A;  3RL8 A;  2X7Z A;  2DC2 A;  3QO6 A;  4G69 A;  2REY A;  3ZRT A;  1N7E A;  4Q6H A;  3SHU A;  1UEQ A;  1IU0 A;  1UEW A;  2YT7 A;  1OBZ A;  1WH1 A;  1TP3 A;  2EV8 A;  1U38 A;  2KOM A;  4UU6 A;  1YBO A;  2I0I A;  1FCF A;  3GAB A;  2L97 A;  2BYG A;  3O46 A;  2KYL A;  1D5G A;  5HEB A;  3SOE A;  4L8N A;  1W9Q A;  3B76 A;  1XZ9 A;  2M0Z A;  1WF8 A;  2KOH A;  4Q2P A;  2HE2 A;  5HFF A;  3QDO A;  2VWR A;  2EDZ A;  3CBX A;  2AWU A;  5FB8 C;  4JOE A;  2OQS A;  2YUY A;  1X5N A;  3KHF A;  3CBY A;  2MX6 A;  4XHV A;  5A2P A;  3TSZ A;  4NXQ A;  1V6B A;  2EEI A;  5EZ0 A;  2JWE A;  2QBW A;  4NMV A;  5I7Z A;  2KJD A;  2JOA A;  2H3M A;  1VB7 A;  4MPA A;  4IC6 A;  2V1W A;  2PZD A;  1UIT A;  3DJA A;  1W9O A;  4JJ3 A;  3CS0 A;  2KRG A;  4LMM A;  5DTH A;  2YT8 A;  4YDP A;  2DLS A;  3I1E A;  3MH4 A;  2FN5 A;  2OMJ A;  3R0H A;  2F5Y A;  4FGM A;  3R68 A;  1X5Q A;  2IWO A;  3KDK A;  4UU5 A;  1ZUB A;  3GDV A;  4K78 A;  1UFX A;  4PQW A;  3SUZ A;  4JOR A;  3AXA A;  1Z86 A;  3VQG A;  4Q6S A;  5G1D A;  1Y7N A;  4OAJ A;  1FC7 A;  1WFV A;  3I4W A;  2I4S A;  2I04 A;  4GHN A;  3DOR A;  4F8K A;  2HGA A;  2KJK A;  1VAE A;  3HPM A;  4P0C A;  3OU0 A;  2DMZ A;  2KOJ A;  1U39 A;  4Q3H A;  2QKV A;  2WL7 A;  1QAU A;  2OCS A;  2KL1 A;  3NGH A;  2CSS A;  1FC6 A;  1WIF A;  2EGK A;  2EGN A;  2P3W A;  5HEY A;  4NNL A;  5E1Y A;  2CSJ A;  5GND A;  1VCW A;  1I16 A;  3TSV A;  2EAQ A;  2AWX A;  5HFB A;  3STJ A;  5JXB A;  5ILB A;  2Q3G A;  2EHR A;  5F3X A;  3QE1 A;  2AIN A;  4OEP A;  1WFG A;  1QAV B;  3ID1 A;  2D8I A;  2PNT A;  4P2A B;  4WYU A;  2ENO A;  1K32 A;  1UM7 A;  2FNE A;  1NTE A;  3ID2 A;  3GSL A;  1SOT A;  2KV8 A;  2K20 A;  2DJT A;  1OBY A;  3HVQ C;  1RGW A;  3RL7 A;  3GJ9 A;  1V1T A;  2G5M B;  3EGG C;  1RY4 A;  2EEJ A;  2DAZ A;  1UEZ A;  1VJ6 A;  2GEF A;  2K1Z A;  4HOP B;  1WHA A;  4NMT A;  2UZC A;  1N6F A;  3DIW A;  2DB5 A;  3QJM A;  2VSP A;  5G1E A;  1GQ4 A;  2L4S A;  3MH6 A;  1SOZ A;  2PDZ A;  2KAW A;  1UJU A;  3TSW A;  3QIK A;  4JL7 A;  3LNX A;  4GVD A;  1M5Z A;  4N6X A;  2EEG A;  2KBS A;  3O5N A;  3E17 A;  5EYZ A;  4E35 A;  4JOH A;  2OGP A;  1X5R A;  2ZPL A;  2QKT A;  2RRM A;  3PV5 A;  3PDV A;  4NMS A;  5E11 A;  1L6O A;  1WHD A;  1I92 A;  3DJ3 A;  1KEF A;  4JOF A;  1WG6 A;  2OZF A;  2HE4 A;  1N7F A;  3SFJ A;  2RCZ A;  1BFE A;  1Q3O A;  2M0V A;  1RGR A;  2IWN A;  2PA1 A;  3RLE A;  3NFL A;  1MFG A;  3ID3 A;  4NXR A;  2CS5 A;  2LC7 A;  5HED A;  3GCO A;  2KQF A;  1U3B A;  3GDU A;  3VQF A;  1B8Q A;  4REY A;  3QGL A;  4E3B A;  1U37 A;  2DKR A;  2KA9 A;  2Z17 A;  1G9O A;  4WYT A;  1R6J A;  1TQ3 A;  2EEH A;  5E6P B;  4Q2Q A;  1N99 A;  2DM8 A;  4EDJ A;  4JOK A;  1W9E A;  1TE0 A;  5F67 A;  2QKU A;  5D13 A;  1WI2 A;  1V5Q A;  2W7R A;  2M0U A;  2H3L A;  3K82 A;  3CBZ A;  1RZX A;  4Z8J A;  5HDY A;  4JJ0 A;  2D92 A;  2I0L A;  1Q7X A;  1UF1 A;  2EGO A;  3CH8 A;  2EDV A;  3FY5 A;  2GZV A;  1Y8T A;  3QJN A;  4NXP A;  1PDR A;  2FE5 A;  5HJ1 A;  2JIN A;  3DJ1 A;  1P1D A;  4H11 A;  4NMP A;  1IHJ A;  4JOG A;  2VPH A;  3K50 A;  4NMR A;  1OBX A;  1NF3 C;  3NCV A;  1N7T A;  2IWQ A;  1IU2 A;  1WJL A;  2JIL A;  3I18 A;  2KJP A;  2PKT A;  2L4T A;  2AWW A;  5E21 A;  4YYX A;  2H2B A;  2EXG A;  2JIK A;  2W4F A;  1WI4 A;  4Q2N A;  5HF4 A;  3HPK A;  1V62 A;  5B42 A;  2JRE A;  2OS6 A;  2V90 A;  2MHO A;  1P1E A;  3CC0 A;  3TMH A;  4RI0 A;  2Z9I A;  2I1N A;  2ZPM A;  5E22 A;  3BPU A;  3LNY A;  2R3Y A;  4R2Z A;  1TP5 A;  1X45 A;  4Z33 A;  2LA8 A;  4E34 A;  5HFD A;  4O06 A;  4AMH A;  4K75 A;  2LC6 A;  2F0A A;  5HFE A;  3KDG A;  2FCF A;  4KFV A;  1WF7 A;  1Q3P A;  4K72 A;  1KWA A;  1X8S A;  3GCN A;  2VSV A;  3KZD A;  1V5L A;  4OEO A;  2KPL A;  3MH7 A;  4NMQ A;  3SHW A;  1UM1 A;  2EDP A;  1X9Z A;  1UEP A;  3WKM A;  1UHP A;  2H2C A;  4JOJ A;  3PS4 A;  2M10 A;  1KY9 A;  3GDS A;  5HF1 A;  1MC7 A;  1X6D A;  1N6E A;  4K76 A;  1UJV A;  4FLN A;  2R4H A;  2I6V A;  2OSG A;  1MFL A;  1Z87 A;  5HET A;  2LUI A;  4NMO A;  5HFC A;  2YUB A;  3R69 A;  2QG1 A;  1T2M A;  2KPK A;  2PKU A;  2M0T A;  2LOB A;  2KG2 A;  2Q9V A;  2D90 A;  1FC9 A;  1UJD A;  1GQ5 A;  2E7K A;  2VZ5 A;  5B6L A;  2YTW A;  1QAV A;  2IWP A;  2O2T A;  3OTP A;  1OZI A;  3GGE A;  3PV4 A;  5IL9 A;  1N6D A;  4Q2O A;  3EGH C;  1VA8 A;  4JOP A;  2DLU A;  1QLC A;  3JXT A;  2EJY A;  4K6Y A;  1GM1 A;  2VRF A;  4GVC A;  3WKL A;  5GLJ A;  4HOP A;  5FHT A;  3PV2 A;  3PDZ A;  1ZOK A;  2JXO A;  2M3M A; 
#chains in the Genus database with same CATH homology
 3NFK A;  2OPG A;  3L4F D;  3KZE A;  2G2L A;  3CYY A;  1BE9 A;  1LCY A;  4KFW A;  3ID4 A;  4NNM A;  5H3J A;  2QT5 A;  3K1R A;  2JSN A;  3RL8 A;  2X7Z A;  2DC2 A;  3QO6 A;  4G69 A;  2REY A;  3ZRT A;  1N7E A;  4Q6H A;  3SHU A;  1UEQ A;  1IU0 A;  1UEW A;  2YT7 A;  1OBZ A;  1WH1 A;  1TP3 A;  2EV8 A;  1U38 A;  2KOM A;  4UU6 A;  1YBO A;  2I0I A;  1FCF A;  3GAB A;  2L97 A;  2BYG A;  3O46 A;  2KYL A;  1D5G A;  5HEB A;  3SOE A;  4L8N A;  1W9Q A;  3B76 A;  1XZ9 A;  2M0Z A;  1WF8 A;  2KOH A;  4Q2P A;  2HE2 A;  5HFF A;  3QDO A;  2VWR A;  2EDZ A;  3CBX A;  2AWU A;  5FB8 C;  4JOE A;  2OQS A;  2YUY A;  1X5N A;  3KHF A;  3CBY A;  2MX6 A;  4XHV A;  5A2P A;  3TSZ A;  4NXQ A;  1V6B A;  2EEI A;  5EZ0 A;  2JWE A;  2QBW A;  4NMV A;  5I7Z A;  2KJD A;  2JOA A;  2H3M A;  1VB7 A;  4MPA A;  4IC6 A;  2V1W A;  2PZD A;  1UIT A;  3DJA A;  1W9O A;  4JJ3 A;  3CS0 A;  2KRG A;  4LMM A;  5DTH A;  2YT8 A;  4YDP A;  2DLS A;  3I1E A;  3MH4 A;  2FN5 A;  2OMJ A;  3R0H A;  2F5Y A;  4FGM A;  3R68 A;  1X5Q A;  2IWO A;  3KDK A;  4UU5 A;  1ZUB A;  3GDV A;  4K78 A;  1UFX A;  4PQW A;  3SUZ A;  4JOR A;  3AXA A;  1Z86 A;  3VQG A;  4Q6S A;  5G1D A;  1Y7N A;  4OAJ A;  1FC7 A;  1WFV A;  3I4W A;  2I4S A;  2I04 A;  4GHN A;  3DOR A;  4F8K A;  2HGA A;  2KJK A;  1VAE A;  3HPM A;  4P0C A;  3OU0 A;  2DMZ A;  2KOJ A;  1U39 A;  4Q3H A;  2QKV A;  2WL7 A;  1QAU A;  2OCS A;  2KL1 A;  3NGH A;  2CSS A;  1FC6 A;  1WIF A;  2EGK A;  2EGN A;  2P3W A;  5HEY A;  4NNL A;  5E1Y A;  2CSJ A;  5GND A;  1VCW A;  1I16 A;  3TSV A;  2EAQ A;  2AWX A;  5HFB A;  3STJ A;  5JXB A;  5ILB A;  2Q3G A;  2EHR A;  5F3X A;  3QE1 A;  2AIN A;  4OEP A;  1WFG A;  1QAV B;  3ID1 A;  2D8I A;  2PNT A;  4P2A B;  4WYU A;  2ENO A;  1K32 A;  1UM7 A;  2FNE A;  1NTE A;  3ID2 A;  3GSL A;  1SOT A;  2KV8 A;  2K20 A;  2DJT A;  1OBY A;  3HVQ C;  1RGW A;  3RL7 A;  3GJ9 A;  1V1T A;  2G5M B;  3EGG C;  1RY4 A;  2EEJ A;  2DAZ A;  1UEZ A;  1VJ6 A;  2GEF A;  2K1Z A;  4HOP B;  1WHA A;  4NMT A;  2UZC A;  1N6F A;  3DIW A;  2DB5 A;  3QJM A;  2VSP A;  5G1E A;  1GQ4 A;  2L4S A;  3MH6 A;  1SOZ A;  2PDZ A;  2KAW A;  1UJU A;  3TSW A;  3QIK A;  4JL7 A;  3LNX A;  4GVD A;  1M5Z A;  4N6X A;  2EEG A;  2KBS A;  3O5N A;  3E17 A;  5EYZ A;  4E35 A;  4JOH A;  2OGP A;  1X5R A;  2ZPL A;  2QKT A;  2RRM A;  3PV5 A;  3PDV A;  4NMS A;  5E11 A;  1L6O A;  1WHD A;  1I92 A;  3DJ3 A;  1KEF A;  4JOF A;  1WG6 A;  2OZF A;  2HE4 A;  1N7F A;  3SFJ A;  2RCZ A;  1BFE A;  1Q3O A;  2M0V A;  1RGR A;  2IWN A;  2PA1 A;  3RLE A;  3NFL A;  1MFG A;  3ID3 A;  4NXR A;  2CS5 A;  2LC7 A;  5HED A;  3GCO A;  2KQF A;  1U3B A;  3GDU A;  3VQF A;  1B8Q A;  4REY A;  3QGL A;  4E3B A;  1U37 A;  2DKR A;  2KA9 A;  2Z17 A;  1G9O A;  4WYT A;  1R6J A;  1TQ3 A;  2EEH A;  5E6P B;  4Q2Q A;  1N99 A;  2DM8 A;  4EDJ A;  4JOK A;  1W9E A;  1TE0 A;  5F67 A;  2QKU A;  5D13 A;  1WI2 A;  1V5Q A;  2W7R A;  2M0U A;  2H3L A;  3K82 A;  3CBZ A;  1RZX A;  4Z8J A;  5HDY A;  4JJ0 A;  2D92 A;  2I0L A;  1Q7X A;  1UF1 A;  2EGO A;  3CH8 A;  2EDV A;  3FY5 A;  2GZV A;  1Y8T A;  3QJN A;  4NXP A;  1PDR A;  2FE5 A;  5HJ1 A;  2JIN A;  3DJ1 A;  1P1D A;  4H11 A;  4NMP A;  1IHJ A;  4JOG A;  2VPH A;  3K50 A;  4NMR A;  1OBX A;  1NF3 C;  3NCV A;  1N7T A;  2IWQ A;  1IU2 A;  1WJL A;  2JIL A;  3I18 A;  2KJP A;  2PKT A;  2L4T A;  2AWW A;  5E21 A;  4YYX A;  2H2B A;  2EXG A;  2JIK A;  2W4F A;  1WI4 A;  4Q2N A;  5HF4 A;  3HPK A;  1V62 A;  5B42 A;  2JRE A;  2OS6 A;  2V90 A;  2MHO A;  1P1E A;  3CC0 A;  3TMH A;  4RI0 A;  2Z9I A;  2I1N A;  2ZPM A;  5E22 A;  3BPU A;  3LNY A;  2R3Y A;  4R2Z A;  1TP5 A;  1X45 A;  4Z33 A;  2LA8 A;  4E34 A;  5HFD A;  4O06 A;  4AMH A;  4K75 A;  2LC6 A;  2F0A A;  5HFE A;  3KDG A;  2FCF A;  4KFV A;  1WF7 A;  1Q3P A;  4K72 A;  1KWA A;  1X8S A;  3GCN A;  2VSV A;  3KZD A;  1V5L A;  4OEO A;  2KPL A;  3MH7 A;  4NMQ A;  3SHW A;  1UM1 A;  2EDP A;  1X9Z A;  1UEP A;  3WKM A;  1UHP A;  2H2C A;  4JOJ A;  3PS4 A;  2M10 A;  1KY9 A;  3GDS A;  5HF1 A;  1MC7 A;  1X6D A;  1N6E A;  4K76 A;  1UJV A;  4FLN A;  2R4H A;  2I6V A;  2OSG A;  1MFL A;  1Z87 A;  5HET A;  2LUI A;  4NMO A;  5HFC A;  2YUB A;  3R69 A;  2QG1 A;  1T2M A;  2KPK A;  2PKU A;  2M0T A;  2LOB A;  2KG2 A;  2Q9V A;  2D90 A;  1FC9 A;  1UJD A;  1GQ5 A;  2E7K A;  2VZ5 A;  5B6L A;  2YTW A;  1QAV A;  2IWP A;  2O2T A;  3OTP A;  1OZI A;  3GGE A;  3PV4 A;  5IL9 A;  1N6D A;  4Q2O A;  3EGH C;  1VA8 A;  4JOP A;  2DLU A;  1QLC A;  3JXT A;  2EJY A;  4K6Y A;  1GM1 A;  2VRF A;  4GVC A;  3WKL A;  5GLJ A;  4HOP A;  5FHT A;  3PV2 A;  3PDZ A;  1ZOK A;  2JXO A;  2M3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...