5B42A

Crystal structure of the c-terminal endonuclease domain of aquifex aeolicus mutl.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
KPTYEILGQMDETFILVKDSEYLYFVDQHLLEERINYEKLKDENLACRISVKAGQKLSEEKIRELIKTWRNLENPHVCPHGRPIYYKIPLREIYEKVGRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein MutL
publication title Structural Features and Functional Dependency on beta-Clamp Define Distinct Subfamilies of Bacterial Mismatch Repair Endonuclease MutL
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Dna binding protein
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08676 MutL_C MutL C terminal dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.20 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5b42A00
3GABA 3KDKA 3KDGA 5B42A 1X9ZA 3NCVA
chains in the Genus database with same CATH superfamily
2JWEA 1X5NA 4WYUA 4EDJA 2AWUA 1M5ZA 2PKUA 5HFCA 4P0CA 2FE5A 5HF4A 2M0UA 2OS6A 1N7EA 2KJKA 1Y8TA 4NXPA 2DKRA 2LC6A 1UEZA 2KOHA 1WG6A 2CSJA 1ZOKA 3QO6A 1MFGA 2IWPA 1BE9A 1UEPA 1I16A 2Z9IA 1WI4A 3HVQC 1VA8A 2LOBA 2VSPA 2DJTA 1WIFA 2OQSA 3PDZA 2H2CA 2RRMA 4JOEA 3DJAA 3TSVA 5FB8C 1PDRA 2P3WA 1UITA 4NMRA 4K6YA 2OPGA 2L4SA 1D5GA 4GVCA 2UZCA 3WKMA 1TP5A 2I04A 2JINA 2QBWA 2OCSA 4Q2NA 1QLCA 3QGLA 1L6OA 4Z8JA 2EAQA 5HDYA 1OBXA 3CYYA 1X8SA 2QG1A 4JOKA 1V6BA 3KDKA 4Z33A 2ZPMA 1FC6A 4Q6HA 2Z17A 2FN5A 4E35A 1LCYA 1QAVA 2QKUA 3MH4A 1W9OA 2REYA 1MC7A 2DAZA 5HEDA 2VRFA 1KEFA 4L8NA 5D13A 4KFVA 1GM1A 1UM1A 2JILA 3DIWA 3QJMA 4K72A 2YUYA 1N6EA 1UM7A 2VPHA 1TQ3A 1WH1A 1WF8A 3CS0A 4HOPB 4MPAA 1N7FA 1OZIA 3GDSA 2KPKA 3EGHC 1W9QA 2Q9VA 4N6XA 3QIKA 4NMTA 1FC7A 2X7ZA 4K78A 5E21A 5I7ZA 3HPKA 1R6JA 1UEWA 2R3YA 2KL1A 2D92A 4OAJA 3SHWA 2M3MA 4F8KA 4LMMA 3TSWA 2PZDA 2PDZA 4G69A 2KQFA 4NNMA 2OGPA 4Q2QA 3K1RA 2EHRA 1X6DA 1XZ9A 2OMJA 2K20A 2E7KA 2EEJA 3KHFA 4PQWA 4OEOA 5E6PB 4AMHA 3CBXA 3EGGC 2EEHA 4UU5A 2V90A 4NMQA 2KOJA 4KFWA 1IHJA 2AINA 2EV8A 2V1WA 1V5QA 3L4FD 4FLNA 3TMHA 3DJ1A 5HF1A 2I6VA 1X45A 2WL7A 2K1ZA 4JL7A 3SFJA 5HFEA 1I92A 4YYXA 3RLEA 4GHNA 3VQGA 2JXOA 4K75A 3RL8A 1QAVB 4JJ0A 1N7TA 1QAUA 4JOFA 1U39A 3K82A 2PA1A 4Q2OA 2R4HA 4WYTA 2GEFA 1TE0A 1OBYA 2QT5A 1RGRA 2EXGA 1VJ6A 3OTPA 3SUZA 2JOAA 3JXTA 2EEGA 2DB5A 4IC6A 2H3LA 2I1NA 4JOHA 3CC0A 3CBYA 3GJ9A 1SOZA 1YBOA 2VWRA 1VCWA 2OSGA 2H2BA 2KV8A 2HE4A 3B76A 3ZRTA 2G5MB 2F0AA 1KWAA 2M0ZA 2YT8A 3GDVA 1X9ZA 2M0TA 3LNYA 2EGOA 3GCNA 3NGHA 5HFFA 2D90A 3MH6A 1FCFA 1Q3PA 2MX6A 2FNEA 2IWNA 1SOTA 5GNDA 3OU0A 3RL7A 1BFEA 2EGNA 3TSZA 1U3BA 1Z86A 3MH7A 1RZXA 3GDUA 2EDZA 1GQ5A 1RGWA 2PNTA 5HFDA 4P2AB 4GVDA 1RY4A 5HETA 1U37A 1Z87A 1IU0A 3CH8A 3E17A 1NTEA 1UF1A 1K32A 2KAWA 3QDOA 5B42A 5EZ0A 2PKTA 3BPUA 4Q3HA 3GABA 4JOGA 2KOMA 4E34A 3GSLA 2JIKA 2EJYA 1N6FA 5DTHA 2CS5A 5HJ1A 2BYGA 2IWOA 4K76A 4JORA 5F3XA 2KJPA 2VSVA 5E11A 5G1DA 1Q3OA 3ID4A 5HEBA 2I0IA 4Q2PA 5B6LA 3PV2A 3NFLA 3AXAA 4UU6A 3ID1A 5E22A 1X5QA 4XHVA 1WFVA 1UEQA 3WKLA 2ENOA 1WI2A 2L4TA 3SHUA 2I4SA 2DC2A 2ZPLA 4FGMA 3KZEA 4HOPA 2W4FA 3O5NA 3GGEA 3FY5A 2OZFA 2LC7A 1TP3A 1B8QA 4JOPA 5FHTA 1UFXA 1Y7NA 1UJUA 2KPLA 3I18A 3PV5A 1N6DA 1U38A 4NNLA 2KBSA 3QE1A 2DLUA 2QKTA 3VQFA 2O2TA 2GZVA 1G9OA 1N99A 3I4WA 1UJDA 1WFGA 4R2ZA 2KG2A 4NMOA 2D8IA 4RI0A 1V62A 3DJ3A 1P1EA 2EEIA 3DORA 5E1YA 4Q6SA 1P1DA 3PV4A 2RCZA 2HGAA 5HFBA 1T2MA 2DMZA 2IWQA 4NXQA 4REYA 1ZUBA 3SOEA 2LUIA 3O46A 2AWXA 5EYZA 2FCFA 1MFLA 1VB7A 1V5LA 1WHDA 3KZDA 4H11A 2KYLA 1V1TA 3R68A 1IU2A 3NCVA 2F5YA 3HPMA 3STJA 5IL9A 4NMSA 2EDVA 3ID2A 2MHOA 1X5RA 5GLJA 3PS4A 2LA8A 4NMPA 2AWWA 4NXRA 2M10A 3PDVA 5G1EA 1UJVA 2YUBA 4JOJA 2I0LA 1WJLA 1Q7XA 2YTWA 1WF7A 1WHAA 2H3MA 3GCOA 1UHPA 4YDPA 5H3JA 4NMVA 2YT7A 3NFKA 2EGKA 5JXBA 2Q3GA 5HEYA 2KJDA 2JSNA 5A2PA 2EDPA 2DM8A 2CSSA 1NF3C 3I1EA 2M0VA 1VAEA 2KRGA 1FC9A 2JREA 3ID3A 1W9EA 2KA9A 1OBZA 1GQ4A 2L97A 2QKVA 2G2LA 5ILBA 2DLSA 3R69A 3CBZA 4JJ3A 4O06A 3R0HA 3QJNA 1KY9A 2W7RA 3K50A 3KDGA 4OEPA 4E3BA 3LNXA 2VZ5A 2HE2A 5F67A
chains in the Genus database with same CATH topology
2JWEA 1X5NA 4WYUA 4EDJA 2AWUA 1M5ZA 2PKUA 5HFCA 4P0CA 2FE5A 5HF4A 2M0UA 2OS6A 1N7EA 2KJKA 1Y8TA 4NXPA 2DKRA 2LC6A 1UEZA 2KOHA 1WG6A 2CSJA 1ZOKA 3QO6A 1MFGA 2IWPA 1BE9A 1UEPA 1I16A 2Z9IA 1WI4A 3HVQC 1VA8A 2LOBA 2VSPA 2DJTA 1WIFA 2OQSA 3PDZA 2H2CA 2RRMA 4JOEA 3DJAA 3TSVA 5FB8C 1PDRA 2P3WA 1UITA 4NMRA 4K6YA 2OPGA 2L4SA 1D5GA 4GVCA 2UZCA 3WKMA 1TP5A 2I04A 2JINA 2QBWA 2OCSA 4Q2NA 1QLCA 3QGLA 1L6OA 4Z8JA 2EAQA 5HDYA 1OBXA 3CYYA 1X8SA 2QG1A 4JOKA 1V6BA 3KDKA 4Z33A 2ZPMA 1FC6A 4Q6HA 2Z17A 2FN5A 4E35A 1LCYA 1QAVA 2QKUA 3MH4A 1W9OA 2REYA 1MC7A 2DAZA 5HEDA 2VRFA 1KEFA 4L8NA 5D13A 4KFVA 1GM1A 1UM1A 2JILA 3DIWA 3QJMA 4K72A 2YUYA 1N6EA 1UM7A 2VPHA 1TQ3A 1WH1A 1WF8A 3CS0A 4HOPB 4MPAA 1N7FA 1OZIA 3GDSA 2KPKA 3EGHC 1W9QA 2Q9VA 4N6XA 3QIKA 4NMTA 1FC7A 2X7ZA 4K78A 5E21A 5I7ZA 3HPKA 1R6JA 1UEWA 2R3YA 2KL1A 2D92A 4OAJA 3SHWA 2M3MA 4F8KA 4LMMA 3TSWA 2PZDA 2PDZA 4G69A 2KQFA 4NNMA 2OGPA 4Q2QA 3K1RA 2EHRA 1X6DA 1XZ9A 2OMJA 2K20A 2E7KA 2EEJA 3KHFA 4PQWA 4OEOA 5E6PB 4AMHA 3CBXA 3EGGC 2EEHA 4UU5A 2V90A 4NMQA 2KOJA 4KFWA 1IHJA 2AINA 2EV8A 2V1WA 1V5QA 3L4FD 4FLNA 3TMHA 3DJ1A 5HF1A 2I6VA 1X45A 2WL7A 2K1ZA 4JL7A 3SFJA 5HFEA 1I92A 4YYXA 3RLEA 4GHNA 3VQGA 2JXOA 4K75A 3RL8A 1QAVB 4JJ0A 1N7TA 1QAUA 4JOFA 1U39A 3K82A 2PA1A 4Q2OA 2R4HA 4WYTA 2GEFA 1TE0A 1OBYA 2QT5A 1RGRA 2EXGA 1VJ6A 3OTPA 3SUZA 2JOAA 3JXTA 2EEGA 2DB5A 4IC6A 2H3LA 2I1NA 4JOHA 3CC0A 3CBYA 3GJ9A 1SOZA 1YBOA 2VWRA 1VCWA 2OSGA 2H2BA 2KV8A 2HE4A 3B76A 3ZRTA 2G5MB 2F0AA 1KWAA 2M0ZA 2YT8A 3GDVA 1X9ZA 2M0TA 3LNYA 2EGOA 3GCNA 3NGHA 5HFFA 2D90A 3MH6A 1FCFA 1Q3PA 2MX6A 2FNEA 2IWNA 1SOTA 5GNDA 3OU0A 3RL7A 1BFEA 2EGNA 3TSZA 1U3BA 1Z86A 3MH7A 1RZXA 3GDUA 2EDZA 1GQ5A 1RGWA 2PNTA 5HFDA 4P2AB 4GVDA 1RY4A 5HETA 1U37A 1Z87A 1IU0A 3CH8A 3E17A 1NTEA 1UF1A 1K32A 2KAWA 3QDOA 5B42A 5EZ0A 2PKTA 3BPUA 4Q3HA 3GABA 4JOGA 2KOMA 4E34A 3GSLA 2JIKA 2EJYA 1N6FA 5DTHA 2CS5A 5HJ1A 2BYGA 2IWOA 4K76A 4JORA 5F3XA 2KJPA 2VSVA 5E11A 5G1DA 1Q3OA 3ID4A 5HEBA 2I0IA 4Q2PA 5B6LA 3PV2A 3NFLA 3AXAA 4UU6A 3ID1A 5E22A 1X5QA 4XHVA 1WFVA 1UEQA 3WKLA 2ENOA 1WI2A 2L4TA 3SHUA 2I4SA 2DC2A 2ZPLA 4FGMA 3KZEA 4HOPA 2W4FA 3O5NA 3GGEA 3FY5A 2OZFA 2LC7A 1TP3A 1B8QA 4JOPA 5FHTA 1UFXA 1Y7NA 1UJUA 2KPLA 3I18A 3PV5A 1N6DA 1U38A 4NNLA 2KBSA 3QE1A 2DLUA 2QKTA 3VQFA 2O2TA 2GZVA 1G9OA 1N99A 3I4WA 1UJDA 1WFGA 4R2ZA 2KG2A 4NMOA 2D8IA 4RI0A 1V62A 3DJ3A 1P1EA 2EEIA 3DORA 5E1YA 4Q6SA 1P1DA 3PV4A 2RCZA 2HGAA 5HFBA 1T2MA 2DMZA 2IWQA 4NXQA 4REYA 1ZUBA 3SOEA 2LUIA 3O46A 2AWXA 5EYZA 2FCFA 1MFLA 1VB7A 1V5LA 1WHDA 3KZDA 4H11A 2KYLA 1V1TA 3R68A 1IU2A 3NCVA 2F5YA 3HPMA 3STJA 5IL9A 4NMSA 2EDVA 3ID2A 2MHOA 1X5RA 5GLJA 3PS4A 2LA8A 4NMPA 2AWWA 4NXRA 2M10A 3PDVA 5G1EA 1UJVA 2YUBA 4JOJA 2I0LA 1WJLA 1Q7XA 2YTWA 1WF7A 1WHAA 2H3MA 3GCOA 1UHPA 4YDPA 5H3JA 4NMVA 2YT7A 3NFKA 2EGKA 5JXBA 2Q3GA 5HEYA 2KJDA 2JSNA 5A2PA 2EDPA 2DM8A 2CSSA 1NF3C 3I1EA 2M0VA 1VAEA 2KRGA 1FC9A 2JREA 3ID3A 1W9EA 2KA9A 1OBZA 1GQ4A 2L97A 2QKVA 2G2LA 5ILBA 2DLSA 3R69A 3CBZA 4JJ3A 4O06A 3R0HA 3QJNA 1KY9A 2W7RA 3K50A 3KDGA 4OEPA 4E3BA 3LNXA 2VZ5A 2HE2A 5F67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GAB A;  3KDK A;  3KDG A;  5B42 A;  1X9Z A;  3NCV A; 
#chains in the Genus database with same CATH topology
 2JWE A;  1X5N A;  4WYU A;  4EDJ A;  2AWU A;  1M5Z A;  2PKU A;  5HFC A;  4P0C A;  2FE5 A;  5HF4 A;  2M0U A;  2OS6 A;  1N7E A;  2KJK A;  1Y8T A;  4NXP A;  2DKR A;  2LC6 A;  1UEZ A;  2KOH A;  1WG6 A;  2CSJ A;  1ZOK A;  3QO6 A;  1MFG A;  2IWP A;  1BE9 A;  1UEP A;  1I16 A;  2Z9I A;  1WI4 A;  3HVQ C;  1VA8 A;  2LOB A;  2VSP A;  2DJT A;  1WIF A;  2OQS A;  3PDZ A;  2H2C A;  2RRM A;  4JOE A;  3DJA A;  3TSV A;  5FB8 C;  1PDR A;  2P3W A;  1UIT A;  4NMR A;  4K6Y A;  2OPG A;  2L4S A;  1D5G A;  4GVC A;  2UZC A;  3WKM A;  1TP5 A;  2I04 A;  2JIN A;  2QBW A;  2OCS A;  4Q2N A;  1QLC A;  3QGL A;  1L6O A;  4Z8J A;  2EAQ A;  5HDY A;  1OBX A;  3CYY A;  1X8S A;  2QG1 A;  4JOK A;  1V6B A;  3KDK A;  4Z33 A;  2ZPM A;  1FC6 A;  4Q6H A;  2Z17 A;  2FN5 A;  4E35 A;  1LCY A;  1QAV A;  2QKU A;  3MH4 A;  1W9O A;  2REY A;  1MC7 A;  2DAZ A;  5HED A;  2VRF A;  1KEF A;  4L8N A;  5D13 A;  4KFV A;  1GM1 A;  1UM1 A;  2JIL A;  3DIW A;  3QJM A;  4K72 A;  2YUY A;  1N6E A;  1UM7 A;  2VPH A;  1TQ3 A;  1WH1 A;  1WF8 A;  3CS0 A;  4HOP B;  4MPA A;  1N7F A;  1OZI A;  3GDS A;  2KPK A;  3EGH C;  1W9Q A;  2Q9V A;  4N6X A;  3QIK A;  4NMT A;  1FC7 A;  2X7Z A;  4K78 A;  5E21 A;  5I7Z A;  3HPK A;  1R6J A;  1UEW A;  2R3Y A;  2KL1 A;  2D92 A;  4OAJ A;  3SHW A;  2M3M A;  4F8K A;  4LMM A;  3TSW A;  2PZD A;  2PDZ A;  4G69 A;  2KQF A;  4NNM A;  2OGP A;  4Q2Q A;  3K1R A;  2EHR A;  1X6D A;  1XZ9 A;  2OMJ A;  2K20 A;  2E7K A;  2EEJ A;  3KHF A;  4PQW A;  4OEO A;  5E6P B;  4AMH A;  3CBX A;  3EGG C;  2EEH A;  4UU5 A;  2V90 A;  4NMQ A;  2KOJ A;  4KFW A;  1IHJ A;  2AIN A;  2EV8 A;  2V1W A;  1V5Q A;  3L4F D;  4FLN A;  3TMH A;  3DJ1 A;  5HF1 A;  2I6V A;  1X45 A;  2WL7 A;  2K1Z A;  4JL7 A;  3SFJ A;  5HFE A;  1I92 A;  4YYX A;  3RLE A;  4GHN A;  3VQG A;  2JXO A;  4K75 A;  3RL8 A;  1QAV B;  4JJ0 A;  1N7T A;  1QAU A;  4JOF A;  1U39 A;  3K82 A;  2PA1 A;  4Q2O A;  2R4H A;  4WYT A;  2GEF A;  1TE0 A;  1OBY A;  2QT5 A;  1RGR A;  2EXG A;  1VJ6 A;  3OTP A;  3SUZ A;  2JOA A;  3JXT A;  2EEG A;  2DB5 A;  4IC6 A;  2H3L A;  2I1N A;  4JOH A;  3CC0 A;  3CBY A;  3GJ9 A;  1SOZ A;  1YBO A;  2VWR A;  1VCW A;  2OSG A;  2H2B A;  2KV8 A;  2HE4 A;  3B76 A;  3ZRT A;  2G5M B;  2F0A A;  1KWA A;  2M0Z A;  2YT8 A;  3GDV A;  1X9Z A;  2M0T A;  3LNY A;  2EGO A;  3GCN A;  3NGH A;  5HFF A;  2D90 A;  3MH6 A;  1FCF A;  1Q3P A;  2MX6 A;  2FNE A;  2IWN A;  1SOT A;  5GND A;  3OU0 A;  3RL7 A;  1BFE A;  2EGN A;  3TSZ A;  1U3B A;  1Z86 A;  3MH7 A;  1RZX A;  3GDU A;  2EDZ A;  1GQ5 A;  1RGW A;  2PNT A;  5HFD A;  4P2A B;  4GVD A;  1RY4 A;  5HET A;  1U37 A;  1Z87 A;  1IU0 A;  3CH8 A;  3E17 A;  1NTE A;  1UF1 A;  1K32 A;  2KAW A;  3QDO A;  5B42 A;  5EZ0 A;  2PKT A;  3BPU A;  4Q3H A;  3GAB A;  4JOG A;  2KOM A;  4E34 A;  3GSL A;  2JIK A;  2EJY A;  1N6F A;  5DTH A;  2CS5 A;  5HJ1 A;  2BYG A;  2IWO A;  4K76 A;  4JOR A;  5F3X A;  2KJP A;  2VSV A;  5E11 A;  5G1D A;  1Q3O A;  3ID4 A;  5HEB A;  2I0I A;  4Q2P A;  5B6L A;  3PV2 A;  3NFL A;  3AXA A;  4UU6 A;  3ID1 A;  5E22 A;  1X5Q A;  4XHV A;  1WFV A;  1UEQ A;  3WKL A;  2ENO A;  1WI2 A;  2L4T A;  3SHU A;  2I4S A;  2DC2 A;  2ZPL A;  4FGM A;  3KZE A;  4HOP A;  2W4F A;  3O5N A;  3GGE A;  3FY5 A;  2OZF A;  2LC7 A;  1TP3 A;  1B8Q A;  4JOP A;  5FHT A;  1UFX A;  1Y7N A;  1UJU A;  2KPL A;  3I18 A;  3PV5 A;  1N6D A;  1U38 A;  4NNL A;  2KBS A;  3QE1 A;  2DLU A;  2QKT A;  3VQF A;  2O2T A;  2GZV A;  1G9O A;  1N99 A;  3I4W A;  1UJD A;  1WFG A;  4R2Z A;  2KG2 A;  4NMO A;  2D8I A;  4RI0 A;  1V62 A;  3DJ3 A;  1P1E A;  2EEI A;  3DOR A;  5E1Y A;  4Q6S A;  1P1D A;  3PV4 A;  2RCZ A;  2HGA A;  5HFB A;  1T2M A;  2DMZ A;  2IWQ A;  4NXQ A;  4REY A;  1ZUB A;  3SOE A;  2LUI A;  3O46 A;  2AWX A;  5EYZ A;  2FCF A;  1MFL A;  1VB7 A;  1V5L A;  1WHD A;  3KZD A;  4H11 A;  2KYL A;  1V1T A;  3R68 A;  1IU2 A;  3NCV A;  2F5Y A;  3HPM A;  3STJ A;  5IL9 A;  4NMS A;  2EDV A;  3ID2 A;  2MHO A;  1X5R A;  5GLJ A;  3PS4 A;  2LA8 A;  4NMP A;  2AWW A;  4NXR A;  2M10 A;  3PDV A;  5G1E A;  1UJV A;  2YUB A;  4JOJ A;  2I0L A;  1WJL A;  1Q7X A;  2YTW A;  1WF7 A;  1WHA A;  2H3M A;  3GCO A;  1UHP A;  4YDP A;  5H3J A;  4NMV A;  2YT7 A;  3NFK A;  2EGK A;  5JXB A;  2Q3G A;  5HEY A;  2KJD A;  2JSN A;  5A2P A;  2EDP A;  2DM8 A;  2CSS A;  1NF3 C;  3I1E A;  2M0V A;  1VAE A;  2KRG A;  1FC9 A;  2JRE A;  3ID3 A;  1W9E A;  2KA9 A;  1OBZ A;  1GQ4 A;  2L97 A;  2QKV A;  2G2L A;  5ILB A;  2DLS A;  3R69 A;  3CBZ A;  4JJ3 A;  4O06 A;  3R0H A;  3QJN A;  1KY9 A;  2W7R A;  3K50 A;  3KDG A;  4OEP A;  4E3B A;  3LNX A;  2VZ5 A;  2HE2 A;  5F67 A; 
#chains in the Genus database with same CATH homology
 2JWE A;  1X5N A;  4WYU A;  4EDJ A;  2AWU A;  1M5Z A;  2PKU A;  5HFC A;  4P0C A;  2FE5 A;  5HF4 A;  2M0U A;  2OS6 A;  1N7E A;  2KJK A;  1Y8T A;  4NXP A;  2DKR A;  2LC6 A;  1UEZ A;  2KOH A;  1WG6 A;  2CSJ A;  1ZOK A;  3QO6 A;  1MFG A;  2IWP A;  1BE9 A;  1UEP A;  1I16 A;  2Z9I A;  1WI4 A;  3HVQ C;  1VA8 A;  2LOB A;  2VSP A;  2DJT A;  1WIF A;  2OQS A;  3PDZ A;  2H2C A;  2RRM A;  4JOE A;  3DJA A;  3TSV A;  5FB8 C;  1PDR A;  2P3W A;  1UIT A;  4NMR A;  4K6Y A;  2OPG A;  2L4S A;  1D5G A;  4GVC A;  2UZC A;  3WKM A;  1TP5 A;  2I04 A;  2JIN A;  2QBW A;  2OCS A;  4Q2N A;  1QLC A;  3QGL A;  1L6O A;  4Z8J A;  2EAQ A;  5HDY A;  1OBX A;  3CYY A;  1X8S A;  2QG1 A;  4JOK A;  1V6B A;  3KDK A;  4Z33 A;  2ZPM A;  1FC6 A;  4Q6H A;  2Z17 A;  2FN5 A;  4E35 A;  1LCY A;  1QAV A;  2QKU A;  3MH4 A;  1W9O A;  2REY A;  1MC7 A;  2DAZ A;  5HED A;  2VRF A;  1KEF A;  4L8N A;  5D13 A;  4KFV A;  1GM1 A;  1UM1 A;  2JIL A;  3DIW A;  3QJM A;  4K72 A;  2YUY A;  1N6E A;  1UM7 A;  2VPH A;  1TQ3 A;  1WH1 A;  1WF8 A;  3CS0 A;  4HOP B;  4MPA A;  1N7F A;  1OZI A;  3GDS A;  2KPK A;  3EGH C;  1W9Q A;  2Q9V A;  4N6X A;  3QIK A;  4NMT A;  1FC7 A;  2X7Z A;  4K78 A;  5E21 A;  5I7Z A;  3HPK A;  1R6J A;  1UEW A;  2R3Y A;  2KL1 A;  2D92 A;  4OAJ A;  3SHW A;  2M3M A;  4F8K A;  4LMM A;  3TSW A;  2PZD A;  2PDZ A;  4G69 A;  2KQF A;  4NNM A;  2OGP A;  4Q2Q A;  3K1R A;  2EHR A;  1X6D A;  1XZ9 A;  2OMJ A;  2K20 A;  2E7K A;  2EEJ A;  3KHF A;  4PQW A;  4OEO A;  5E6P B;  4AMH A;  3CBX A;  3EGG C;  2EEH A;  4UU5 A;  2V90 A;  4NMQ A;  2KOJ A;  4KFW A;  1IHJ A;  2AIN A;  2EV8 A;  2V1W A;  1V5Q A;  3L4F D;  4FLN A;  3TMH A;  3DJ1 A;  5HF1 A;  2I6V A;  1X45 A;  2WL7 A;  2K1Z A;  4JL7 A;  3SFJ A;  5HFE A;  1I92 A;  4YYX A;  3RLE A;  4GHN A;  3VQG A;  2JXO A;  4K75 A;  3RL8 A;  1QAV B;  4JJ0 A;  1N7T A;  1QAU A;  4JOF A;  1U39 A;  3K82 A;  2PA1 A;  4Q2O A;  2R4H A;  4WYT A;  2GEF A;  1TE0 A;  1OBY A;  2QT5 A;  1RGR A;  2EXG A;  1VJ6 A;  3OTP A;  3SUZ A;  2JOA A;  3JXT A;  2EEG A;  2DB5 A;  4IC6 A;  2H3L A;  2I1N A;  4JOH A;  3CC0 A;  3CBY A;  3GJ9 A;  1SOZ A;  1YBO A;  2VWR A;  1VCW A;  2OSG A;  2H2B A;  2KV8 A;  2HE4 A;  3B76 A;  3ZRT A;  2G5M B;  2F0A A;  1KWA A;  2M0Z A;  2YT8 A;  3GDV A;  1X9Z A;  2M0T A;  3LNY A;  2EGO A;  3GCN A;  3NGH A;  5HFF A;  2D90 A;  3MH6 A;  1FCF A;  1Q3P A;  2MX6 A;  2FNE A;  2IWN A;  1SOT A;  5GND A;  3OU0 A;  3RL7 A;  1BFE A;  2EGN A;  3TSZ A;  1U3B A;  1Z86 A;  3MH7 A;  1RZX A;  3GDU A;  2EDZ A;  1GQ5 A;  1RGW A;  2PNT A;  5HFD A;  4P2A B;  4GVD A;  1RY4 A;  5HET A;  1U37 A;  1Z87 A;  1IU0 A;  3CH8 A;  3E17 A;  1NTE A;  1UF1 A;  1K32 A;  2KAW A;  3QDO A;  5B42 A;  5EZ0 A;  2PKT A;  3BPU A;  4Q3H A;  3GAB A;  4JOG A;  2KOM A;  4E34 A;  3GSL A;  2JIK A;  2EJY A;  1N6F A;  5DTH A;  2CS5 A;  5HJ1 A;  2BYG A;  2IWO A;  4K76 A;  4JOR A;  5F3X A;  2KJP A;  2VSV A;  5E11 A;  5G1D A;  1Q3O A;  3ID4 A;  5HEB A;  2I0I A;  4Q2P A;  5B6L A;  3PV2 A;  3NFL A;  3AXA A;  4UU6 A;  3ID1 A;  5E22 A;  1X5Q A;  4XHV A;  1WFV A;  1UEQ A;  3WKL A;  2ENO A;  1WI2 A;  2L4T A;  3SHU A;  2I4S A;  2DC2 A;  2ZPL A;  4FGM A;  3KZE A;  4HOP A;  2W4F A;  3O5N A;  3GGE A;  3FY5 A;  2OZF A;  2LC7 A;  1TP3 A;  1B8Q A;  4JOP A;  5FHT A;  1UFX A;  1Y7N A;  1UJU A;  2KPL A;  3I18 A;  3PV5 A;  1N6D A;  1U38 A;  4NNL A;  2KBS A;  3QE1 A;  2DLU A;  2QKT A;  3VQF A;  2O2T A;  2GZV A;  1G9O A;  1N99 A;  3I4W A;  1UJD A;  1WFG A;  4R2Z A;  2KG2 A;  4NMO A;  2D8I A;  4RI0 A;  1V62 A;  3DJ3 A;  1P1E A;  2EEI A;  3DOR A;  5E1Y A;  4Q6S A;  1P1D A;  3PV4 A;  2RCZ A;  2HGA A;  5HFB A;  1T2M A;  2DMZ A;  2IWQ A;  4NXQ A;  4REY A;  1ZUB A;  3SOE A;  2LUI A;  3O46 A;  2AWX A;  5EYZ A;  2FCF A;  1MFL A;  1VB7 A;  1V5L A;  1WHD A;  3KZD A;  4H11 A;  2KYL A;  1V1T A;  3R68 A;  1IU2 A;  3NCV A;  2F5Y A;  3HPM A;  3STJ A;  5IL9 A;  4NMS A;  2EDV A;  3ID2 A;  2MHO A;  1X5R A;  5GLJ A;  3PS4 A;  2LA8 A;  4NMP A;  2AWW A;  4NXR A;  2M10 A;  3PDV A;  5G1E A;  1UJV A;  2YUB A;  4JOJ A;  2I0L A;  1WJL A;  1Q7X A;  2YTW A;  1WF7 A;  1WHA A;  2H3M A;  3GCO A;  1UHP A;  4YDP A;  5H3J A;  4NMV A;  2YT7 A;  3NFK A;  2EGK A;  5JXB A;  2Q3G A;  5HEY A;  2KJD A;  2JSN A;  5A2P A;  2EDP A;  2DM8 A;  2CSS A;  1NF3 C;  3I1E A;  2M0V A;  1VAE A;  2KRG A;  1FC9 A;  2JRE A;  3ID3 A;  1W9E A;  2KA9 A;  1OBZ A;  1GQ4 A;  2L97 A;  2QKV A;  2G2L A;  5ILB A;  2DLS A;  3R69 A;  3CBZ A;  4JJ3 A;  4O06 A;  3R0H A;  3QJN A;  1KY9 A;  2W7R A;  3K50 A;  3KDG A;  4OEP A;  4E3B A;  3LNX A;  2VZ5 A;  2HE2 A;  5F67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...