4UU6A

Crystal structure of the pdz domain of pals1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAGUK P55 SUBFAMILY MEMBER 5
publication title Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4uu6A00
4JOKA 1XZ9A 1TP5A 4IC6A 1VB7A 3B76A 4AMHA 4HOPA 3STJA 2EEGA 3QDOA 3MH7A 2IWNA 4NMSA 5E22A 1I16A 3PV2A 4GHNA 5FB8C 3CBXA 3MH6A 2KL1A 2DC2A 2I6VA 5HF4A 2L97A 4JOFA 1D5GA 2KAWA 2WL7A 3R68A 1WFGA 5FHTA 4JOHA 3CBYA 1VCWA 2JIKA 2QKTA 1WJLA 2P3WA 2M0ZA 2F5YA 1NF3C 4NMQA 5D13A 5HFFA 4K72A 1V5LA 2I4SA 2FN5A 5G1DA 3DJ1A 1K32A 4NMTA 1FC7A 2OGPA 1IHJA 1RY4A 2AWUA 3RL7A 3EGGC 2KV8A 1UHPA 2KJKA 3CYYA 4JOPA 2EJYA 2KPLA 4E3BA 5HEBA 2M10A 1MFGA 1P1EA 4Z8JA 2JINA 2EAQA 1UEPA 3GDSA 3KZEA 2W7RA 1VAEA 1Y8TA 1TQ3A 1P1DA 1KWAA 1UEQA 3R0HA 4FGMA 1V5QA 1M5ZA 1W9OA 1WF7A 2L4SA 3JXTA 2VSPA 1X6DA 4GVDA 3K50A 2KA9A 4O06A 2EDVA 2Q3GA 1X45A 1VJ6A 1Q3PA 1Z86A 1UEZA 2D92A 5E1YA 3AXAA 1X5RA 2LUIA 2YT8A 2YTWA 4REYA 3KZDA 1ZOKA 2VZ5A 2EGNA 2LA8A 4N6XA 2DLSA 3TSWA 2V1WA 2OCSA 4JOGA 2DB5A 2HGAA 4YYXA 3CS0A 2YUBA 2VSVA 3NGHA 1WG6A 3WKMA 2VRFA 3DJ3A 2FE5A 4EDJA 2EDPA 1WIFA 2PDZA 1NTEA 1PDRA 1VA8A 2AWWA 1IU0A 2HE2A 2PKTA 3QO6A 5GNDA 4JORA 2DJTA 2M3MA 1QAVA 3I4WA 2Z17A 1UF1A 2G2LA 4E35A 3HPKA 1YBOA 2DKRA 2JOAA 1FC6A 4NXRA 3ZRTA 5H3JA 1Y7NA 3PS4A 2H3LA 1QLCA 3RLEA 2Q9VA 2JILA 3OU0A 3OTPA 3GJ9A 4K75A 2ENOA 4PQWA 3LNYA 1U38A 4Q6SA 5GLJA 2ZPMA 4HOPB 1UJUA 2LC7A 1UJDA 5HEYA 5E6PB 2YUYA 4F8KA 3SOEA 2KJPA 1Z87A 3DJAA 2EGKA 1WI2A 2V90A 2EHRA 4RI0A 4LMMA 2GZVA 2EEIA 1N6DA 3CH8A 3LNXA 1OBYA 2KOJA 3HVQC 1GM1A 3GCNA 3HPMA 2D8IA 4NXPA 1Q3OA 2JXOA 3BPUA 4K6YA 1LCYA 3ID1A 5E11A 2Z9IA 2EGOA 4JL7A 1OZIA 4YDPA 2FNEA 3O5NA 1QAUA 1UJVA 1Q7XA 3QGLA 1UEWA 4NNLA 2PZDA 4Q2PA 2PNTA 3ID4A 1U39A 2I04A 4WYUA 2H2CA 3NFLA 2LOBA 2D90A 3CBZA 3TMHA 2QBWA 1TP3A 1R6JA 4L8NA 1BE9A 5F3XA 2QKVA 3QIKA 4R2ZA 2KOHA 1U37A 4KFVA 5HF1A 1RGWA 4Q2OA 1N6EA 3WKLA 1WFVA 2QG1A 3PV4A 2PKUA 1V62A 4NMPA 1N6FA 1B8QA 1MC7A 5HEDA 1BFEA 1UFXA 4OAJA 2KRGA 3EGHC 2QKUA 3E17A 1OBZA 5A2PA 3ID3A 1L6OA 2L4TA 1X8SA 3I18A 2OZFA 1WHDA 5HETA 4Q3HA 2H3MA 2OSGA 2KJDA 3QJNA 2LC6A 3SUZA 1MFLA 4G69A 2MHOA 3L4FD 2CSJA 2CS5A 2KPKA 1N7TA 2M0UA 1UM1A 2BYGA 4JOEA 5HDYA 2RCZA 3ID2A 4Q2QA 3RL8A 5HFEA 2OMJA 2DM8A 2R3YA 3QJMA 5HFCA 3CC0A 3K82A 2IWOA 3VQFA 3PDZA 2FCFA 1FC9A 2OQSA 2X7ZA 3KHFA 5HFBA 2REYA 2DMZA 2M0VA 4GVCA 2AWXA 1N99A 4E34A 1GQ5A 2KG2A 1V1TA 2VPHA 1QAVB 2K20A 4Z33A 3K1RA 2AINA 2IWQA 5G1EA 4OEOA 5EZ0A 5EYZA 5HFDA 4OEPA 3DIWA 3GDVA 1GQ4A 3TSZA 3GCOA 4P0CA 2W4FA 3TSVA 4H11A 1T2MA 4JOJA 4P2AB 3VQGA 1U3BA 1V6BA 2EV8A 1I92A 2UZCA 3O46A 2JREA 1X5NA 1KY9A 2I1NA 1N7EA 2KBSA 1WH1A 3I1EA 5I7ZA 1X5QA 2VWRA 4NMVA 3PDVA 2QT5A 2H2BA 3FY5A 3PV5A 1UITA 3R69A 3GSLA 3SHWA 5DTHA 4KFWA 1TE0A 3GDUA 1W9EA 2DAZA 4NXQA 4WYTA 5HJ1A 5JXBA 1W9QA 1RGRA 1WF8A 3SHUA 1SOZA 1FCFA 1G9OA 2I0LA 2OPGA 2EEJA 2OS6A 2KOMA 1UM7A 2EXGA 3SFJA 5F67A 2F0AA 4Q6HA 2G5MB 2DLUA 2RRMA 4K78A 2KQFA 4NMOA 4MPAA 4NMRA 3DORA 3GGEA 1OBXA 2HE4A 2ZPLA 4K76A 2KYLA 1KEFA 4XHVA 2M0TA 3NFKA 2K1ZA 4UU5A 2CSSA 2PA1A 1N7FA 1ZUBA 4UU6A 2EEHA 5E21A 2E7KA 4NNMA 2R4HA 2I0IA 4Q2NA 1WHAA 2O2TA 3MH4A 3QE1A 5B6LA 1SOTA 2EDZA 1RZXA 2YT7A 2IWPA 2MX6A 1WI4A 1IU2A 2JWEA
chains in the Genus database with same CATH superfamily
4JOKA 1XZ9A 1TP5A 4IC6A 1VB7A 3B76A 4AMHA 4HOPA 3STJA 2EEGA 3QDOA 3MH7A 2IWNA 4NMSA 5E22A 1I16A 3PV2A 4GHNA 5FB8C 3CBXA 3MH6A 2KL1A 2DC2A 2I6VA 5HF4A 2L97A 4JOFA 1D5GA 5IL9A 2KAWA 2WL7A 3R68A 1WFGA 5FHTA 4JOHA 3CBYA 1VCWA 2JIKA 2QKTA 1WJLA 2P3WA 2M0ZA 1X9ZA 2F5YA 1NF3C 4NMQA 5D13A 5HFFA 4K72A 1V5LA 2I4SA 2FN5A 5G1DA 3NCVA 3DJ1A 1K32A 4NMTA 1FC7A 2OGPA 1IHJA 1RY4A 2AWUA 3RL7A 3EGGC 2KV8A 1UHPA 2KJKA 3CYYA 4JOPA 2EJYA 2KPLA 4E3BA 5HEBA 2M10A 1MFGA 1P1EA 4Z8JA 2JINA 2EAQA 1UEPA 3GDSA 3KZEA 4FLNA 2W7RA 1VAEA 1Y8TA 1TQ3A 1P1DA 1KWAA 1UEQA 3R0HA 4FGMA 1V5QA 1M5ZA 1W9OA 1WF7A 2L4SA 3JXTA 2VSPA 5ILBA 1X6DA 4GVDA 3K50A 2KA9A 4O06A 2EDVA 2Q3GA 1X45A 1VJ6A 1Q3PA 1Z86A 1UEZA 2D92A 5E1YA 3AXAA 1X5RA 2LUIA 2YT8A 2YTWA 4REYA 3KZDA 1ZOKA 2VZ5A 2EGNA 3GABA 2LA8A 4N6XA 2DLSA 2JSNA 3TSWA 2V1WA 2OCSA 4JOGA 2DB5A 2HGAA 3KDKA 4YYXA 3CS0A 2YUBA 2VSVA 3NGHA 1WG6A 3WKMA 2VRFA 3DJ3A 2FE5A 4EDJA 2EDPA 1WIFA 2PDZA 1NTEA 1PDRA 1VA8A 2AWWA 1IU0A 2HE2A 2PKTA 3QO6A 5GNDA 4JORA 2DJTA 2M3MA 1QAVA 3I4WA 2Z17A 1UF1A 2G2LA 4E35A 3HPKA 1YBOA 2DKRA 2JOAA 1FC6A 4NXRA 3ZRTA 5H3JA 1Y7NA 3PS4A 2H3LA 1QLCA 3RLEA 2Q9VA 2JILA 3OU0A 3OTPA 3GJ9A 4K75A 2ENOA 4PQWA 3LNYA 1U38A 4Q6SA 5GLJA 2ZPMA 4HOPB 1UJUA 2LC7A 1UJDA 5HEYA 5E6PB 2YUYA 4F8KA 3SOEA 2KJPA 1Z87A 3DJAA 2EGKA 1WI2A 2V90A 2EHRA 4RI0A 4LMMA 2GZVA 2EEIA 1N6DA 3CH8A 3LNXA 1OBYA 2KOJA 3HVQC 1GM1A 3GCNA 3HPMA 2D8IA 4NXPA 1Q3OA 2JXOA 3BPUA 4K6YA 1LCYA 3ID1A 5E11A 2Z9IA 2EGOA 4JL7A 1OZIA 4YDPA 2FNEA 3O5NA 1QAUA 1UJVA 1Q7XA 3QGLA 1UEWA 4NNLA 2PZDA 2GEFA 4Q2PA 2PNTA 3ID4A 1U39A 2I04A 4WYUA 2H2CA 3NFLA 2LOBA 2D90A 3CBZA 3TMHA 2QBWA 1TP3A 1R6JA 4L8NA 1BE9A 5F3XA 2QKVA 3QIKA 4R2ZA 2KOHA 1U37A 4JJ0A 4KFVA 5HF1A 1RGWA 4Q2OA 1N6EA 3WKLA 1WFVA 2QG1A 3PV4A 2PKUA 1V62A 4NMPA 1N6FA 1B8QA 1MC7A 5HEDA 1BFEA 1UFXA 4OAJA 2KRGA 3EGHC 2QKUA 3E17A 1OBZA 5A2PA 3ID3A 1L6OA 2L4TA 1X8SA 3I18A 2OZFA 1WHDA 5HETA 4Q3HA 2H3MA 2OSGA 2KJDA 3QJNA 2LC6A 3SUZA 1MFLA 4G69A 2MHOA 3L4FD 2CSJA 2CS5A 2KPKA 1N7TA 2M0UA 1UM1A 2BYGA 4JOEA 5HDYA 2RCZA 3ID2A 3KDGA 4Q2QA 3RL8A 5HFEA 2OMJA 2DM8A 2R3YA 3QJMA 5HFCA 3CC0A 3K82A 2IWOA 3VQFA 3PDZA 2FCFA 1FC9A 2OQSA 2X7ZA 3KHFA 5HFBA 2REYA 2DMZA 2M0VA 4GVCA 2AWXA 1N99A 4E34A 1GQ5A 2KG2A 1V1TA 2VPHA 1QAVB 2K20A 4Z33A 5B42A 3K1RA 2AINA 2IWQA 5G1EA 4OEOA 5EZ0A 5EYZA 5HFDA 4OEPA 3DIWA 3GDVA 1GQ4A 3TSZA 3GCOA 4P0CA 2W4FA 3TSVA 4H11A 1T2MA 4JOJA 4P2AB 3VQGA 1U3BA 1V6BA 2EV8A 1I92A 2UZCA 3O46A 2JREA 1X5NA 1KY9A 2I1NA 1N7EA 2KBSA 1WH1A 3I1EA 5I7ZA 1X5QA 2VWRA 4NMVA 3PDVA 2QT5A 2H2BA 3FY5A 3PV5A 1UITA 3R69A 3GSLA 3SHWA 5DTHA 4KFWA 1TE0A 3GDUA 1W9EA 2DAZA 4NXQA 4WYTA 5HJ1A 5JXBA 1W9QA 1RGRA 1WF8A 3SHUA 1SOZA 1FCFA 1G9OA 2I0LA 2OPGA 2EEJA 2OS6A 2KOMA 1UM7A 2EXGA 3SFJA 5F67A 2F0AA 4Q6HA 2G5MB 2DLUA 2RRMA 4K78A 2KQFA 4NMOA 4MPAA 4NMRA 3DORA 3GGEA 1OBXA 2HE4A 2ZPLA 4K76A 2KYLA 1KEFA 4XHVA 2M0TA 3NFKA 2K1ZA 4UU5A 4JJ3A 2CSSA 2PA1A 1N7FA 1ZUBA 4UU6A 2EEHA 5E21A 2E7KA 4NNMA 2R4HA 2I0IA 4Q2NA 1WHAA 2O2TA 3MH4A 3QE1A 5B6LA 1SOTA 2EDZA 1RZXA 2YT7A 2IWPA 2MX6A 1WI4A 1IU2A 2JWEA
chains in the Genus database with same CATH topology
4JOKA 1XZ9A 1TP5A 4IC6A 1VB7A 3B76A 4AMHA 4HOPA 3STJA 2EEGA 3QDOA 3MH7A 2IWNA 4NMSA 5E22A 1I16A 3PV2A 4GHNA 5FB8C 3CBXA 3MH6A 2KL1A 2DC2A 2I6VA 5HF4A 2L97A 4JOFA 1D5GA 5IL9A 2KAWA 2WL7A 3R68A 1WFGA 5FHTA 4JOHA 3CBYA 1VCWA 2JIKA 2QKTA 1WJLA 2P3WA 2M0ZA 1X9ZA 2F5YA 1NF3C 4NMQA 5D13A 5HFFA 4K72A 1V5LA 2I4SA 2FN5A 5G1DA 3NCVA 3DJ1A 1K32A 4NMTA 1FC7A 2OGPA 1IHJA 1RY4A 2AWUA 3RL7A 3EGGC 2KV8A 1UHPA 2KJKA 3CYYA 4JOPA 2EJYA 2KPLA 4E3BA 5HEBA 2M10A 1MFGA 1P1EA 4Z8JA 2JINA 2EAQA 1UEPA 3GDSA 3KZEA 4FLNA 2W7RA 1VAEA 1Y8TA 1TQ3A 1P1DA 1KWAA 1UEQA 3R0HA 4FGMA 1V5QA 1M5ZA 1W9OA 1WF7A 2L4SA 3JXTA 2VSPA 5ILBA 1X6DA 4GVDA 3K50A 2KA9A 4O06A 2EDVA 2Q3GA 1X45A 1VJ6A 1Q3PA 1Z86A 1UEZA 2D92A 5E1YA 3AXAA 1X5RA 2LUIA 2YT8A 2YTWA 4REYA 3KZDA 1ZOKA 2VZ5A 2EGNA 3GABA 2LA8A 4N6XA 2DLSA 2JSNA 3TSWA 2V1WA 2OCSA 4JOGA 2DB5A 2HGAA 3KDKA 4YYXA 3CS0A 2YUBA 2VSVA 3NGHA 1WG6A 3WKMA 2VRFA 3DJ3A 2FE5A 4EDJA 2EDPA 1WIFA 2PDZA 1NTEA 1PDRA 1VA8A 2AWWA 1IU0A 2HE2A 2PKTA 3QO6A 5GNDA 4JORA 2DJTA 2M3MA 1QAVA 3I4WA 2Z17A 1UF1A 2G2LA 4E35A 3HPKA 1YBOA 2DKRA 2JOAA 1FC6A 4NXRA 3ZRTA 5H3JA 1Y7NA 3PS4A 2H3LA 1QLCA 3RLEA 2Q9VA 2JILA 3OU0A 3OTPA 3GJ9A 4K75A 2ENOA 4PQWA 3LNYA 1U38A 4Q6SA 5GLJA 2ZPMA 4HOPB 1UJUA 2LC7A 1UJDA 5HEYA 5E6PB 2YUYA 4F8KA 3SOEA 2KJPA 1Z87A 3DJAA 2EGKA 1WI2A 2V90A 2EHRA 4RI0A 4LMMA 2GZVA 2EEIA 1N6DA 3CH8A 3LNXA 1OBYA 2KOJA 3HVQC 1GM1A 3GCNA 3HPMA 2D8IA 4NXPA 1Q3OA 2JXOA 3BPUA 4K6YA 1LCYA 3ID1A 5E11A 2Z9IA 2EGOA 4JL7A 1OZIA 4YDPA 2FNEA 3O5NA 1QAUA 1UJVA 1Q7XA 3QGLA 1UEWA 4NNLA 2PZDA 2GEFA 4Q2PA 2PNTA 3ID4A 1U39A 2I04A 4WYUA 2H2CA 3NFLA 2LOBA 2D90A 3CBZA 3TMHA 2QBWA 1TP3A 1R6JA 4L8NA 1BE9A 5F3XA 2QKVA 3QIKA 4R2ZA 2KOHA 1U37A 4JJ0A 4KFVA 5HF1A 1RGWA 4Q2OA 1N6EA 3WKLA 1WFVA 2QG1A 3PV4A 2PKUA 1V62A 4NMPA 1N6FA 1B8QA 1MC7A 5HEDA 1BFEA 1UFXA 4OAJA 2KRGA 3EGHC 2QKUA 3E17A 1OBZA 5A2PA 3ID3A 1L6OA 2L4TA 1X8SA 3I18A 2OZFA 1WHDA 5HETA 4Q3HA 2H3MA 2OSGA 2KJDA 3QJNA 2LC6A 3SUZA 1MFLA 4G69A 2MHOA 3L4FD 2CSJA 2CS5A 2KPKA 1N7TA 2M0UA 1UM1A 2BYGA 4JOEA 5HDYA 2RCZA 3ID2A 3KDGA 4Q2QA 3RL8A 5HFEA 2OMJA 2DM8A 2R3YA 3QJMA 5HFCA 3CC0A 3K82A 2IWOA 3VQFA 3PDZA 2FCFA 1FC9A 2OQSA 2X7ZA 3KHFA 5HFBA 2REYA 2DMZA 2M0VA 4GVCA 2AWXA 1N99A 4E34A 1GQ5A 2KG2A 1V1TA 2VPHA 1QAVB 2K20A 4Z33A 5B42A 3K1RA 2AINA 2IWQA 5G1EA 4OEOA 5EZ0A 5EYZA 5HFDA 4OEPA 3DIWA 3GDVA 1GQ4A 3TSZA 3GCOA 4P0CA 2W4FA 3TSVA 4H11A 1T2MA 4JOJA 4P2AB 3VQGA 1U3BA 1V6BA 2EV8A 1I92A 2UZCA 3O46A 2JREA 1X5NA 1KY9A 2I1NA 1N7EA 2KBSA 1WH1A 3I1EA 5I7ZA 1X5QA 2VWRA 4NMVA 3PDVA 2QT5A 2H2BA 3FY5A 3PV5A 1UITA 3R69A 3GSLA 3SHWA 5DTHA 4KFWA 1TE0A 3GDUA 1W9EA 2DAZA 4NXQA 4WYTA 5HJ1A 5JXBA 1W9QA 1RGRA 1WF8A 3SHUA 1SOZA 1FCFA 1G9OA 2I0LA 2OPGA 2EEJA 2OS6A 2KOMA 1UM7A 2EXGA 3SFJA 5F67A 2F0AA 4Q6HA 2G5MB 2DLUA 2RRMA 4K78A 2KQFA 4NMOA 4MPAA 4NMRA 3DORA 3GGEA 1OBXA 2HE4A 2ZPLA 4K76A 2KYLA 1KEFA 4XHVA 2M0TA 3NFKA 2K1ZA 4UU5A 4JJ3A 2CSSA 2PA1A 1N7FA 1ZUBA 4UU6A 2EEHA 5E21A 2E7KA 4NNMA 2R4HA 2I0IA 4Q2NA 1WHAA 2O2TA 3MH4A 3QE1A 5B6LA 1SOTA 2EDZA 1RZXA 2YT7A 2IWPA 2MX6A 1WI4A 1IU2A 2JWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOK A;  1XZ9 A;  1TP5 A;  4IC6 A;  1VB7 A;  3B76 A;  4AMH A;  4HOP A;  3STJ A;  2EEG A;  3QDO A;  3MH7 A;  2IWN A;  4NMS A;  5E22 A;  1I16 A;  3PV2 A;  4GHN A;  5FB8 C;  3CBX A;  3MH6 A;  2KL1 A;  2DC2 A;  2I6V A;  5HF4 A;  2L97 A;  4JOF A;  1D5G A;  2KAW A;  2WL7 A;  3R68 A;  1WFG A;  5FHT A;  4JOH A;  3CBY A;  1VCW A;  2JIK A;  2QKT A;  1WJL A;  2P3W A;  2M0Z A;  2F5Y A;  1NF3 C;  4NMQ A;  5D13 A;  5HFF A;  4K72 A;  1V5L A;  2I4S A;  2FN5 A;  5G1D A;  3DJ1 A;  1K32 A;  4NMT A;  1FC7 A;  2OGP A;  1IHJ A;  1RY4 A;  2AWU A;  3RL7 A;  3EGG C;  2KV8 A;  1UHP A;  2KJK A;  3CYY A;  4JOP A;  2EJY A;  2KPL A;  4E3B A;  5HEB A;  2M10 A;  1MFG A;  1P1E A;  4Z8J A;  2JIN A;  2EAQ A;  1UEP A;  3GDS A;  3KZE A;  2W7R A;  1VAE A;  1Y8T A;  1TQ3 A;  1P1D A;  1KWA A;  1UEQ A;  3R0H A;  4FGM A;  1V5Q A;  1M5Z A;  1W9O A;  1WF7 A;  2L4S A;  3JXT A;  2VSP A;  1X6D A;  4GVD A;  3K50 A;  2KA9 A;  4O06 A;  2EDV A;  2Q3G A;  1X45 A;  1VJ6 A;  1Q3P A;  1Z86 A;  1UEZ A;  2D92 A;  5E1Y A;  3AXA A;  1X5R A;  2LUI A;  2YT8 A;  2YTW A;  4REY A;  3KZD A;  1ZOK A;  2VZ5 A;  2EGN A;  2LA8 A;  4N6X A;  2DLS A;  3TSW A;  2V1W A;  2OCS A;  4JOG A;  2DB5 A;  2HGA A;  4YYX A;  3CS0 A;  2YUB A;  2VSV A;  3NGH A;  1WG6 A;  3WKM A;  2VRF A;  3DJ3 A;  2FE5 A;  4EDJ A;  2EDP A;  1WIF A;  2PDZ A;  1NTE A;  1PDR A;  1VA8 A;  2AWW A;  1IU0 A;  2HE2 A;  2PKT A;  3QO6 A;  5GND A;  4JOR A;  2DJT A;  2M3M A;  1QAV A;  3I4W A;  2Z17 A;  1UF1 A;  2G2L A;  4E35 A;  3HPK A;  1YBO A;  2DKR A;  2JOA A;  1FC6 A;  4NXR A;  3ZRT A;  5H3J A;  1Y7N A;  3PS4 A;  2H3L A;  1QLC A;  3RLE A;  2Q9V A;  2JIL A;  3OU0 A;  3OTP A;  3GJ9 A;  4K75 A;  2ENO A;  4PQW A;  3LNY A;  1U38 A;  4Q6S A;  5GLJ A;  2ZPM A;  4HOP B;  1UJU A;  2LC7 A;  1UJD A;  5HEY A;  5E6P B;  2YUY A;  4F8K A;  3SOE A;  2KJP A;  1Z87 A;  3DJA A;  2EGK A;  1WI2 A;  2V90 A;  2EHR A;  4RI0 A;  4LMM A;  2GZV A;  2EEI A;  1N6D A;  3CH8 A;  3LNX A;  1OBY A;  2KOJ A;  3HVQ C;  1GM1 A;  3GCN A;  3HPM A;  2D8I A;  4NXP A;  1Q3O A;  2JXO A;  3BPU A;  4K6Y A;  1LCY A;  3ID1 A;  5E11 A;  2Z9I A;  2EGO A;  4JL7 A;  1OZI A;  4YDP A;  2FNE A;  3O5N A;  1QAU A;  1UJV A;  1Q7X A;  3QGL A;  1UEW A;  4NNL A;  2PZD A;  4Q2P A;  2PNT A;  3ID4 A;  1U39 A;  2I04 A;  4WYU A;  2H2C A;  3NFL A;  2LOB A;  2D90 A;  3CBZ A;  3TMH A;  2QBW A;  1TP3 A;  1R6J A;  4L8N A;  1BE9 A;  5F3X A;  2QKV A;  3QIK A;  4R2Z A;  2KOH A;  1U37 A;  4KFV A;  5HF1 A;  1RGW A;  4Q2O A;  1N6E A;  3WKL A;  1WFV A;  2QG1 A;  3PV4 A;  2PKU A;  1V62 A;  4NMP A;  1N6F A;  1B8Q A;  1MC7 A;  5HED A;  1BFE A;  1UFX A;  4OAJ A;  2KRG A;  3EGH C;  2QKU A;  3E17 A;  1OBZ A;  5A2P A;  3ID3 A;  1L6O A;  2L4T A;  1X8S A;  3I18 A;  2OZF A;  1WHD A;  5HET A;  4Q3H A;  2H3M A;  2OSG A;  2KJD A;  3QJN A;  2LC6 A;  3SUZ A;  1MFL A;  4G69 A;  2MHO A;  3L4F D;  2CSJ A;  2CS5 A;  2KPK A;  1N7T A;  2M0U A;  1UM1 A;  2BYG A;  4JOE A;  5HDY A;  2RCZ A;  3ID2 A;  4Q2Q A;  3RL8 A;  5HFE A;  2OMJ A;  2DM8 A;  2R3Y A;  3QJM A;  5HFC A;  3CC0 A;  3K82 A;  2IWO A;  3VQF A;  3PDZ A;  2FCF A;  1FC9 A;  2OQS A;  2X7Z A;  3KHF A;  5HFB A;  2REY A;  2DMZ A;  2M0V A;  4GVC A;  2AWX A;  1N99 A;  4E34 A;  1GQ5 A;  2KG2 A;  1V1T A;  2VPH A;  1QAV B;  2K20 A;  4Z33 A;  3K1R A;  2AIN A;  2IWQ A;  5G1E A;  4OEO A;  5EZ0 A;  5EYZ A;  5HFD A;  4OEP A;  3DIW A;  3GDV A;  1GQ4 A;  3TSZ A;  3GCO A;  4P0C A;  2W4F A;  3TSV A;  4H11 A;  1T2M A;  4JOJ A;  4P2A B;  3VQG A;  1U3B A;  1V6B A;  2EV8 A;  1I92 A;  2UZC A;  3O46 A;  2JRE A;  1X5N A;  1KY9 A;  2I1N A;  1N7E A;  2KBS A;  1WH1 A;  3I1E A;  5I7Z A;  1X5Q A;  2VWR A;  4NMV A;  3PDV A;  2QT5 A;  2H2B A;  3FY5 A;  3PV5 A;  1UIT A;  3R69 A;  3GSL A;  3SHW A;  5DTH A;  4KFW A;  1TE0 A;  3GDU A;  1W9E A;  2DAZ A;  4NXQ A;  4WYT A;  5HJ1 A;  5JXB A;  1W9Q A;  1RGR A;  1WF8 A;  3SHU A;  1SOZ A;  1FCF A;  1G9O A;  2I0L A;  2OPG A;  2EEJ A;  2OS6 A;  2KOM A;  1UM7 A;  2EXG A;  3SFJ A;  5F67 A;  2F0A A;  4Q6H A;  2G5M B;  2DLU A;  2RRM A;  4K78 A;  2KQF A;  4NMO A;  4MPA A;  4NMR A;  3DOR A;  3GGE A;  1OBX A;  2HE4 A;  2ZPL A;  4K76 A;  2KYL A;  1KEF A;  4XHV A;  2M0T A;  3NFK A;  2K1Z A;  4UU5 A;  2CSS A;  2PA1 A;  1N7F A;  1ZUB A;  4UU6 A;  2EEH A;  5E21 A;  2E7K A;  4NNM A;  2R4H A;  2I0I A;  4Q2N A;  1WHA A;  2O2T A;  3MH4 A;  3QE1 A;  5B6L A;  1SOT A;  2EDZ A;  1RZX A;  2YT7 A;  2IWP A;  2MX6 A;  1WI4 A;  1IU2 A;  2JWE A; 
#chains in the Genus database with same CATH topology
 4JOK A;  1XZ9 A;  1TP5 A;  4IC6 A;  1VB7 A;  3B76 A;  4AMH A;  4HOP A;  3STJ A;  2EEG A;  3QDO A;  3MH7 A;  2IWN A;  4NMS A;  5E22 A;  1I16 A;  3PV2 A;  4GHN A;  5FB8 C;  3CBX A;  3MH6 A;  2KL1 A;  2DC2 A;  2I6V A;  5HF4 A;  2L97 A;  4JOF A;  1D5G A;  5IL9 A;  2KAW A;  2WL7 A;  3R68 A;  1WFG A;  5FHT A;  4JOH A;  3CBY A;  1VCW A;  2JIK A;  2QKT A;  1WJL A;  2P3W A;  2M0Z A;  1X9Z A;  2F5Y A;  1NF3 C;  4NMQ A;  5D13 A;  5HFF A;  4K72 A;  1V5L A;  2I4S A;  2FN5 A;  5G1D A;  3NCV A;  3DJ1 A;  1K32 A;  4NMT A;  1FC7 A;  2OGP A;  1IHJ A;  1RY4 A;  2AWU A;  3RL7 A;  3EGG C;  2KV8 A;  1UHP A;  2KJK A;  3CYY A;  4JOP A;  2EJY A;  2KPL A;  4E3B A;  5HEB A;  2M10 A;  1MFG A;  1P1E A;  4Z8J A;  2JIN A;  2EAQ A;  1UEP A;  3GDS A;  3KZE A;  4FLN A;  2W7R A;  1VAE A;  1Y8T A;  1TQ3 A;  1P1D A;  1KWA A;  1UEQ A;  3R0H A;  4FGM A;  1V5Q A;  1M5Z A;  1W9O A;  1WF7 A;  2L4S A;  3JXT A;  2VSP A;  5ILB A;  1X6D A;  4GVD A;  3K50 A;  2KA9 A;  4O06 A;  2EDV A;  2Q3G A;  1X45 A;  1VJ6 A;  1Q3P A;  1Z86 A;  1UEZ A;  2D92 A;  5E1Y A;  3AXA A;  1X5R A;  2LUI A;  2YT8 A;  2YTW A;  4REY A;  3KZD A;  1ZOK A;  2VZ5 A;  2EGN A;  3GAB A;  2LA8 A;  4N6X A;  2DLS A;  2JSN A;  3TSW A;  2V1W A;  2OCS A;  4JOG A;  2DB5 A;  2HGA A;  3KDK A;  4YYX A;  3CS0 A;  2YUB A;  2VSV A;  3NGH A;  1WG6 A;  3WKM A;  2VRF A;  3DJ3 A;  2FE5 A;  4EDJ A;  2EDP A;  1WIF A;  2PDZ A;  1NTE A;  1PDR A;  1VA8 A;  2AWW A;  1IU0 A;  2HE2 A;  2PKT A;  3QO6 A;  5GND A;  4JOR A;  2DJT A;  2M3M A;  1QAV A;  3I4W A;  2Z17 A;  1UF1 A;  2G2L A;  4E35 A;  3HPK A;  1YBO A;  2DKR A;  2JOA A;  1FC6 A;  4NXR A;  3ZRT A;  5H3J A;  1Y7N A;  3PS4 A;  2H3L A;  1QLC A;  3RLE A;  2Q9V A;  2JIL A;  3OU0 A;  3OTP A;  3GJ9 A;  4K75 A;  2ENO A;  4PQW A;  3LNY A;  1U38 A;  4Q6S A;  5GLJ A;  2ZPM A;  4HOP B;  1UJU A;  2LC7 A;  1UJD A;  5HEY A;  5E6P B;  2YUY A;  4F8K A;  3SOE A;  2KJP A;  1Z87 A;  3DJA A;  2EGK A;  1WI2 A;  2V90 A;  2EHR A;  4RI0 A;  4LMM A;  2GZV A;  2EEI A;  1N6D A;  3CH8 A;  3LNX A;  1OBY A;  2KOJ A;  3HVQ C;  1GM1 A;  3GCN A;  3HPM A;  2D8I A;  4NXP A;  1Q3O A;  2JXO A;  3BPU A;  4K6Y A;  1LCY A;  3ID1 A;  5E11 A;  2Z9I A;  2EGO A;  4JL7 A;  1OZI A;  4YDP A;  2FNE A;  3O5N A;  1QAU A;  1UJV A;  1Q7X A;  3QGL A;  1UEW A;  4NNL A;  2PZD A;  2GEF A;  4Q2P A;  2PNT A;  3ID4 A;  1U39 A;  2I04 A;  4WYU A;  2H2C A;  3NFL A;  2LOB A;  2D90 A;  3CBZ A;  3TMH A;  2QBW A;  1TP3 A;  1R6J A;  4L8N A;  1BE9 A;  5F3X A;  2QKV A;  3QIK A;  4R2Z A;  2KOH A;  1U37 A;  4JJ0 A;  4KFV A;  5HF1 A;  1RGW A;  4Q2O A;  1N6E A;  3WKL A;  1WFV A;  2QG1 A;  3PV4 A;  2PKU A;  1V62 A;  4NMP A;  1N6F A;  1B8Q A;  1MC7 A;  5HED A;  1BFE A;  1UFX A;  4OAJ A;  2KRG A;  3EGH C;  2QKU A;  3E17 A;  1OBZ A;  5A2P A;  3ID3 A;  1L6O A;  2L4T A;  1X8S A;  3I18 A;  2OZF A;  1WHD A;  5HET A;  4Q3H A;  2H3M A;  2OSG A;  2KJD A;  3QJN A;  2LC6 A;  3SUZ A;  1MFL A;  4G69 A;  2MHO A;  3L4F D;  2CSJ A;  2CS5 A;  2KPK A;  1N7T A;  2M0U A;  1UM1 A;  2BYG A;  4JOE A;  5HDY A;  2RCZ A;  3ID2 A;  3KDG A;  4Q2Q A;  3RL8 A;  5HFE A;  2OMJ A;  2DM8 A;  2R3Y A;  3QJM A;  5HFC A;  3CC0 A;  3K82 A;  2IWO A;  3VQF A;  3PDZ A;  2FCF A;  1FC9 A;  2OQS A;  2X7Z A;  3KHF A;  5HFB A;  2REY A;  2DMZ A;  2M0V A;  4GVC A;  2AWX A;  1N99 A;  4E34 A;  1GQ5 A;  2KG2 A;  1V1T A;  2VPH A;  1QAV B;  2K20 A;  4Z33 A;  5B42 A;  3K1R A;  2AIN A;  2IWQ A;  5G1E A;  4OEO A;  5EZ0 A;  5EYZ A;  5HFD A;  4OEP A;  3DIW A;  3GDV A;  1GQ4 A;  3TSZ A;  3GCO A;  4P0C A;  2W4F A;  3TSV A;  4H11 A;  1T2M A;  4JOJ A;  4P2A B;  3VQG A;  1U3B A;  1V6B A;  2EV8 A;  1I92 A;  2UZC A;  3O46 A;  2JRE A;  1X5N A;  1KY9 A;  2I1N A;  1N7E A;  2KBS A;  1WH1 A;  3I1E A;  5I7Z A;  1X5Q A;  2VWR A;  4NMV A;  3PDV A;  2QT5 A;  2H2B A;  3FY5 A;  3PV5 A;  1UIT A;  3R69 A;  3GSL A;  3SHW A;  5DTH A;  4KFW A;  1TE0 A;  3GDU A;  1W9E A;  2DAZ A;  4NXQ A;  4WYT A;  5HJ1 A;  5JXB A;  1W9Q A;  1RGR A;  1WF8 A;  3SHU A;  1SOZ A;  1FCF A;  1G9O A;  2I0L A;  2OPG A;  2EEJ A;  2OS6 A;  2KOM A;  1UM7 A;  2EXG A;  3SFJ A;  5F67 A;  2F0A A;  4Q6H A;  2G5M B;  2DLU A;  2RRM A;  4K78 A;  2KQF A;  4NMO A;  4MPA A;  4NMR A;  3DOR A;  3GGE A;  1OBX A;  2HE4 A;  2ZPL A;  4K76 A;  2KYL A;  1KEF A;  4XHV A;  2M0T A;  3NFK A;  2K1Z A;  4UU5 A;  4JJ3 A;  2CSS A;  2PA1 A;  1N7F A;  1ZUB A;  4UU6 A;  2EEH A;  5E21 A;  2E7K A;  4NNM A;  2R4H A;  2I0I A;  4Q2N A;  1WHA A;  2O2T A;  3MH4 A;  3QE1 A;  5B6L A;  1SOT A;  2EDZ A;  1RZX A;  2YT7 A;  2IWP A;  2MX6 A;  1WI4 A;  1IU2 A;  2JWE A; 
#chains in the Genus database with same CATH homology
 4JOK A;  1XZ9 A;  1TP5 A;  4IC6 A;  1VB7 A;  3B76 A;  4AMH A;  4HOP A;  3STJ A;  2EEG A;  3QDO A;  3MH7 A;  2IWN A;  4NMS A;  5E22 A;  1I16 A;  3PV2 A;  4GHN A;  5FB8 C;  3CBX A;  3MH6 A;  2KL1 A;  2DC2 A;  2I6V A;  5HF4 A;  2L97 A;  4JOF A;  1D5G A;  5IL9 A;  2KAW A;  2WL7 A;  3R68 A;  1WFG A;  5FHT A;  4JOH A;  3CBY A;  1VCW A;  2JIK A;  2QKT A;  1WJL A;  2P3W A;  2M0Z A;  1X9Z A;  2F5Y A;  1NF3 C;  4NMQ A;  5D13 A;  5HFF A;  4K72 A;  1V5L A;  2I4S A;  2FN5 A;  5G1D A;  3NCV A;  3DJ1 A;  1K32 A;  4NMT A;  1FC7 A;  2OGP A;  1IHJ A;  1RY4 A;  2AWU A;  3RL7 A;  3EGG C;  2KV8 A;  1UHP A;  2KJK A;  3CYY A;  4JOP A;  2EJY A;  2KPL A;  4E3B A;  5HEB A;  2M10 A;  1MFG A;  1P1E A;  4Z8J A;  2JIN A;  2EAQ A;  1UEP A;  3GDS A;  3KZE A;  4FLN A;  2W7R A;  1VAE A;  1Y8T A;  1TQ3 A;  1P1D A;  1KWA A;  1UEQ A;  3R0H A;  4FGM A;  1V5Q A;  1M5Z A;  1W9O A;  1WF7 A;  2L4S A;  3JXT A;  2VSP A;  5ILB A;  1X6D A;  4GVD A;  3K50 A;  2KA9 A;  4O06 A;  2EDV A;  2Q3G A;  1X45 A;  1VJ6 A;  1Q3P A;  1Z86 A;  1UEZ A;  2D92 A;  5E1Y A;  3AXA A;  1X5R A;  2LUI A;  2YT8 A;  2YTW A;  4REY A;  3KZD A;  1ZOK A;  2VZ5 A;  2EGN A;  3GAB A;  2LA8 A;  4N6X A;  2DLS A;  2JSN A;  3TSW A;  2V1W A;  2OCS A;  4JOG A;  2DB5 A;  2HGA A;  3KDK A;  4YYX A;  3CS0 A;  2YUB A;  2VSV A;  3NGH A;  1WG6 A;  3WKM A;  2VRF A;  3DJ3 A;  2FE5 A;  4EDJ A;  2EDP A;  1WIF A;  2PDZ A;  1NTE A;  1PDR A;  1VA8 A;  2AWW A;  1IU0 A;  2HE2 A;  2PKT A;  3QO6 A;  5GND A;  4JOR A;  2DJT A;  2M3M A;  1QAV A;  3I4W A;  2Z17 A;  1UF1 A;  2G2L A;  4E35 A;  3HPK A;  1YBO A;  2DKR A;  2JOA A;  1FC6 A;  4NXR A;  3ZRT A;  5H3J A;  1Y7N A;  3PS4 A;  2H3L A;  1QLC A;  3RLE A;  2Q9V A;  2JIL A;  3OU0 A;  3OTP A;  3GJ9 A;  4K75 A;  2ENO A;  4PQW A;  3LNY A;  1U38 A;  4Q6S A;  5GLJ A;  2ZPM A;  4HOP B;  1UJU A;  2LC7 A;  1UJD A;  5HEY A;  5E6P B;  2YUY A;  4F8K A;  3SOE A;  2KJP A;  1Z87 A;  3DJA A;  2EGK A;  1WI2 A;  2V90 A;  2EHR A;  4RI0 A;  4LMM A;  2GZV A;  2EEI A;  1N6D A;  3CH8 A;  3LNX A;  1OBY A;  2KOJ A;  3HVQ C;  1GM1 A;  3GCN A;  3HPM A;  2D8I A;  4NXP A;  1Q3O A;  2JXO A;  3BPU A;  4K6Y A;  1LCY A;  3ID1 A;  5E11 A;  2Z9I A;  2EGO A;  4JL7 A;  1OZI A;  4YDP A;  2FNE A;  3O5N A;  1QAU A;  1UJV A;  1Q7X A;  3QGL A;  1UEW A;  4NNL A;  2PZD A;  2GEF A;  4Q2P A;  2PNT A;  3ID4 A;  1U39 A;  2I04 A;  4WYU A;  2H2C A;  3NFL A;  2LOB A;  2D90 A;  3CBZ A;  3TMH A;  2QBW A;  1TP3 A;  1R6J A;  4L8N A;  1BE9 A;  5F3X A;  2QKV A;  3QIK A;  4R2Z A;  2KOH A;  1U37 A;  4JJ0 A;  4KFV A;  5HF1 A;  1RGW A;  4Q2O A;  1N6E A;  3WKL A;  1WFV A;  2QG1 A;  3PV4 A;  2PKU A;  1V62 A;  4NMP A;  1N6F A;  1B8Q A;  1MC7 A;  5HED A;  1BFE A;  1UFX A;  4OAJ A;  2KRG A;  3EGH C;  2QKU A;  3E17 A;  1OBZ A;  5A2P A;  3ID3 A;  1L6O A;  2L4T A;  1X8S A;  3I18 A;  2OZF A;  1WHD A;  5HET A;  4Q3H A;  2H3M A;  2OSG A;  2KJD A;  3QJN A;  2LC6 A;  3SUZ A;  1MFL A;  4G69 A;  2MHO A;  3L4F D;  2CSJ A;  2CS5 A;  2KPK A;  1N7T A;  2M0U A;  1UM1 A;  2BYG A;  4JOE A;  5HDY A;  2RCZ A;  3ID2 A;  3KDG A;  4Q2Q A;  3RL8 A;  5HFE A;  2OMJ A;  2DM8 A;  2R3Y A;  3QJM A;  5HFC A;  3CC0 A;  3K82 A;  2IWO A;  3VQF A;  3PDZ A;  2FCF A;  1FC9 A;  2OQS A;  2X7Z A;  3KHF A;  5HFB A;  2REY A;  2DMZ A;  2M0V A;  4GVC A;  2AWX A;  1N99 A;  4E34 A;  1GQ5 A;  2KG2 A;  1V1T A;  2VPH A;  1QAV B;  2K20 A;  4Z33 A;  5B42 A;  3K1R A;  2AIN A;  2IWQ A;  5G1E A;  4OEO A;  5EZ0 A;  5EYZ A;  5HFD A;  4OEP A;  3DIW A;  3GDV A;  1GQ4 A;  3TSZ A;  3GCO A;  4P0C A;  2W4F A;  3TSV A;  4H11 A;  1T2M A;  4JOJ A;  4P2A B;  3VQG A;  1U3B A;  1V6B A;  2EV8 A;  1I92 A;  2UZC A;  3O46 A;  2JRE A;  1X5N A;  1KY9 A;  2I1N A;  1N7E A;  2KBS A;  1WH1 A;  3I1E A;  5I7Z A;  1X5Q A;  2VWR A;  4NMV A;  3PDV A;  2QT5 A;  2H2B A;  3FY5 A;  3PV5 A;  1UIT A;  3R69 A;  3GSL A;  3SHW A;  5DTH A;  4KFW A;  1TE0 A;  3GDU A;  1W9E A;  2DAZ A;  4NXQ A;  4WYT A;  5HJ1 A;  5JXB A;  1W9Q A;  1RGR A;  1WF8 A;  3SHU A;  1SOZ A;  1FCF A;  1G9O A;  2I0L A;  2OPG A;  2EEJ A;  2OS6 A;  2KOM A;  1UM7 A;  2EXG A;  3SFJ A;  5F67 A;  2F0A A;  4Q6H A;  2G5M B;  2DLU A;  2RRM A;  4K78 A;  2KQF A;  4NMO A;  4MPA A;  4NMR A;  3DOR A;  3GGE A;  1OBX A;  2HE4 A;  2ZPL A;  4K76 A;  2KYL A;  1KEF A;  4XHV A;  2M0T A;  3NFK A;  2K1Z A;  4UU5 A;  4JJ3 A;  2CSS A;  2PA1 A;  1N7F A;  1ZUB A;  4UU6 A;  2EEH A;  5E21 A;  2E7K A;  4NNM A;  2R4H A;  2I0I A;  4Q2N A;  1WHA A;  2O2T A;  3MH4 A;  3QE1 A;  5B6L A;  1SOT A;  2EDZ A;  1RZX A;  2YT7 A;  2IWP A;  2MX6 A;  1WI4 A;  1IU2 A;  2JWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...