3GDVA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yqf peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
316
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 61
structure length 295
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdvA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA01
3QE1A 3CS7A 4BTTB 3QLPH 2ZU4A 3SNBA 1D3DB 3Q00A 1U37A 2ZZUH 1UK2A 2XTTB 2Z6BD 1L1GA 3ZVGA 2OQUA 5E0GA 4DURA 3W94A 1CA0C 2BDAA 4TPYA 5GWZA 2OXSA 2ZU2A 3LIWA 3LC3A 4JOPA 5HFCA 1Z8RA 2P59A 3RXMA 1INCA 4FUGA 4D7FA 1P8VC 4A6LA 1YKTA 3PDZA 2ANKH 4ABAA 1BA8B 3E3TA 3IWMA 3LH3A 1CHGA 1BIOA 1NS3A 4FVDA 1FY1A 2VINA 5HM2A 2QKUA 4CBNA 2CN0H 2FXRA 3KZDA 1PJPA 2CHAC 3DHKH 2RA3A 4MPVA 7GCHG 1SOTA 3A86A 2EI8A 4HZHA 3UR6A 3M3TA 1SB1H 2W3IA 3TMHA 2WYJA 1QCPA 3SHUA 4MNXA 2ZKSA 1TPSA 1Z86A 1AMHA 2REYA 2CV3A 2AMQA 3RXCA 1C1MA 3SU4A 4CR5A 3E0NB 1PPCE 1NPMA 2M10A 1GCDA 2VSVA 1MQ6A 1LKAA 1VITG 2QIQA 3LNXA 3GDUA 1O33A 1Y3WA 1O3DA 1CQQA 4AFQA 3HGPA 4AG1A 1UEQA 2PFEA 4IC6A 3SHCH 4JZ1A 3MU1A 1ARCA 2BD2A 4AB9A 1GHAF 3R68A 4ABIA 2WPKS 1C2JA 1TQ3A 2Q1JA 3RXOA 3LGIA 4X1NU 1O3GA 2KAIB 3RL8A 5D13A 2FI3E 1V2RT 2WPIS 2OMJA 1O2KA 3W95A 2WPMS 3HK6B 1P04A 3TSVA 4I33A 4BTIB 3OTPA 4NNMA 2I0LA 1UCYK 3TJVA 2F0AA 1AY6H 1TLDA 1EP6A 1ZHMA 1C1OA 4NMVA 5HFFA 5EU8A 3SU6A 5DJ7A 1AVGH 1ZTJA 3F1SB 2Z17A 3JXTA 1FONA 1UTOA 2P8OB 4X2VA 4YESB 3BPUA 1TGNA 3PV5A 1PPFE 1TONA 1RRKA 1ETRH 2AMDA 3Q3KA 3O8CA 1RTKA 1G3CA 2GZ7A 3FANA 1XKAC 1Z8IB 4YT7H 2R2WU 1O2ZA 1O2QA 3OTJE 3TSWA 1AWFH 1BMLA 2BZAA 1V2LT 2KJPA 2Z3EA 4BNRA 4DGJA 1O3LA 2C90B 4A1TA 4O3UA 1TQ7B 2A2XH 3MH6A 3FVFB 2D8IA 2A1DB 1HAIH 1WBGB 1TRNA 1GI2A 2GVFA 1A5GH 4K8BA 4JOEA 2VWMA 1UTPA 4X6OA 1FLEE 2JIKA 1FY5A 2B7DH 2PWXA 2GT8A 2Y5FA 4Z8JA 3VEQB 3MTYA 2CMYA 1MTNC 1NZQH 3RC5A 2QG1A 4Q7YA 2FYRA 2Z9GA 3OYPA 2I6SA 1ZOMA 4Z0KA 2JWEA 3M5OA 3GCHB 2V1WA 3L4FD 3KGPA 3K1RA 1DSUA 2BD3A 4AGKA 3Q77A 2KG2A 1OWDA 4R8TB 1XXDA 3BIVH 1FI8A 1TB6H 2IPHA 3BTHE 3RXTA 1WI4A 4GHNA 1O5EH 1RGQA 3TNTA 4K60A 2PSXA 2QY0B 1N6DA 1ZPZA 4CRDA 1L0ZA 2FCFA 1MCVA 2XC5A 1GL0E 3U9AH 1ELAA 2E7KA 2BX4A 4FUCA 3ZZ4A 1O30A 3TGJE 3BEFB 1ELVA 1YP9A 2HNTC 3CC0A 1GBKA 2R2MB 1MC7A 5ABWA 1SQAA 3FP7E 2ZPSA 1KXDA 1YM0A 3MNSA 1DOJA 1MKWK 1TMTH 1G3BA 1GGDC 1HFDA 1W9OA 4NSVA 3SNDA 1P3CA 1W11U 4GLYA 1YGCH 4I8JA 1C5PA 4X8TH 1PQ8A 4B2BA 4I7YH 1FN8A 5EG4A 2QGRA 3UIRA 3ZVAA 1V2JT 4E7RG 1K2I1 1MZAA 1SLXB 2A2QH 2UWPA 1ZHPA 2Z3CA 1X5NA 2M0VA 1AUTC 4ISIH 3T28A 2NU4E 1WHAA 1N7TA 3TK9A 2FOBA 1FPCH 1TIOA 1EX3A 2SGFE 3A8BA 2AYWA 3SN8A 1OBYA 2VJ1A 2FTLE 2JH5D 4THNH 3SV2H 1ESTA 3M7QA 2DE8A 4JZDH 3NXPA 1BDAA 3RXDA 2Z9LA 3A8CA 1A46H 4K3JA 1DWDH 5SGAE 4X8UH 1OPHB 1QNJA 3NFLA 5AVDA 1KY9A 1RJXB 4Y0ZE 4DW2U 2G8TA 2J34A 3SJ8A 2G2LA 1T31A 1IQMA 1JXPA 2B0FA 2GMTB 1C1VH 2HGTH 1LPZB 3TJOA 2C3SA 4AG2A 3GGEA 1ZZZA 1GBEA 2AH4X 3EGHC 4R0IA 3NCLA 2PTCE 1OP8A 1F0SA 2VRFA 4BAMB 2WPJS 4ZH8A 1HXEH 1MTVA 1O37A 5C5OA 2BVXH 2EJYA 2PTNA 1NRQH 1BB0B 2H9EH 1BQYA 2A7HA 3SJOA 2VIWA 7GCHF 4MDSA 1ZMLA 3ATIA 4NXRA 1TGSZ 4K1TA 2KOMA 4O06A 1N1LA 2A4QA 1GMCF 1TMBH 1Y3UA 2ZWLH 1GJ6A 1F0UA 4WYTA 1ZLRA 1THRH 3L6PA 1E34B 3BTQE 1MTSA 3TNSA 2JETB 1UM1A 1GI5A 1UCYH 4JK6A 5DK1A 1DUEA 2Y5GA 1PPBH 2BXUH 2O8MA 2OUAA 1A5IA 3AVZA 2V35A 3ZVCA 1P11E 4Q2NA 1J15A 3FY5A 1WYKA 1DANH 3GJ9A 1QRZA 2BOKA 3RMMH 5A09A 1GI9B 5E0JA 1EOLA 5C20A 1ZUBA 2M0UA 4E3BA 1ELCA 4R2ZA 1AQ7A 2CJIA 1LHEH 1CU1A 2L97A 1GBMA 2VNTA 4K8YA 2ZFFH 1P2OA 1KSNA 5C1YA 7LPRA 5EODA 3RLWH 2JKHA 3ENSB 2GZVA 4KELA 5IYTA 4Y76A 3T2NA 1QB9A 1HPGA 5BRRE 3GYLB 3B76A 3SJIA 1BRUP 2HVXA 3SUFA 1GI1A 1O3CA 1AVXA 1SFIA 4WXVA 5EGMA 1YPLH 4OEOA 1U3BA 4A1VA 1SHHB 3LGYA 5TCAA 1MD8A 4L8NA 3ZZ3A 2JINA 4XHVA 1TBRH 1OX1A 2PUXB 4NFEA 1O5GH 4FUJA 1SGPE 4UDWH 2KYLA 3F9FA 2EV8A 3VQGA 1NTPA 5I25A 2A7CA 1UF1A 3E0PB 2RCZA 2J4IA 2I4SA 2J9NA 2ZQ1A 3B23B 4UFDH 2G4TA 2A31A 2GV6A 3QWCH 3RXHA 1UCYE 2YT7A 1D9IA 4GPGA 1WJLA 1O34A 3GCOA 4B2AA 1FDPA 3KIDU 3GY6A 3UR9A 1C9PA 1IQGA 1GDNA 1HV7A 2HLCA 4JORA 4MLFB 2ZP0H 3ID4A 2ZHQH 5B6LA 2OQ5A 1F7ZA 2CS5A 3U69H 3A82A 1Z71A 1JIRA 3PM3A 4MNVA 3A83A 3MO3A 1H8DH 1VCWA 4REYA 2F9NA 1ZJKA 1H9LB 2BM2A 1Z1IA 5HJ1A 1QAVB 2AIQA 1THSH 1EAXA 1W13U 2YNAA 5E1YA 3S9BA 3MNCA 3D23A 1UK4A 2ZC9H 3RMLH 1GHBF 5GJ4B 4PROA 3DIWA 1TPPA 1GI3A 2RCEA 3QGNB 2PUQH 1WTGH 1AVWA 4BTUB 2FI4E 4LXBH 1WG6A 1LVYA 4AOQA 2Z7FE 2OD3B 2PGQB 1CE5A 1XUJA 3E17A 1HYLA 2YTWA 2YUBA 1HAZB 1V2KT 1OKXA 2UWOA 9ESTA 2XNIA 8LPRA 1VCPA 3LJOA 2TIOA 1U6QA 5JB9S 5DP7A 1BT7A 5HF4A 2BDBA 1O2YA 3PV4A 2ZFRH 2ZGHA 3GY7A 2D2DA 2VH0A 1ABIH 2ODQA 3OSYA 4JZEH 1D6WA 1HJAB 3MNXA 1G30B 1U39A 3GISB 2OBOA 1XUIA 5FAHA 1AFQB 3UUZA 1X7AC 4HOPB 3A88A 2ZFTA 4X2WA 1CSOE 3U1IB 4K1EA 4B74A 5FCKA 1BTHH 3UNSA 3V7TA 2DAZA 4ZAEA 8ESTE 4Q2PA 4K5ZA 2JXOA 1KLTA 4D76A 1K1LA 4K1SA 3M36A 1EJMA 1Z1JA 2K1QA 2H5CA 4UFGH 1AN1E 5GDSH 4I8LA 4Y6DA 2D90A 3DUXH 3NK8A 2LA8A 3PTBA 1NFYA 3M3SA 3EA8A 1QY6A 1KXCA 3URDA 4MTBA 2WUCA 1IAUA 1P02A 1UEZA 1AHTH 2R3UA 2ZDNA 1VCQA 1QRXA 4X1PU 1C2DA 3ID1A 1SMFE 1RIWC 5HF1A 1H4WA 5L2YH 1ANBA 4Q6HA 2OP9A 1JMOH 2ZDMA 2F9VA 4LZ4B 3ATWA 1V2VT 3EAJA 5A2PA 2HRVA 4BANB 3VQFA 2BOHB 1O31A 2OINA 1Y8TA 1QQ4A 2HPPH 4JOGA 4HGCA 2VIVA 1ZJDA 5JDUB 3M37A 1QURH 1UJUA 2BHGA 1OYQA 1W2KH 1IHTH 1FY4A 1GBFA 1P9SA 1C1RA 3LH1A 4GCHF 2BDIA 2ZCHP 3BTME 1MH0A 3EE0B 2XBVA 4RN6A 4DJZB 1AE8H 1HAXB 2L4SA 2DB5A 4GVDA 2GP9B 2Y6TA 1GBCA 1RS0A 4IGDA 3SUDA 1DPOA 3O5NA 1O2PA 2AERH 3I29A 1UVUH 4ABHA 4DIIH 1O3KA 5DP8A 2HNTE 1S6HA 2Y5HA 1HAVA 5T6GA 3ZYEA 1XUKA 2W7UA 2EGNA 4F49A 2ZFSA 2FNEA 4K75A 4DG4A 2NU2E 4CBOA 3CENA 1TPOA 2O2TA 1GJCB 1FJSA 1WIFA 3LONA 1OYTH 1EPTB 2JILA 5LPEA 1GG6C 1V2WT 3ODFA 3I77A 2BY9X 5E2PA 1N6EA 3K9XB 5EW1H 1YPMH 3SHWA 1TNIA 1V2UT 1H9IE 1UITA 1GJ4H 1O3HA 1EZSC 1GPZA 1IOEA 1LHFH 2A4GA 3GCTG 2XRCA 1KIGH 5TJXA 1EXFA 1W12U 2OPGA 1P57B 1IQLA 1EZQA 2BYGA 3ID2A 3MU4A 4NGAH 1HLTH 2ZDVH 4ZXXH 1A2CH 5DP4A 1EAWA 1LQEA 2DKRA 3P8NA 1YLCA 1IU0A 4G69A 2DLSA 1HUTH 1SLUB 2ULLA 1JOUB 1MZDA 1YYY1 1S0QA 3DD2H 1S5SA 1UJDA 2KRGA 4D8NA 4JZIA 1O3MA 3GICB 4NCYA 1KWAA 3VFEA 4CRCA 2P3TB 3PDVA 1GMHF 2ZEBA 2XW9A 5T6DA 3PO1B 1W0YH 1MTUA 1TNKA 1ZR0A 3CS0A 1O3PB 2JOAA 1KLIH 2VIPA 1DITH 3N7OA 1GDQA 1ELGA 4WMFA 1PPZA 1F5RA 2P95A 3S9AA 1SOZA 3QGLA 1ANCA 5HEDA 2H2CA 5F8XA 3LGUA 4BXWA 1D4PB 3ZVFA 1V2NT 1VA8A 1ETSH 1C1UH 4X8SH 5CHAC 4IN2A 3FAOA 1YCPH 3JZ1B 4BXSA 3RXFA 1BMMH 1VR1H 3BTGE 3LNYA 3V13A 2I1NA 2QBWA 3TH3H 1VGCC 3BSQA 4O9VA 1N99A 1N8OC 3LGTA 3AW0A 1NC6A 4XSKU 3T25A 2RA0A 1GQ4A 1G9OA 3KHFA 2C8YB 4TPIZ 3TSZA 1UJVA 3MO6A 1P10A 3RXSA 3UQOA 2PW8H 4X0WU 4AMHA 1TBZH 4DCDA 1EZUC 1AB9C 1TP3A 3B8JA 1TPAE 2FLBH 4JOFA 4OS7A 3T29A 3HPKA 4FU8A 5TCCA 3MH7A 3TH4H 5HYOA 2ZQ2A 1TABE 3SQEE 1BRBE 1UO6A 2QAAA 1AIXH 1SGEE 1GMCG 3UWJH 2CGAA 4ZMAH 1FUJA 2FX4A 2J38A 4U01A 3SU3A 1NRRH 3KQCA 3RM2H 4NA9H 5L6NH 1FC7A 5DG6A 3ZZAA 2XWAA 1A0JA 2F91A 3KEEA 4X2XA 1QTFA 3VB4A 3ZZCA 1QAVA 3S7HB 1TP5A 1OP0A 3F9EA 2EI6A 4GHQA 1ELDE 1TGBA 1MCTA 2R0KA 3HPTB 2DC2A 4LOYH 1WH1A 3RXAA 4AORA 2W26A 3MFJA 1X8SA 3U1JB 3HPMA 3E90B 2STBE 3RXKA 4KTCA 1MAXA 2TBSA 1CHOF 2C93B 4AZ2B 5HMAA 1T7CA 2O8TA 1UTMA 1GL1A 3NPSA 3QK1A 5EQQA 1G2MA 4B2CA 2L4TA 4H6SB 4MPWA 2LPRA 4OEPA 3UOPA 1UK3A 4NWKA 2D26C 4YOGA 2A4RA 2PKSC 2WUBA 3RP2A 1DVAH 5JPMH 2GCTC 1NY22 4YZUA 1ZGVA 4IBLH 2QXJA 3ATMA 1V2QT 3PMHB 3PTNA 4JMYA 3QUMP 2PNTA 4HOPA 5JYIA 4K72A 5DP6A 4E35A 1ZGIA 1A5HA 3GCNA 3TGIE 2ASUB 1A1RA 1K1PA 2QYIA 5GNDA 4ZHAA 5A2MH 4ZUHA 2WV5A 4Q3HA 3BF6H 1PPEE 2C8WB 5GCHG 2PLXA 1Q2WA 5C1UA 2B5TB 4BOHA 1V5LA 3GY5A 1X5QA 3I18A 1HXFH 2PR3A 1ZSJA 1BRAA 1P01A 4BAKB 4MQAA 1O2HA 4OGXA 5BPEA 1WI2A 1LVOA 3A89A 3H7OA 4UU5A 2NU3E 1TX7A 1GJ7B 4RKJB 4WH8A 6GCHF 1CT2E 1GMDF 5FX6A 5FB8C 8GCHF 1QR3E 4VGCC 3UNRA 1B7XB 1Z8JB 4N6XA 1Q3XA 2PKUA 1OS8A 1LKBA 4NIXA 1SR5C 4D9QA 2AWWA 3ZZ9A 2BY8X 3SNCA 2J2UA 3TITA 1S0RA 1WCZA 1HAHH 2SGPE 2QA9E 2OC8A 2QXHA 2TGDA 1GHBG 1FAKH 2ESTE 4P2AB 3NWUA 3LPRA 5E6PB 1DDJA 3ZVEA 4Y8ZA 1GI8B 4NSYA 3R69A 2LNCA 1K1MA 1K9OE 3RXQA 2ANWA 1FIWA 3MU0A 1SLWB 1ZYOA 4FUIA 4NIVA 2PZDA 1DX5M 1TX8A 2R4HA 2A0QB 4ISOA 2EGOA 2GTBA 2RRMA 1Z8GA 1K22H 3DJ1A 4NIWA 4CH8B 3GCTF 4WMEA 2Q6DA 1TFXA 2GZ9A 3CYYA 1B0FA 1FXYA 4X1QU 1O5BB 1V2TT 7ESTE 3ZVDA 2Y7XA 1VAEA 2FYQA 1F92A 2IWNA 2VWLA 1RGWA 3SJKA 2H2ZA 3STJA 4ZKRU 1TNGA 3VB7A 1V2OT 1OP2A 4JOKA 3BEUA 4B76A 3TH2H 4XBCA 1LVBA 1E35B 1LHDH 1HGTH 3AASA 1KEFA 4E34A 5C3NA 1BTWA 1S81A 3RXUA 1EPTA 1P2IA 2FMJA 3UFAA 1MUEB 4AX9H 2CF8H 5A8XA 1FAXA 4H4FA 2KL1A 1SGFA 2IWOA 4XE4A 4IMZA 5AFYH 2PHBA 1J8AA 4OS5A 1SFQB 3DFJA 3RXIA 1WV7H 5FHTA 3FP8E 2FOCA 3WY8A 1O2JA 3HKJB 1MBMA 1DSTA 2QKTA 2A32A 4OS6A 2G5NA 1RD3B 1ORFA 1O2IA 2ZECA 1O2WA 5HDYA 2AEIH 2DJTA 2UUYA 1HAVB 2Y7ZA 1BTXA 2JREA 1LDTT 1L4ZA 2ZNKH 1L6OA 2KJDA 1FQ3A 2GKVE 1GBIA 4Y7AA 2BQ7B 5EPNA 1FZZA 2VGCB 2V3OH 1CA8B 1C5OH 1O3NA 3LDXH 4UE7H 1X6DA 3TIUA 4U30A 2GX4A 1N6XA 4GCHG 4OAJA 4IW4E 4Q80A 1BE9A 3IG6B 1K1OA 1CBWB 4U2WA 4WF8A 3GY4A 4NA7A 4WWYA 5F67A 3PYHA 3HK3B 1UHPA 1G36A 1K1JA 1IQKA 2H6MA 4TY6A 6LPRA 5JXBA 1K1IA 5AF9H 2M0ZA 9LPRA 5F03A 4FUBA 1LPKB 5FXLA 5FPYA 4I8KA 3E16B 1KDQA 1SGRE 3NZIA 4X8VH 5E0HA 1CGIE 1O3JA 2HPQH 2XBYA 1EAIA 2QXGA 1XUHA 2BD8A 1SG8B 1L1JA 1C5XB 1JWTA 1GJBB 2P8OC 3VGCB 2Y80A 4AFZA 3PV2A 3BTDE 1H9HE 1IHSH 2O8LA 2F5YA 4HFPB 4K6YA 1DWEH 1HDTH 3GDVA 1NFWA 1J17T 3KL6A 4NMSA 4FU7A 2EI7A 3SI3H 2ZG0H 3SORA 1O2TA 2ZTXA 4NFFA 4WYUA 1NROH 4LZ1H 3LT3A 2XXLA 2W7SA 6CHAB 1NTEA 1Q7XA 1O2MA 3CBYA 1P0SH 1C5TA 2FESH 2BD7A 1K21H 1D3PB 2BD4A 2BDHA 1C5LH 1L1NA 5A0AE 1AUJA 1YC0A 8KME2 2OZFA 2LC7A 2EA3A 3ODDA 3QZRA 4UONA 2B9LA 1GMHG 2F3CE 4RI0A 3A80A 1TNLA 1QLCA 2K1ZA 1SI5H 1TNHA 4LMMA 4YDPA 1ETTH 3I4WA 1C4Y2 1O32A 1M5ZA 1NFUA 1ZTKA 1HNEE 1PFXC 3GCHC 1S85A 3MI4A 4WVPE 4MPAA 2XBXA 1ZSKA 5GCHF 1PQ7A 1IQEA 1FY8E 1UM7A 1CGHA 1Z7KA 1AZ8A 1ZSLA 2HWLB 3BG4B 5C67A 3ESTA 1P06A 5G4BA 1E38B 3V3MA 5I7ZA 5LPRA 2BQ6B 1O3AA 1A61H 1YF4A 2KA9A 4ZHLU 2QN5T 2IOTA 4Y11E 5DO4H 1HAOH 1XUGA 1SGCA 3A87A 2ALPA 5HFDA 4J2YB 3PS4A 2W7RA 4INHA 2FIRH 4KP0A 1RTFB 2P3UB 2DUCA 5AHGH 1P1EA 5DPAA 1LCYA 3A84A 4F8KA 3A85A 2VVVA 1MKWH 1C1QA 1SGNE 3M35A 3T62A 3RC6A 3SNEA 2VSPA 3Q3YA 3QTOH 1Y59T 5EPYA 1GDUA 1NT1A 3OU0A 1J14A 1O3IA 3ZZ6A 3HGNA 4OGYA 4WY3A 2UWLA 1JIMA 3U98H 3O8RA 1O36A 4MNYA 2ZGJA 3K50A 5DP3A 5AFZH 3UOUA 2BXTH 4ZXYH 1PDRA 1BZXE 1TE0A 1H8IH 2FOAA 4NA8A 1J16A 3DFLA 1L2EA 1EB2A 3C1KA 3ZZBA 1N6YA 4JYTA 1C2GA 2ZHEH 2NWNA 3FZDA 1DICA 2AGIX 2EDVA 5F3XA 1T32A 1THPB 4ABBA 2AWUA 2GZ8A 3QIKA 1YBWA 1UVPA 2FOMB 2J92A 1V6BA 4Y7BA 3P95A 4CRFA 2V0BA 3RU4T 1C2EA 4Q7ZA 2EDPA 2M0TA 4OS2A 5JBCS 1SGFG 1T4UH 2VB0A 4A7IB 4F4OC 1SLVB 4A92A 3S7KB 1CHOG 2PDZA 1CA0B 1KYNA 1ZOKA 1AO5A 2BDCA 2GMTC 1JBUH 1QRWA 1C5NH 3A8AA 5E21A 1CT4E 1V5QA 1Y3XA 1OZIA 4ISLA 1C2LA 2BD9A 2F9UA 4ESTE 1D3TB 2ZPMA 5JBAS 1Y7NA 2EXGA 1WFGA 1ZPCA 1I92A 1C5RA 1VJ6A 1RFNA 2FP7B 1VZQH 2Q6GA 4K69A 3KN2A 1BITA 1R6JA 2OCSA 2Q3GA 2R0LA 4ZHMU 2CHAB 5DP5A 4NXQA 1O2UA 4K76A 3BTWE 1P09A 3P92A 3ZYDA 1F0RA 4JOHA 2FE5A 2SGAA 4ZKNU 4AYVB 4UEHH 4ABEA 1W7GH 3K2UA 1C1NA 3QN7A 1W9EA 3QZQA 2JETC 1XKBC 3M5MA 3SNAA 3SUGA 1QQUA 3UNQA 1IQHA 3PLBA 1LPGB 1W14U 4IN1A 4X6PA 1PPGE 1AGJA 1SHYA 1TA2A 1P9UA 1GBTA 3URCA 3PMJA 4ZKOU 3KF2A 5I46H 2W5EA 1X5RA 3GOVB 6GCHG 4I32A 2Z9IA 1GVKB 1GBBA 1GMDG 1DFPA 3QO6A 8GCHG 1EJNA 1D6RA 4A1XA 4SGBE 1LHGH 2TRMA 2HE4A 3UPEA 1W3CA 1WOFA 2M3MA 4Y79A 1DXWA 2PV9B 1O35A 1C5QA 1KXAA 2A5AA 3SU2A 1G2LA 3P70B 5HGGA 2PKAA 1WQSA 5PTPA 1W8BH 2VWRA 4P0CA 3VB6A 2XC4A 2ALVA 1KLJH 3SU0A 4DOQA 2V90A 1GJ8B 5EXLA 2ZFQH 2V6NA 1TOCB 1O38A 1QBOA 1KTTB 3LKWA 3RMOH 4IC5A 3M3VA 3QX5H 1E0FD 2QF3A 2XC0A 1BMNH 5FBIA 2YOLA 1RGRA 3EDXB 2ZU1A 3CP7A 4Z6AH 1QBVH 2Q6FA 1V6DA 1H1BA 3A7TA 1F5KU 2SGEE 1GWAA 1TGCA 1EZXC 3RXGA 5EYZA 3BG4C 1XM1A 2HOBA 3T27A 3G01A 3TK5A 4XOJA 1DLEA 1BHXF 2QKVA 5C2ZA 1EP5A 1MFGA 1HRTH 1Y5UT 1C1SA 1C5YB 1HCGA 2FOHA 1UMAH 2BDYA 1LMWB 2ZHWH 3ZZ7A 2EDZA 2OC0A 2EAQA 2GD4B 2QF0A 2KV8A 3O8DA 1LVMA 1MTWA 1NN6A 1V2ST 4E06H 3TJUA 1GI7B 1QJ1B 2PA1A 3RXPA 3ZV8A 1Y5BT 3I1EA 1O2NA 1O2OA 1W7XH 1CGJE 1QL9A 2DE9A 5A8ZA 3BV9B 1OSSA 1MTNB 2I04A 3RDZA 2BY7X 4JZFH 3KCGH 1FV9A 1UHBA 3GSLA 4CH2B 1O3FA 1C2FA 1B5GH 2IWPA 5B6OA 1DWBH 2FS9A 2F9BH 4CRGA 1SL3A 1UTKA 4ABFA 2LC6A 1O2SA 2Z3DA 2HALA 1C5SA 3DJAA 1IQFA 2ZPLA 3R0FA 1YPEH 1S82A 1KDQB 1SGTA 3GYMA 1CT0E 3QJMA 1P2JA 4ISNA 1WQVH 3U8RH 2BLQA 1HJAC 2BY6X 2SFAA 3U8OH 1VITH 2GGVB 1EKBB 2UZCA 1O5FH 2G81E 3LU9B 1AFQC 5A0BA 4MPUA 2IN2A 2BTCE 4GUXA 3RXLA 1V2PT 1C5MD 2HE2A 2F9OA 1GGDB 2GCHG 1C1TA 4XBDA 2OGPA 2BB4A 4ZKSU 1G37A 2I6VA 2ZHFH 2C8ZB 1FPHH 1QGFA 3NFKA 2VWNA 3SO3A 5ESTE 1GQ5A 3TVJB 2UUFB 1AI8H 3IITA 1GCTB 1P03A 2Z9KA 1TALA 3DORA 1SGQE 4MPXA 1AWHB 1OWKA 2WPHS 1LTOA 2YT8A 2ZU5A 3SJ9A 2ILNA 1P1DA 2DLUA 2ZDLA 3K65B 2QXIA 4OS4A 1HJ8A 1P2KA 2VIQA 5A8YA 1FCFA 1YPHC 1ZTLA 2QC2A 2PSYA 5EXMA 4MVNA 2C8XB 2F9PA 3CH8A 3E6PH 2AGEX 1EJAA 4AGJA 4YYXA 4CRBA 5GPIB 3CBXA 1P2QA 2WV4A 3EYDA 1O39A 3UREA 3MH5A 4JYUH 2C4FH 3BTTE 4Y10E 4NMQA 1GHYH 2LOBA 3M5NA 3A8DA 4MG3A 1C2HA 2FN5A 1TA6A 1LHCH 1C1PA 4KGAA 3MNBA 2SGDE 3M7UA 3V12A 5DKMA 2A7JA 2FTMA 4FVBA 3SUEA 2EEIA 2D1JA 5J4SA 3MO9A 2RDLA 5G1EA 1DWCH 3F68H 3SGBE 4GAWA 2G55A 4Y71A 3SU5A 2GT7A 1YLDA 2ZFPH 4NZLA 5GIBA 1SC8U 1GHXH 1AFEH 1ID5H 3PWCA 2HGAA 2M5TA 4KFVA 2QV1A 4I8HA 1ELEE 3E91A 2EEHA 2OC1A 3RU4D 2UUKB 4TYDA 3MWIU 2FM2A 2A4OA 1O2XA 4TY7A 1QFKH 1X45A 4Z33A 1SSXA 2OC7A 2VVUA 5L2ZH 2TPIZ 3E8LA 5HXFA 3KQBA 1C1WH 1E37B 1GHZA 3MH4A 2VU8E 4U32A 2WINI 5ESBA 2DM8A 2OBQA 4GHTA 4NG9H 3TLOA 1G3EA 3QGJA 1Q3PA 3RXRA 1EPTC 3T26A 1I16A 3OY5U 2EGKA 1QJ6B 2G52A 1T8NA 1DS2E 2H1UA 1UFXA 4H6TA 3JZ2B 5DP9A 1UEWA 1MFLA 3K6ZA 3O46A 1OWHA 1G9IE 1K28D 2G00A 2A5KA 5JBBS 3A7YA 1P05A 3P17H 1P2NA 7KMEH 1YBOA 3RUOA 1T8LA 1SPJA 2STAE 1P12E 4AFUA 1Y3VA 1BTUA 2J94A 1LO6A 1DUAA 1S83A 1LQDB 1C5UA 2W4FA 1FN6A 5FPTA 3ZRTA 1P2MA 1MKXK 4AFSA 2Y82A 1NFXA 1YPJH 4XDEA 2UUJB 1HIAB 1C4U2 1V62A 1PQAA 4YT6H 1VJAU 2CSSA 2HNTF 2KPLA 5FX5A 1T4VH 1GHVH 2WPLS 3SHAH 2ZIQH 3VPKA 4KFWA 1V3XA 2XCFA 3UY9A 1AU8A 3PO1C 1W9QA 1EOJA 2O8UA 5FBEA 1TNJA 2ZGBH 1EUFA 1GBJA 2AMPA 1AZZA 2JH0D 1N6FA 1GBAA 3C27B 5IDKA 2A5IA 3EA7A 1FMGA 3M5LA 1QL7A 1A3BH 2FOGA 3F9GA 4RKOB 4Y0YE 3UTUH 3BTEE 3LGVA 4YO9A 2XBWA 1PYTC 1NRNH 3P8OA 1BTPA 5JBTA 3QDZB 3FFGA 5G1DA 1IQIA 2ZCLP 5EQSA 2B8OH 2ZF0H 4CHAB 3F6UH 1GBLA 1WSSH 4HTCH 1J9CH 2ZTZA 4JOJA 3L33A 2VVCA 4WJG2 1GBDA 1IQNA 1DE7H 2H5DA 2YNBA 2MHOA 1GJAB 1ELFA 4ISHH 1GVLA 3VB5A 5LH8A 4Y8YA 3ZZ8A 2ZPQA 3RLEA 2BDGA 1BJVA 3HATH 1ZMJA 3LOXA 3KHVA 2BQWB 2XWBI 2GV7A 3SU1A 2NU1E 1NM6A 5DTHA 1CO7E 1V2MT 1YPGH 1OOKB 4M7GA 3A7ZA 3L3TA 1ACBE 1B0EA 2CSJA 1BTZA 1PYTD 4X6NA 1HAPH 5HEBA 3S0NA 1OWEA 2CF9H 2ODYB 1QBNA 3LC5A 3ZZ5A 3PMAB 5H4IB 2EHRA 4XBBA 4Q2OA 1GCTC 1QB6A 1Z6JH 3I78A 3LJJA 3SQHE 1QJ7B 2G4UA 3A7XA 3GDSA 1O2RA 5E22A 2PKAB 3MYWA 1ZRBA 4CR9A 1WFVA 2H3LA 2XCNA 4AN7A 3E1XB 5GXPA 1O5AB 3H7TA 1QL8A 1KTSB 4KTUA 5HFEA 1Z6EA 2G5VA 4YLUA 4H42U 3RLYH 1Y3YA 4ABJA 1FC9A 1HJ9A 4B1TA 3ATKA 3ZV9A 4B75A 2OCVB 4TWWA 4O3TA 2Y81A 1HB0B 4JL7A 1EATA 1QA0A 2ZGXH 4NMOA 1KXEA 1KXBA 2FODA 2GCHF 2KOJA 2ZDAH 4HI3A 1XVMA 4YLQH 2VWOA 1SQTA 3ITIA 1P3EA 1PPHE 1NU9A 3A7VA 2Q9VA 2GDEH 2BZ6H 2ZPRA 2D8WA 4BAOB 5L30H 2FLRH 5HFBA 5EXNA 1TYNA 1DM4B 4CRAA 3BIUH 3AXAA 5CE1A 3UWIA 4LK4A 1XXFA 1RZXA 2EC9H 2BX3A 3RL7A 3AAUA 5EZ0A 1TWXB 3M61U 1ELTA 1QAUA 4X1RU 2BLOA 4AYYB 2AIPA 1T8MA 2FX6A 1K1NA 4D9RA 1AKSA 2VIOA 3EA9A 3SI4H 2P3WA 1GJ5H 2ZTYA 3O8BA 4FUEA 1O3OA 4NXPA 2ZDKA 2Z9JA 3EQ0H 4B71A 2RG3A 1KXFA 1XZ9A 3GY2A 1RIWB 1FC6A 3R3GB 4BAHB 1S6FA 3RXVA 1IQJA 2WYGA 4YOJA 1C5VA 1SGYE 4XFQA 1BCUH 1C9TA 4NWLA 3K82A 3SGAE 1UHBB 3F9HA 4ABDA 3BTKE 2BVSH 2OS6A 1O3EA 1TGTA 2TGTA 2FOEA 4SGAE 1ANEA 3U8TH 3QTVH 1BBRK 4INLA 3SZNA 1GJ9B 3ZVBA 3HVQC 1BMAA 1XX9A 2FWWA 2D92A 3VXFH 2EEJA 5C1XA 3OY6U 2VZ5A 2VIDA 1VITF 1UTJA 2XYAA 3T5FH 2X7ZA 3FZZA 3BG8A 5EOKA 2H3MA 5HM9A 3AAVA 1CVWH 1F0TA 3P6ZB 1DLKB 5DGJA 2TGPZ 2CXVA 4X6MA 1C5ZB 5E8EH 2AS9A 2ZU3A 1TOMH 1RXPA 3PLPA 2P3FH 3SOSA 3H5CB 2LUIA 3B9FH 1MD7A 1UTQA 3D62A 4IMQA 2ZCKP 3OX7U 4J1YA 2BY5X 1MKXH 5LGOA 1NRSH 2OLGA 4GSOA 1OBXA 4JK5A 1O2GH 2ZI2H 2AFQB 4OS1A 4ASHA 5C5NA 2FEQH 2IWQA 1ZHRA 5E2OA 5T6FA 3GY8A 1BFEA 1DT2A 2JH6D 2QT5A 4Q6SA 1GG6B 1B8QA 2VPHA 1UVTH 1ARBA 5H3JA 4E7NA 1FNIA 5HEYA 4O03A 5F8ZA 3D49H 4FU9A 4FUFA 4Q2QA 3AW1A 4IS5A 2BYAX 1BUIA 1GJDB 3WKMA 3QDOA 2G5MB 1BOQA 1YPHE 2BD5A 1RTLA 4O97A 2KJKA 3DT0H 1EASA 2KAIA 4CHAC 3MOCA 4NMPA 3RU4E 1ESAA 3LGWA 2J95A 3KQDA 3PMBB 1C5WB 2FPZA 3GY3A 1GM1A 1OXGA 4B73A 1XMNB 3RM0H 2FS8A 3DJ3A 4A5TS 3SV8A 3MMGA 1WUNH 3SOEA 2Z94A 1TBQH 3HKIB 1GI4A 1SQOA 1SBWA 1W10U 1A0LA 5GLJA 4Q7XA 6ESTA 1NF3C 5A0CA 1BHXB 1WU1A 3EGKH 3MU5A 4GVCA 1GI6A 2H9TH 2BMGB 2ZO3H 3S69A 3P8FA 3SBKA 1C2IA 4EDJA 3DA9B 1C4V2 3KZEA 1O2VA 2ZGCA 1MBQA 3UQVA 1WTHD 1FIZA 1GBHA 2FO9A 3MHWU 3BN9A 1UVSH 4FXGH 4WH6A 1OWIA 1ESBA 2AINA 1YCPK 1ZRKA 2IJOB 5CHAB 1G3DA 1F5LA 1Q31A 4JCNA 1HIAA 2DMZA 3Q76A 1ABJH 4X2YA 1XUFA 1BTYA 4NMTA 3RXBA 1Q3OA 2VGCC 1WHDA 4NIYA 1AD8H 2P94A 2SGQE 4DY7B 1VGCB 3FP6E 3MU8A 1N8OB 2FDAA 1DY9A 2R9PA 1TAWA 5HETA 1CBWC 2KPKA 2F83A 2ODPA 2VH6A 3ID3A 1N7EA 3VB3A 4UFEH 4ABGA 1UTNA 2KOHA 2GDDA 1GHAG 3A7WA 5FCRA 2I0IA 2MX6A 1O0DH 1QIXB 1AB9B 1UJ1A 3RC4A 3A81A 3SGQE 3ATLA 1XVOA 5J4QA 1DY8A 1TQ0B 4Q2KA 2ZA5A 1MU6B 2NU0E 2P93A 2TGAA 3KNXA 4TWYA 1ZPBA 2EEGA 1D3QB 1GVZA 4QT8C 3PLKA 4K78A 1EB1H 1WAYB 3K6YA 1A7SA 1TMUH 1U38A 3VXEH 1A0HB 4FUHA 2WL7A 1O5DH 1MMJN 4UD9H 3VGCC 1VB7A 1UEPA 1N7FA 1GI0A 1M9UA 1A4WH 1V1TA 1NESE 5CMXH 3EGGC 5ETXA 1JRSA 2OQSA 4NNLA 3KQEA 1ANDA 4K2YA 3QJNA 2FOFA 4YOIA 2ENOA 1O5CB 1AE5A 1QB1A 1BRCE 4DIHH 6CHAC 5LPFA 1HAYB 1GHWH 1BBRH 3TU7H 1L4DA 3SV7A 2SNWA 5EQRA 2G51A 4ZROA 4PQWA 1NO9H 3BTFE 3D65E 2YUYA 1VJ9U 2OTVA 3PWBA 1HAGE 1QA7A 5JB8S 1IHJA 2W3KA 2KBSA 2ANYA 3CBZA 2PKSB 5EW2H 2GCTB 2ZHDA 1TX6A 3V0XA 5K0HA 1PQ5A 5FPSA 1E36B 1HBTH 5K7RA 1TRMA 1W0ZU 4UU6A 1O3BA 1MAYA 1K32A 4KTSA 4WXIA 2I6QA 1SVPA 4NMRA 1ZMNA 1TRYA 2O9QA 3NUMA 1FY3A 2H9HA 3TK6A 1Y5AT 4I31A 4D7GA 1SGDE 3WKLA 3R0HA 2BLVA 3RXJA 4YM9A 4GVUA 2PKTA 1WF8A 1YPKH 4Y8XA 5T3HA 3RXEA 3PB1E 4JYVH 1T8OA 2A45B 3BEIB 3TPIZ 3SUZA 3SV6A 4UFFH 4WMDA 3Q3XA 1QHRB 1MQ5A 4INKA 2O8WA 1SGIB 1O2LA 2BLWA 2K20A 4VGCB 4AB8A 2H2BA 4RSPA 3S9CA 1NU7B 1BBRE 1BJUA 1YCPM 5E11A 4DT7B 3ZZDA 5F6MA 2ANMH 3PROA 1IU2A 4FGMA 3STIA 2EEKA 4YTAA 4KKDA 3SFJA 2FZZA 4X1SU 1EAUA 3SW2B 4BAQB 1C2MA 4E05H 2THFB 2SNVA 1T2MA 1UTLM 1OWJA 1F2SE 2AGGX 2KQFA 3TJNA 4FUDA 1G32B 1S84A 4CREA 1JRTA 2P16A 1ELBA 1A3EH 1C2KA 1D5GA 2V3HH 1RY4A 1Z87A 1AKSB 1MU8B 3RMNH 5F8TA 4H11A 2OSGA 4NZQA 1EQ9A 3P8GA 1OBZA 3NGHA 1NRPH 2PGBB 2QCYA 2KAWA 2AWXA 2FI5E 4I8GA 2R3YA 1UVOA 4MNWA 3M7TA 4DVAU 3ELAH 3NKKA 3TGKE 1WF7A 1DXPA 2BVRH 3SV9A
chains in the Genus database with same CATH superfamily
3QE1A 3CS7A 4BTTB 3QLPH 2ZU4A 3SNBA 1D3DB 2V7QD 3Q00A 1U37A 2ZZUH 1UK2A 2XTTB 2Z6BD 1L1GA 3ZVGA 2OQUA 5E0GA 4DURA 3W94A 1CA0C 2BDAA 4TPYA 5GWZA 2OXSA 2ZU2A 3LIWA 3LC3A 4JOPA 5HFCA 1Z8RA 2P59A 3RXMA 1INCA 4FUGA 4D7FA 1P8VC 4A6LA 1YKTA 3PDZA 2ANKH 4ABAA 1BA8B 3E3TA 3IWMA 3LH3A 1CHGA 3OEED 1BIOA 1NS3A 4FVDA 1FY1A 2VINA 5HM2A 2QKUA 4CBNA 2CN0H 2FXRA 3KZDA 1PJPA 2CHAC 3DHKH 2RA3A 4MPVA 7GCHG 1SOTA 3A86A 2EI8A 4HZHA 3UR6A 3M3TA 1SB1H 2W3IA 3ZIAD 3TMHA 2WYJA 1QCPA 3SHUA 2KCAA 5EJLA 4MNXA 2ZKSA 1TPSA 1Z86A 1AMHA 2REYA 2CV3A 2AMQA 3RXCA 1C1MA 2XNDD 3SU4A 4CR5A 3E0NB 1PPCE 1NPMA 2M10A 1GCDA 2VSVA 1MQ6A 1LKAA 1VITG 2QIQA 3LNXA 3GDUA 1O33A 1Y3WA 1O3DA 1CQQA 4AFQA 3HGPA 4AG1A 1UEQA 2PFEA 4IC6A 3SHCH 4JZ1A 3MU1A 1ARCA 2BD2A 4AB9A 1GHAF 3MQKC 3R68A 4ABIA 2WPKS 1C2JA 1TQ3A 2Q1JA 3RXOA 3LGIA 3F0PA 4X1NU 1O3GA 2KAIB 3RL8A 5D13A 2FI3E 1V2RT 2WPIS 2OMJA 1O2KA 3W95A 2WPMS 3HK6B 1P04A 3TSVA 4I33A 4BTIB 3OTPA 4NNMA 2I0LA 1UCYK 4ZCNA 3TJVA 2F0AA 1AY6H 1TLDA 1EP6A 1ZHMA 1C1OA 4NMVA 5HFFA 5EU8A 3SU6A 5DJ7A 1AVGH 1ZTJA 3F1SB 3OFND 2Z17A 3JXTA 1FONA 1UTOA 2P8OB 4X2VA 4YESB 3BPUA 1TGNA 3F0OA 3PV5A 1PPFE 1TONA 1RRKA 1ETRH 2AMDA 3Q3KA 3O8CA 1RTKA 1G3CA 2GZ7A 2KM0A 1XKAC 3FANA 1Z8IB 4YT7H 2R2WU 1O2ZA 1O2QA 3OTJE 3TSWA 1AWFH 1BMLA 2BZAA 1V2LT 2KJPA 2Z3EA 4BNRA 4DGJA 1O3LA 2C90B 4A1TA 4O3UA 1TQ7B 2A2XH 2KZ4A 3MH6A 3FVFB 2D8IA 2A1DB 1HAIH 1WBGB 1TRNA 3N7DA 1GI2A 2GVFA 1A5GH 4K8BA 4JOEA 4Q4LA 2VWMA 2JSNA 1UTPA 4X6OA 2PP6A 3SYJA 1FLEE 2JIKA 1FY5A 2B7DH 2PWXA 2GT8A 2Y5FA 4JJ0A 4Z8JA 3VEQB 3MTYA 2CMYA 1MTNC 1NZQH 3RC5A 2QG1A 4Q7YA 2FYRA 2Z9GA 3OYPA 2I6SA 1ZOMA 4Z0KA 2JWEA 3M5OA 3GCHB 2V1WA 3L4FD 3KGPA 4B6EA 3K1RA 1DSUA 2BD3A 4AGKA 3Q77A 2KG2A 1OWDA 3FKSD 4R8TB 1XXDA 3BIVH 5EJ1A 1FI8A 1TB6H 2IPHA 3BTHE 3RXTA 1WI4A 4GHNA 1O5EH 1RGQA 3TNTA 4K60A 2PSXA 2QY0B 1N6DA 1ZPZA 4CRDA 5IK2D 1L0ZA 2FCFA 1MCVA 2XC5A 1GL0E 2KCYA 3U9AH 1ELAA 2E7KA 2BX4A 4FUCA 3ZZ4A 1O30A 3TGJE 3BEFB 1ELVA 1YP9A 3DCLA 2HNTC 3CC0A 1GBKA 2R2MB 1MC7A 5ABWA 1SQAA 4FOUC 3FP7E 2ZPSA 1KXDA 1YM0A 3MNSA 1DOJA 1MKWK 1TMTH 1G3BA 1GGDC 1HFDA 1W9OA 4NSVA 3SNDA 1P3CA 1W11U 4GLYA 1YGCH 4I8JA 1C5PA 2JIZD 4X8TH 1PQ8A 4B2BA 4I7YH 1FN8A 5EG4A 2QGRA 3UIRA 3ZVAA 1V2JT 4E7RG 1K2I1 1MZAA 4AC9A 1SLXB 2A2QH 2UWPA 1ZHPA 2Z3CA 1X5NA 2M0VA 1AUTC 4ISIH 3T28A 2NU4E 1WHAA 1N7TA 3NCVA 3TK9A 2FOBA 1FPCH 1TIOA 1EX3A 2SGFE 3OAAD 3A8BA 2AYWA 3SN8A 1OBYA 2VJ1A 2FTLE 2JH5D 4THNH 3SV2H 1ESTA 3M7QA 2DE8A 4JZDH 3F2GA 1BDAA 3NXPA 3RXDA 2Z9LA 3A8CA 1A46H 4K3JA 1DWDH 5SGAE 4X8UH 1OPHB 1QNJA 3NFLA 5AVDA 1KY9A 3DSPA 4Z1MD 3PRBA 1RJXB 2W6ID 4Y0ZE 4DW2U 2G8TA 2J34A 3SJ8A 2G2LA 1T31A 1IQMA 1JXPA 2B0FA 2GMTB 1C1VH 2HGTH 1LPZB 3TJOA 2C3SA 4AG2A 3GGEA 1ZZZA 1GBEA 2AH4X 2L6OA 3EGHC 4R0IA 3NCLA 2PTCE 1OP8A 1F0SA 2VRFA 4BAMB 2WPJS 4ZH8A 1HXEH 1MTVA 1O37A 5C5OA 2BVXH 2EJYA 2PTNA 1NRQH 1BB0B 2H9EH 1BQYA 2A7HA 3SJOA 2VIWA 7GCHF 4MDSA 1ZMLA 3ATIA 4NXRA 1TGSZ 4K1TA 2KOMA 4O06A 1N1LA 2A4QA 1GMCF 1TMBH 1Y3UA 2ZWLH 1GJ6A 1F0UA 4WYTA 1ZLRA 2W6JD 1THRH 3L6PA 1E34B 3BTQE 1MTSA 3TNSA 2JETB 1UM1A 1GI5A 1UCYH 2KCPA 4JK6A 5DK1A 1DUEA 2Y5GA 1PPBH 2BXUH 2O8MA 2OUAA 2XOKD 1A5IA 3AVZA 2V35A 3ZVCA 1P11E 4Q2NA 1J15A 3FY5A 1WYKA 1DANH 3GJ9A 1QRZA 2BOKA 3RMMH 5A09A 1GI9B 5E0JA 1EOLA 5C20A 1ZUBA 2M0UA 4E3BA 1ELCA 4R2ZA 1AQ7A 2CJIA 1LHEH 1CU1A 2L97A 1GBMA 2VNTA 4K8YA 2ZFFH 1P2OA 1KSNA 5C1YA 7LPRA 5EODA 3RLWH 2JKHA 3ENSB 2GZVA 4KELA 5IYTA 4Y76A 3T2NA 1QB9A 1HPGA 5BRRE 3GYLB 3B76A 3SJIA 1BRUP 2HVXA 3SUFA 1GI1A 1O3CA 1AVXA 1SFIA 4WXVA 5EGMA 1YPLH 4OEOA 1U3BA 4A1VA 1SHHB 3LGYA 5TCAA 3F2HA 1MD8A 2WPDD 4L8NA 3ZZ3A 2JINA 4XHVA 1TBRH 2KX4A 1OX1A 2YMSB 2PUXB 4NFEA 1O5GH 4FUJA 1SGPE 4UDWH 2KYLA 3F9FA 2EV8A 4JJ3A 3VQGA 1NTPA 5I25A 2A7CA 1UF1A 3E0PB 2RCZA 2J4IA 2I4SA 2J9NA 2ZQ1A 3B23B 4UFDH 2G4TA 2A31A 2GV6A 3QWCH 3RXHA 1UCYE 2YT7A 1D9IA 4GPGA 1WJLA 1O34A 3GCOA 4B2AA 3KDGA 1FDPA 3KIDU 3GY6A 3UR9A 1C9PA 1IQGA 1GDNA 1HV7A 2HLCA 4JORA 4MLFB 2ZP0H 3ID4A 2ZHQH 5B6LA 2OQ5A 1F7ZA 2CS5A 3U69H 3A82A 1Z71A 1JIRA 3PM3A 4MNVA 3A83A 3MO3A 1H8DH 1VCWA 4REYA 2F9NA 1ZJKA 1H9LB 4P00A 2BM2A 1Z1IA 5HJ1A 1QAVB 2AIQA 1THSH 1EAXA 1W13U 1E79D 2YNAA 5E1YA 3S9BA 3MNCA 3D23A 1UK4A 2ZC9H 3RMLH 1GHBF 5GJ4B 4PROA 3DIWA 1TPPA 1GI3A 2RCEA 3QGNB 2PUQH 2HVYB 1WTGH 1AVWA 4BTUB 2FI4E 4LXBH 1WG6A 1LVYA 4AOQA 2Z7FE 2OD3B 2PGQB 1CE5A 1XUJA 3E17A 1HYLA 2YTWA 2YUBA 1HAZB 1V2KT 1OKXA 2UWOA 9ESTA 2XNIA 8LPRA 1VCPA 3LJOA 2TIOA 1U6QA 5JB9S 5DP7A 1BT7A 5HF4A 2BDBA 1O2YA 3PV4A 2ZFRH 2ZGHA 3GY7A 2D2DA 2VH0A 1ABIH 2ODQA 3OSYA 4JZEH 1D6WA 1HJAB 3MNXA 1G30B 1U39A 3GISB 2OBOA 1XUIA 5FAHA 1AFQB 3UUZA 1X7AC 4HOPB 3A88A 2ZFTA 4X2WA 1CSOE 3U1IB 4K1EA 4B74A 5FCKA 1BTHH 3UNSA 3V7TA 2DAZA 4ZAEA 8ESTE 4Q2PA 4K5ZA 2JXOA 1KLTA 3FO8D 4D76A 1K1LA 4K1SA 3M36A 1EJMA 1Z1JA 2K0QA 2K1QA 2H5CA 4UFGH 1AN1E 5GDSH 4I8LA 4Y6DA 2D90A 3DUXH 3NK8A 2LA8A 3PTBA 1NFYA 3M3SA 3EA8A 1QY6A 4I86A 1KXCA 3URDA 4MTBA 2WUCA 1IAUA 1P02A 1UEZA 1AHTH 2R3UA 2ZDNA 1VCQA 4TSFD 1QRXA 4X1PU 1C2DA 3ID1A 1SMFE 1RIWC 5CDFE 5HF1A 1H4WA 5L2YH 1ANBA 4Q6HA 3EE7A 2OP9A 1JMOH 3KYGA 2ZDMA 2F9VA 4LZ4B 3ATWA 1V2VT 3EAJA 5A2PA 4FLNA 2HRVA 4BANB 3VQFA 2BOHB 1O31A 2OINA 1Y8TA 1QQ4A 2HPPH 4JOGA 1S6LA 4HGCA 2VIVA 1ZJDA 5JDUB 3M37A 1QURH 1UJUA 2BHGA 1OYQA 1W2KH 1IHTH 1FY4A 1GBFA 1P9SA 1C1RA 3LH1A 4GCHF 2BDIA 2ZCHP 3BTME 1MH0A 3EE0B 2XBVA 4RN6A 4DJZB 1AE8H 1HAXB 2L4SA 2DB5A 4GVDA 2GP9B 2Y6TA 1GBCA 1RS0A 4IGDA 3SUDA 1DPOA 3O5NA 1E1RD 1O2PA 2AERH 1UVUH 3I29A 4ABHA 4DIIH 1O3KA 5DP8A 2HNTE 2HLDD 1S6HA 2Y5HA 1HAVA 5T6GA 3ZYEA 1XUKA 2W7UA 2EGNA 4F49A 2ZFSA 2FNEA 4K75A 4DG4A 2NU2E 4CBOA 3CENA 1TPOA 2O2TA 1GJCB 1FJSA 1WIFA 3LONA 1OYTH 1EPTB 2JILA 1BMFD 5LPEA 1GG6C 1V2WT 3ODFA 3I77A 2BY9X 5E2PA 1N6EA 3K9XB 5EW1H 1YPMH 5T1VA 3SHWA 1TNIA 1V2UT 1H9IE 1UITA 1GJ4H 1O3HA 1EZSC 1GPZA 1IOEA 1LHFH 2A4GA 3GCTG 3PRDA 2XRCA 1KIGH 5TJXA 1EXFA 1W12U 2OPGA 1P57B 1IQLA 1EZQA 2BYGA 3ID2A 3MU4A 4NGAH 1HLTH 2QF4A 2ZDVH 4ZXXH 1A2CH 5DP4A 1EAWA 1LQEA 2DKRA 3P8NA 1YLCA 1IU0A 4G69A 2DLSA 1HUTH 1SLUB 2ULLA 1JOUB 1MZDA 1YYY1 1S0QA 3DD2H 1S5SA 1UJDA 2KRGA 4D8NA 4JZIA 1O3MA 3GICB 4NCYA 1KWAA 3VFEA 4CRCA 2P3TB 3PDVA 1GMHF 2ZEBA 2XW9A 5T6DA 3PO1B 1W0YH 1MTUA 1TNKA 1ZR0A 3CS0A 1O3PB 2JOAA 1KLIH 2VIPA 1DITH 3N7OA 1GDQA 4XRNA 1ELGA 4WMFA 1PPZA 1F5RA 2P95A 3S9AA 1SOZA 3QGLA 1ANCA 5HEDA 2H2CA 5F8XA 3LGUA 4BXWA 1D4PB 3ZVFA 1KMHB 1V2NT 1VA8A 1ETSH 1C1UH 4X8SH 5CHAC 4IN2A 3FAOA 1YCPH 4B6FA 3JZ1B 4BXSA 3RXFA 1EFRD 1BMMH 4HG6A 1VR1H 3BTGE 3LNYA 3V13A 2I1NA 2QBWA 3TH3H 1VGCC 3BSQA 5HKKD 4O9VA 1N99A 1N8OC 3LGTA 3AW0A 1NC6A 4XSKU 3T25A 2RA0A 1GQ4A 1G9OA 3KHFA 2C8YB 4TPIZ 3TSZA 1UJVA 3MO6A 1P10A 3RXSA 3UQOA 2PW8H 5EIYA 4X0WU 4AMHA 1TBZH 2LELA 4DCDA 1EZUC 1AB9C 1TP3A 3B8JA 1TPAE 1K0HA 2FLBH 4JOFA 4OS7A 3T29A 3HPKA 4FU8A 5TCCA 3MH7A 3TH4H 5HYOA 2ZQ2A 1TABE 3SQEE 1BRBE 1UO6A 2QAAA 1AIXH 1SGEE 1GMCG 3UWJH 2CGAA 4ZMAH 5C94A 1FUJA 2FX4A 2J38A 3H09A 4U01A 1NRRH 3SU3A 3GABA 3KQCA 3RM2H 4NA9H 5L6NH 1FC7A 5DG6A 3ZZAA 2XWAA 1A0JA 2F91A 3KEEA 4X2XA 1QTFA 3VB4A 3ZZCA 1QAVA 3S7HB 5KEDA 1TP5A 1OP0A 3F9EA 2EI6A 4GHQA 1ELDE 1TGBA 1MCTA 2R0KA 3HPTB 2DC2A 4LOYH 1WH1A 3RXAA 4AORA 2W26A 3MFJA 1X8SA 3U1JB 3HPMA 3E90B 2STBE 3RXKA 4KTCA 1MAXA 2TBSA 2IPQX 1CHOF 2C93B 4AZ2B 5HMAA 1T7CA 2O8TA 1UTMA 1GL1A 3NPSA 3QK1A 5EQQA 1G2MA 4B2CA 2L4TA 4H6SB 4MPWA 2LPRA 4OEPA 3UOPA 1UK3A 4NWKA 3NRLA 2D26C 4YOGA 2A4RA 2PKSC 2WUBA 3RP2A 1DVAH 5JPMH 2WV9A 2GCTC 1NY22 4YZUA 5EJZA 1ZGVA 4IBLH 2QXJA 3ATMA 1V2QT 2IJD1 3PMHB 3PTNA 4JMYA 3QUMP 2PNTA 4HOPA 5JYIA 4K72A 5DP6A 4E35A 1ZGIA 1A5HA 3GCNA 3TGIE 2ASUB 2KCOA 1A1RA 1K1PA 2QYIA 5GNDA 4ZHAA 5A2MH 4ZUHA 2WV5A 4Q3HA 3BF6H 1PPEE 2JJ1D 2C8WB 5GCHG 2PLXA 1Q2WA 5C1UA 2B5TB 4BOHA 1V5LA 3GY5A 1X5QA 3I18A 1HXFH 1W0KD 1ZSJA 2PR3A 1BRAA 1P01A 4BAKB 4MQAA 1O2HA 4OGXA 5BPEA 1WI2A 1LVOA 3A89A 3H7OA 4UU5A 2NU3E 1TX7A 1GJ7B 4RKJB 4WH8A 6GCHF 1CT2E 1GMDF 3KDKA 5FX6A 5FB8C 8GCHF 1QR3E 4VGCC 3UNRA 1B7XB 2WHXA 1Z8JB 4N6XA 1Q3XA 2PKUA 1OS8A 1LKBA 4NIXA 1SR5C 4D9QA 2AWWA 3ZZ9A 2BY8X 3SNCA 2J2UA 3TITA 1S0RA 3OEHD 1WCZA 1HAHH 2SGPE 4RT1A 2QA9E 3UB0A 2OC8A 2QXHA 2TGDA 1GHBG 1FAKH 3KYFA 2ESTE 4P2AB 3NWUA 3LPRA 5E6PB 1DDJA 3ZVEA 4Y8ZA 1GI8B 4NSYA 3R69A 2LNCA 4DT4A 1K1MA 1K9OE 3RXQA 3N7EA 2ANWA 1FIWA 3MU0A 1SLWB 1ZYOA 4FUIA 4NIVA 5HIZA 2PZDA 1DX5M 1TX8A 2R4HA 2A0QB 4ISOA 2EGOA 2GTBA 2J97A 2RRMA 1Z8GA 1K22H 3DJ1A 4F48B 4NIWA 4CH8B 3GCTF 2AHME 4WMEA 2Q6DA 1TFXA 2GZ9A 3CYYA 1B0FA 1FXYA 4X1QU 1O5BB 1H8HD 1V2TT 5KGOA 7ESTE 3ZVDA 2Y7XA 1VAEA 2FYQA 1F92A 2IWNA 2VWLA 1RGWA 3SJKA 2H2ZA 3STJA 4ZKRU 1TNGA 3VB7A 1V2OT 1OP2A 4JOKA 3BEUA 4B76A 3TH2H 4XBCA 1LVBA 1E35B 1LHDH 1HGTH 3AASA 1KEFA 4E34A 5C3NA 1BTWA 1S81A 3RXUA 1EPTA 1P2IA 2FMJA 3UFAA 1MUEB 4AX9H 2JJ2D 2CF8H 5A8XA 1FAXA 4H4FA 2KL1A 1SGFA 2IWOA 4XE4A 4IMZA 5AFYH 2PHBA 1J8AA 4OS5A 1SFQB 3DFJA 3RXIA 1WV7H 5FHTA 3FP8E 2FOCA 3WY8A 1O2JA 1WXRA 3HKJB 1MBMA 1DSTA 2QKTA 2A32A 4OS6A 2G5NA 1RD3B 1ORFA 1O2IA 2ZECA 1O2WA 5HDYA 2AEIH 2DJTA 2UUYA 1HAVB 2Y7ZA 1BTXA 2JREA 1LDTT 1L4ZA 2ZNKH 1L6OA 2KJDA 1FQ3A 2GKVE 1GBIA 1QZ8A 4Y7AA 2BQ7B 5EPNA 1FZZA 2VGCB 2V3OH 1CA8B 1C5OH 1O3NA 3LDXH 4UE7H 1X6DA 3TIUA 1YWUA 4U30A 2WZQA 2GX4A 1N6XA 4GCHG 4OAJA 4IW4E 4Q80A 1BE9A 3IG6B 1K1OA 1CBWB 4U2WA 4WF8A 3GY4A 4NA7A 4WWYA 5F67A 3PYHA 3HK3B 1UHPA 1G36A 1K1JA 2QF5A 1IQKA 2H6MA 4FETA 4TY6A 6LPRA 5JXBA 1K1IA 5AF9H 2M0ZA 9LPRA 5F03A 4FUBA 1LPKB 4Q63A 3DSGA 5FXLA 5FPYA 4I8KA 3E16B 1KDQA 1SGRE 3NZIA 4X8VH 5E0HA 1CGIE 1O3JA 2HPQH 2XBYA 1EAIA 4P02A 2QXGA 1XUHA 2BD8A 1SG8B 1L1JA 1C5XB 1JWTA 2KFWA 1GJBB 2P8OC 3VGCB 2Y80A 4AFZA 3PV2A 3BTDE 1H9HE 1IHSH 2O8LA 2F5YA 4HFPB 4K6YA 1DWEH 1HDTH 3GDVA 1NFWA 1J17T 3KL6A 4NMSA 4FU7A 2EI7A 3SI3H 2ZG0H 3SORA 1O2TA 2ZTXA 4NFFA 4WYUA 1NROH 3FN8A 4LZ1H 3LT3A 2XXLA 2W7SA 6CHAB 1NTEA 1Q7XA 1O2MA 3CBYA 1P0SH 1C5TA 2FESH 2BD7A 1K21H 4TT3D 1D3PB 2BD4A 2BDHA 1C5LH 1L1NA 5A0AE 1AUJA 1YC0A 8KME2 3OE7D 2RDEA 2OZFA 2LC7A 2EA3A 3ODDA 3QZRA 4UONA 2B9LA 1GMHG 2F3CE 4RI0A 3A80A 1TNLA 1QLCA 2K1ZA 1SI5H 1TNHA 4LMMA 4YDPA 1ETTH 3I4WA 1C4Y2 1O32A 1M5ZA 1NFUA 1ZTKA 1HNEE 1PFXC 3GCHC 1S85A 3MI4A 4WVPE 4MPAA 2XBXA 1ZSKA 5GCHF 1PQ7A 1IQEA 1FY8E 1UM7A 1CGHA 1Z7KA 1AZ8A 1ZSLA 2HWLB 3BG4B 5C67A 3ESTA 1P06A 5G4BA 1E38B 3V3MA 5I7ZA 5LPRA 2BQ6B 1O3AA 1A61H 1YF4A 2KA9A 4ZHLU 2QN5T 2IOTA 4Y11E 5DO4H 1HAOH 1XUGA 1SGCA 3A87A 2ALPA 5HFDA 4J2YB 3PS4A 2W7RA 4INHA 2FIRH 4KP0A 3F3BA 1RTFB 2P3UB 2DUCA 5AHGH 1P1EA 5DPAA 1LCYA 3A84A 4F8KA 3A85A 2VVVA 1MKWH 2K8IA 1C1QA 1SGNE 3M35A 3T62A 5FL7D 3RC6A 3SNEA 2VSPA 3Q3YA 3QTOH 1Y59T 5EPYA 1GDUA 1NT1A 3OU0A 1J14A 1O3IA 1YLNA 3ZZ6A 3HGNA 4OGYA 4WY3A 2UWLA 1JIMA 3U98H 3O8RA 1O36A 4MNYA 2ZGJA 3K50A 5DP3A 5AFZH 3UOUA 1VKYA 2BXTH 4ZXYH 1PDRA 1BZXE 1TE0A 1H8IH 2FOAA 4NA8A 1J16A 3DFLA 1L2EA 1EB2A 3C1KA 3ZZBA 1N6YA 3DSOA 4JYTA 1C2GA 2ZHEH 2NWNA 3FZDA 1DICA 2AGIX 2EDVA 5F3XA 1T32A 1THPB 4ABBA 2AWUA 2GZ8A 3QIKA 1YBWA 1UVPA 2FOMB 2J92A 1V6BA 4Y7BA 3P95A 4CRFA 2V0BA 3RU4T 1C2EA 4Q7ZA 2EDPA 2M0TA 4OS2A 5JBCS 1SGFG 1T4UH 2VB0A 4A7IB 4F4OC 1SLVB 4A92A 3S7KB 1CHOG 2F4LA 2PDZA 1CA0B 1KYNA 1ZOKA 1AO5A 2BDCA 2GMTC 1JBUH 1QRWA 1C5NH 3A8AA 5E21A 1CT4E 1V5QA 1Y3XA 1OZIA 4ISLA 1C2LA 2BD9A 2F9UA 4ESTE 1D3TB 2ZPMA 5JBAS 1Y7NA 2EXGA 1WFGA 1ZPCA 1I92A 1C5RA 1VJ6A 1RFNA 2FP7B 1VZQH 2Q6GA 4K69A 3KN2A 1BITA 1R6JA 5C0TA 2OCSA 2Q3GA 3F2FA 2R0LA 4ZHMU 2CHAB 5DP5A 4NXQA 1O2UA 4K76A 3WWFA 3BTWE 1P09A 3P92A 3ZYDA 1F0RA 4JOHA 2FE5A 2SGAA 4ZKNU 4AYVB 4UEHH 4ABEA 1W7GH 3K2UA 1C1NA 3QN7A 1W9EA 3QZQA 2JETC 1XKBC 3M5MA 3SNAA 3SUGA 1QQUA 3UNQA 1IQHA 3PLBA 1LPGB 1W14U 4IN1A 4X6PA 1PPGE 1AGJA 1SHYA 1TA2A 1P9UA 1GBTA 3URCA 3PMJA 4ZKOU 3KF2A 5I46H 2W5EA 1X5RA 3GOVB 6GCHG 4I32A 2Z9IA 1GVKB 1GBBA 1GMDG 1DFPA 3QO6A 8GCHG 1EJNA 1D6RA 4A1XA 4SGBE 1LHGH 2TRMA 2HE4A 3UPEA 1W3CA 1WOFA 2M3MA 4Y79A 2F43B 1DXWA 2PV9B 1O35A 1C5QA 1KXAA 2A5AA 3SU2A 1G2LA 3P70B 5HGGA 2PKAA 1SQRA 1WQSA 5PTPA 1W8BH 2VWRA 4P0CA 3VB6A 2XC4A 2ALVA 1KLJH 3SU0A 4DOQA 2V90A 1GJ8B 1WDIA 5EXLA 2KR7A 2ZFQH 2V6NA 1TOCB 1O38A 1QBOA 1KTTB 2YMSC 2VBCA 3LKWA 2M2AA 3RMOH 4IC5A 3M3VA 3FOAA 3QX5H 1E0FD 2QF3A 2XC0A 1BMNH 5FBIA 2YOLA 1RGRA 3EDXB 2ZU1A 3CP7A 4Z6AH 1QBVH 2Q6FA 1V6DA 1H1BA 3A7TA 1F5KU 2SGEE 1GWAA 1TGCA 1EZXC 3RXGA 5EYZA 3BG4C 1XM1A 2HOBA 3T27A 4F55A 3G01A 3TK5A 4XOJA 1DLEA 1BHXF 2QKVA 5C2ZA 1EP5A 1MFGA 1HRTH 1Y5UT 1C1SA 1C5YB 1HCGA 2FOHA 1UMAH 2BDYA 1LMWB 2ZHWH 3VG8A 3ZZ7A 2EDZA 2OC0A 2EAQA 2GD4B 2QF0A 2KV8A 3O8DA 1LVMA 1MTWA 1NN6A 1V2ST 4E06H 3TJUA 1GI7B 1QJ1B 2PA1A 3RXPA 3ZV8A 1Y5BT 3I1EA 1O2NA 1O2OA 1W7XH 1CGJE 1QL9A 2DE9A 5A8ZA 3BV9B 1OSSA 1MTNB 2I04A 3RDZA 2BY7X 4JZFH 3KCGH 1FV9A 1UHBA 3GSLA 4CH2B 1NBMD 1O3FA 1C2FA 1B5GH 2IWPA 5B6OA 1DWBH 2FS9A 2F9BH 4CRGA 3KQ5A 1SL3A 5HIYA 1UTKA 4ABFA 2LC6A 1O2SA 2Z3DA 2HALA 1C5SA 3DJAA 1IQFA 2ZPLA 3R0FA 1YPEH 1S82A 1KDQB 1SGTA 3GYMA 1CT0E 4ASUD 3QJMA 1P2JA 4ISNA 1WQVH 3U8RH 2BLQA 1HJAC 2BY6X 2SFAA 3U8OH 1VITH 2GGVB 1EKBB 2UZCA 1O5FH 2G81E 3LU9B 1AFQC 5A0BA 4MPUA 2IN2A 2BTCE 4GUXA 3RXLA 1V2PT 1C5MD 2HE2A 2F9OA 1GGDB 2GCHG 1C1TA 4XBDA 2OGPA 2BB4A 4ZKSU 1G37A 2I6VA 2ZHFH 2C8ZB 1FPHH 1QGFA 3NFKA 2VWNA 3SO3A 5ESTE 1GQ5A 3TVJB 2UUFB 1AI8H 3IITA 1GCTB 1P03A 2Z9KA 5CHBA 1TALA 3DORA 1SGQE 4MPXA 1AWHB 1OWKA 2WPHS 1LTOA 2YT8A 2ZU5A 3SJ9A 2ILNA 1P1DA 2DLUA 2ZDLA 3K65B 2QXIA 4OS4A 1HJ8A 1P2KA 2VIQA 3SZEA 5A8YA 1FCFA 1YPHC 1ZTLA 2QC2A 3UAIC 2PSYA 5EXMA 4MVNA 2C8XB 2F9PA 3CH8A 3E6PH 2AGEX 1EJAA 4AGJA 4YYXA 4CRBA 5GPIB 3CBXA 1P2QA 2WV4A 3EYDA 1O39A 3UREA 3MH5A 4JYUH 2C4FH 3AK5A 3BTTE 4Y10E 4NMQA 1GHYH 2LOBA 3M5NA 3A8DA 4MG3A 1C2HA 2FN5A 1TA6A 1LHCH 1C1PA 4KGAA 3MNBA 2WSSD 2SGDE 3U28C 3M7UA 3V12A 5DKMA 2A7JA 2FTMA 4FVBA 3SUEA 2EEIA 2D1JA 5J4SA 3MO9A 2RDLA 5G1EA 1DWCH 3F68H 3SGBE 4GAWA 2G55A 4Y71A 3SU5A 2GT7A 1YLDA 2J98B 2ZFPH 4NZLA 5GIBA 1SC8U 1GHXH 1AFEH 1ID5H 2V3MA 3PWCA 2HGAA 2M5TA 4KFVA 2QV1A 4I8HA 5KECA 1ELEE 3E91A 2EEHA 2OC1A 3RU4D 2UUKB 4TYDA 3MWIU 2FM2A 2A4OA 1O2XA 4TY7A 1QFKH 1X45A 4Z33A 1SSXA 2OC7A 1UW7A 3WWBA 1H8ED 2VVUA 5L2ZH 2TPIZ 3E8LA 5HXFA 3KQBA 1C1WH 1E37B 1GHZA 3MH4A 2VU8E 4U32A 2WINI 3GS9A 5ESBA 2DM8A 2OBQA 4GHTA 4NG9H 3TLOA 1G3EA 3QGJA 1Q3PA 3RXRA 1EPTC 3T26A 1I16A 3OY5U 2EGKA 1QJ6B 2G52A 1T8NA 1DS2E 2H1UA 1UFXA 4H6TA 3JZ2B 5DP9A 1UEWA 1MFLA 3K6ZA 3O46A 1OWHA 1G9IE 1K28D 2G00A 2A5KA 5JBBS 3A7YA 1P05A 3P17H 1P2NA 7KMEH 1YBOA 3RUOA 5DN6D 1T8LA 1SPJA 2STAE 1P12E 4AFUA 1Y3VA 1BTUA 2J94A 1LO6A 1DUAA 1S83A 1LQDB 1C5UA 3WW7A 2W4FA 1FN6A 5FPTA 3ZRTA 1P2MA 2LP6A 1MKXK 4AFSA 2Y82A 1NFXA 1YPJH 4XDEA 2UUJB 1HIAB 1C4U2 1V62A 1PQAA 4YT6H 1VJAU 2CSSA 2HNTF 2KPLA 5FX5A 1T4VH 1GHVH 2WPLS 3SHAH 2ZIQH 3VPKA 4KFWA 1V3XA 2XCFA 3UY9A 1AU8A 3PO1C 1W9QA 2EY4C 1EOJA 2O8UA 5FBEA 1TNJA 2ZGBH 1EUFA 1GBJA 2AMPA 1AZZA 2JH0D 1N6FA 1GBAA 3C27B 5IDKA 2A5IA 3EA7A 1FMGA 3M5LA 1QL7A 1A3BH 2FOGA 3F9GA 4RKOB 4Y0YE 3UTUH 3BTEE 3LGVA 4YO9A 2XBWA 1PYTC 1MABB 1NRNH 5C17A 3P8OA 1BTPA 5JBTA 3QDZB 3FFGA 5G1DA 1IQIA 2ZCLP 5EQSA 2B8OH 2ZF0H 4CHAB 3F6UH 1GBLA 1WSSH 4HTCH 1J9CH 2ZTZA 4JOJA 3L33A 2VVCA 4WJG2 1GBDA 1IQNA 1DE7H 2H5DA 2YNBA 2MHOA 1GJAB 1ELFA 4ISHH 1GVLA 3VB5A 1YY3A 5LH8A 4Y8YA 3ZZ8A 2ZPQA 3RLEA 2BDGA 1BJVA 3HATH 1ZMJA 3LOXA 3KHVA 4ACBA 2BQWB 2XWBI 2GV7A 3SU1A 2NU1E 1NM6A 5DTHA 1CO7E 1V2MT 1YPGH 1OOKB 4M7GA 3A7ZA 3L3TA 1ACBE 1B0EA 2CSJA 1BTZA 1PYTD 4X6NA 1HAPH 5HEBA 3S0NA 1OWEA 2CF9H 2ODYB 1QBNA 3LC5A 3ZZ5A 3PMAB 5H4IB 2EHRA 1OHHD 4XBBA 4Q2OA 1GCTC 2OK5A 1QB6A 1Z6JH 3I78A 3LJJA 3SQHE 1QJ7B 2G4UA 2J5UA 3A7XA 3GDSA 1O2RA 5E22A 2PKAB 3MYWA 1ZRBA 4CR9A 1WFVA 2H3LA 3N99A 2XCNA 3CNRA 4AN7A 3E1XB 5GXPA 1O5AB 3H7TA 1QL8A 1KTSB 4KTUA 5HFEA 1Z6EA 2G5VA 4YLUA 4H42U 3RLYH 1Y3YA 4ABJA 1FC9A 1HJ9A 4B1TA 3ATKA 3ZV9A 4B75A 2OCVB 4TWWA 4O3TA 2Y81A 1HB0B 4JL7A 1EATA 1QA0A 2ZGXH 4NMOA 1KXEA 1KXBA 2FODA 2GCHF 2KOJA 2ZDAH 4HI3A 1XVMA 4YLQH 2VWOA 1SQTA 3ITIA 1P3EA 1PPHE 1NU9A 3A7VA 2Q9VA 2GDEH 2BZ6H 2ZPRA 2D8WA 4BAOB 5L30H 2FLRH 5HFBA 5EXNA 1TYNA 1DM4B 1FX0B 4CRAA 3BIUH 3AXAA 5CE1A 3UWIA 4LK4A 4OM9A 1XXFA 1RZXA 2EC9H 2BX3A 3RL7A 3AAUA 5EZ0A 1TWXB 3M61U 1ELTA 1QAUA 4X1RU 2BLOA 4AYYB 2AIPA 1T8MA 2FX6A 1K1NA 1NBME 4D9RA 5B42A 1AKSA 2VIOA 3EA9A 3SI4H 2P3WA 1GJ5H 2ZTYA 3O8BA 4FUEA 1O3OA 4NXPA 2ZDKA 3W1EA 5ILBA 2Z9JA 3EQ0H 4B71A 2RG3A 1KXFA 1XZ9A 3GY2A 1RIWB 1FC6A 3R3GB 4BAHB 1S6FA 3RXVA 1IQJA 2WYGA 4YOJA 1C5VA 1SGYE 4XFQA 1BCUH 1C9TA 4NWLA 3K82A 3SGAE 1UHBB 3F9HA 4ABDA 3BTKE 2BVSH 2OS6A 1O3EA 1TGTA 2TGTA 2FOEA 4SGAE 1ANEA 3U8TH 3QTVH 1BBRK 4INLA 3SZNA 1GJ9B 3ZVBA 2GEFA 3HVQC 1BMAA 1XX9A 2FWWA 2D92A 3VXFH 2EEJA 5C1XA 3OY6U 2VZ5A 2VIDA 1VITF 1UTJA 2XYAA 3T5FH 2X7ZA 3FZZA 3BG8A 5EOKA 2H3MA 5HM9A 3AAVA 1CVWH 1F0TA 3P6ZB 1DLKB 5DGJA 2TGPZ 2CXVA 4X6MA 1C5ZB 5E8EH 2AS9A 2ZU3A 2GJGA 1TOMH 1RXPA 3PLPA 2P3FH 3SOSA 3H5CB 2LUIA 3B9FH 1MD7A 1UTQA 3D62A 4IMQA 2ZCKP 3OX7U 4J1YA 2BY5X 1MKXH 5LGOA 1NRSH 2EQNA 2OLGA 5DSFA 4GSOA 1OBXA 4JK5A 4ACAA 1O2GH 2ZI2H 2AFQB 4OS1A 4ASHA 5C5NA 2FEQH 2IWQA 1ZHRA 5E2OA 5T6FA 3GY8A 1BFEA 1DT2A 2JH6D 2QT5A 4Q6SA 1GG6B 1B8QA 2VPHA 1UVTH 2J98A 1ARBA 5H3JA 4E7NA 1FNIA 5HEYA 4O03A 5F8ZA 3D49H 4FU9A 4FUFA 4Q2QA 3AW1A 4IS5A 2BYAX 1BUIA 1GJDB 3WKMA 3QDOA 2G5MB 1BOQA 1YPHE 2BD5A 1RTLA 4O97A 2KJKA 3DT0H 1EASA 2KAIA 4CHAC 3MOCA 4NMPA 3RU4E 1ESAA 3LGWA 2J95A 3KQDA 3PMBB 1C5WB 2FPZA 5IL9A 3GY3A 1GM1A 1OXGA 4B73A 1XMNB 3RM0H 2FS8A 3DJ3A 4A5TS 3SV8A 3MMGA 1WUNH 3SOEA 2Z94A 1TBQH 3HKIB 1GI4A 1SQOA 1SBWA 1W10U 1A0LA 5GLJA 4Q7XA 6ESTA 2RFKC 1NF3C 5A0CA 1BHXB 1WU1A 3EGKH 3MU5A 4GVCA 1GI6A 2H9TH 2BMGB 2ZO3H 3S69A 3P8FA 3SBKA 1C2IA 4EDJA 3DA9B 1C4V2 3KZEA 1O2VA 2ZGCA 1MBQA 3UQVA 1WTHD 1FIZA 1GBHA 2FO9A 3MHWU 3BN9A 1UVSH 4FXGH 4WH6A 5F53A 1OWIA 1ESBA 2AINA 1YCPK 1ZRKA 2IJOB 5CHAB 1G3DA 1F5LA 1Q31A 4JCNA 1HIAA 2DMZA 3Q76A 1ABJH 4X2YA 1XUFA 1BTYA 4NMTA 3RXBA 1Q3OA 2VGCC 1WHDA 4NIYA 1AD8H 2P94A 1X9ZA 2SGQE 4DY7B 1VGCB 3FP6E 3MU8A 4M9FA 1N8OB 2FDAA 1DY9A 2R9PA 1TAWA 5HETA 1CBWC 2KPKA 2F83A 2ODPA 2VH6A 3ID3A 1N7EA 3VB3A 4UFEH 4ABGA 1UTNA 2KOHA 2GDDA 1GHAG 3A7WA 5C0UA 5FCRA 2I0IA 2MX6A 1O0DH 1QIXB 1AB9B 1UJ1A 3RC4A 2JDID 3A81A 3SGQE 3ATLA 1XVOA 5J4QA 1DY8A 1TQ0B 4Q2KA 2ZA5A 1MU6B 2NU0E 4YXWD 2P93A 2TGAA 3KNXA 4TWYA 1ZPBA 2EEGA 1D3QB 1GVZA 2L74A 4QT8C 3PLKA 4K78A 1EB1H 1WAYB 3K6YA 1A7SA 1TMUH 1U38A 3VXEH 1A0HB 4FUHA 2WL7A 1O5DH 1MMJN 4UD9H 3VGCC 1VB7A 1UEPA 1N7FA 1GI0A 1M9UA 1A4WH 1V1TA 1NESE 5CMXH 3EGGC 5ETXA 1JRSA 2OQSA 4NNLA 3KQEA 1ANDA 4K2YA 3QJNA 2FOFA 4YOIA 2ENOA 1O5CB 1AE5A 1QB1A 1BRCE 4DIHH 6CHAC 5LPFA 1HAYB 1GHWH 1BBRH 3TU7H 1L4DA 3SV7A 2SNWA 5EQRA 2G51A 4ZROA 4PQWA 1NO9H 3BTFE 3D65E 2YUYA 1VJ9U 2OTVA 3PWBA 2QE7D 1HAGE 1QA7A 5JB8S 1IHJA 2W3KA 2KBSA 2ANYA 3CBZA 2PKSB 5EW2H 2CK3D 2GCTB 2ZHDA 1TX6A 3V0XA 5K0HA 1PQ5A 5FPSA 1E36B 1HBTH 1W0JD 5K7RA 1TRMA 1W0ZU 4UU6A 1O3BA 1MAYA 1K32A 4KTSA 1COWD 4RT0A 4WXIA 2I6QA 1SVPA 4NMRA 1ZMNA 1TRYA 2O9QA 3NUMA 1FY3A 2H9HA 3TK6A 1Y5AT 4I31A 4D7GA 1SGDE 3WKLA 3R0HA 2BLVA 3RXJA 4YM9A 4GVUA 2PKTA 1WF8A 1YPKH 4Y8XA 5T3HA 3RXEA 3PB1E 4JYVH 1T8OA 2A45B 3BEIB 3TPIZ 3SUZA 3SV6A 4UFFH 4WMDA 3Q3XA 1QHRB 1MQ5A 4INKA 2O8WA 1SGIB 2YMSD 1O2LA 2BLWA 2K20A 4VGCB 4AB8A 2H2BA 4RSPA 3S9CA 1NU7B 1BBRE 1BJUA 1YCPM 5E11A 4DT7B 3ZZDA 5F6MA 2ANMH 3PROA 1IU2A 4FGMA 3STIA 2EEKA 4YTAA 4KKDA 3SFJA 2FZZA 4X1SU 1EAUA 3SW2B 4BAQB 1C2MA 4E05H 2THFB 2SNVA 1T2MA 1SKYE 4XD7D 1UTLM 1OWJA 1F2SE 2AGGX 2KQFA 3TJNA 4FUDA 1G32B 1E1QD 1S84A 4CREA 1JRTA 2P16A 1ELBA 1A3EH 1C2KA 1D5GA 2V3HH 1RY4A 1Z87A 1AKSB 1MU8B 3RMNH 5F8TA 4H11A 2OSGA 4NZQA 1EQ9A 3P8GA 1OBZA 3NGHA 1NRPH 2PGBB 2QCYA 2KAWA 2AWXA 2FI5E 4I8GA 2R3YA 1UVOA 4MNWA 3M7TA 4DVAU 3ELAH 3NKKA 3TGKE 1WF7A 1DXPA 2BVRH 3SV9A
chains in the Genus database with same CATH topology
3QE1A 3CS7A 4BTTB 3QLPH 2ZU4A 3SNBA 1D3DB 3Q00A 1U37A 2ZZUH 1UK2A 2XTTB 2Z6BD 1L1GA 3ZVGA 2OQUA 5E0GA 4DURA 3W94A 1CA0C 2BDAA 4TPYA 5GWZA 2OXSA 2ZU2A 3LIWA 3LC3A 4JOPA 5HFCA 1Z8RA 2P59A 3RXMA 1INCA 4FUGA 4D7FA 1P8VC 4A6LA 1YKTA 3PDZA 2ANKH 4ABAA 1BA8B 3E3TA 3IWMA 3LH3A 1CHGA 1BIOA 1NS3A 4FVDA 1FY1A 2VINA 5HM2A 2QKUA 4CBNA 2CN0H 2FXRA 3KZDA 1PJPA 2CHAC 3DHKH 2RA3A 4MPVA 7GCHG 1SOTA 3A86A 2EI8A 4HZHA 3UR6A 3M3TA 1SB1H 2W3IA 3TMHA 2WYJA 1QCPA 3SHUA 4MNXA 2ZKSA 1TPSA 1Z86A 1AMHA 2REYA 2CV3A 2AMQA 3RXCA 1C1MA 3SU4A 4CR5A 3E0NB 1PPCE 1NPMA 2M10A 1GCDA 2VSVA 1MQ6A 1LKAA 1VITG 2QIQA 3LNXA 3GDUA 1O33A 1Y3WA 1O3DA 1CQQA 4AFQA 3HGPA 4AG1A 1UEQA 2PFEA 4IC6A 3SHCH 4JZ1A 3MU1A 1ARCA 2BD2A 4AB9A 1GHAF 3R68A 4ABIA 2WPKS 1C2JA 1TQ3A 2Q1JA 3RXOA 3LGIA 4X1NU 1O3GA 2KAIB 3RL8A 5D13A 2FI3E 1V2RT 2WPIS 2OMJA 1O2KA 3W95A 2WPMS 3HK6B 1P04A 3TSVA 4I33A 4BTIB 3OTPA 4NNMA 2I0LA 1UCYK 3TJVA 2F0AA 1AY6H 1TLDA 1EP6A 1ZHMA 1C1OA 4NMVA 5HFFA 5EU8A 3SU6A 5DJ7A 1AVGH 1ZTJA 3F1SB 2Z17A 3JXTA 1FONA 1UTOA 2P8OB 4X2VA 4YESB 3BPUA 1TGNA 3PV5A 1PPFE 1TONA 1RRKA 1ETRH 2AMDA 3Q3KA 3O8CA 1RTKA 1G3CA 2GZ7A 3FANA 1XKAC 1Z8IB 4YT7H 2R2WU 1O2ZA 1O2QA 3OTJE 3TSWA 1AWFH 1BMLA 2BZAA 1V2LT 2KJPA 2Z3EA 4BNRA 4DGJA 1O3LA 2C90B 4A1TA 4O3UA 1TQ7B 2A2XH 3MH6A 3FVFB 2D8IA 2A1DB 1HAIH 1WBGB 1TRNA 1GI2A 2GVFA 1A5GH 4K8BA 4JOEA 2VWMA 2JSNA 1UTPA 4X6OA 1FLEE 2JIKA 1FY5A 2B7DH 2PWXA 2GT8A 2Y5FA 4JJ0A 4Z8JA 3VEQB 3MTYA 2CMYA 1MTNC 1NZQH 3RC5A 2QG1A 4Q7YA 2FYRA 2Z9GA 3OYPA 2I6SA 1ZOMA 4Z0KA 2JWEA 3M5OA 3GCHB 2V1WA 3L4FD 3KGPA 3K1RA 1DSUA 2BD3A 4AGKA 3Q77A 2KG2A 1OWDA 4R8TB 1XXDA 3BIVH 1FI8A 1TB6H 2IPHA 3BTHE 3RXTA 1WI4A 4GHNA 1O5EH 1RGQA 3TNTA 4K60A 2PSXA 2QY0B 1N6DA 1ZPZA 4CRDA 1L0ZA 2FCFA 1MCVA 2XC5A 1GL0E 3U9AH 1ELAA 2E7KA 2BX4A 4FUCA 3ZZ4A 1O30A 3TGJE 3BEFB 1ELVA 1YP9A 2HNTC 3CC0A 1GBKA 2R2MB 1MC7A 5ABWA 1SQAA 3FP7E 2ZPSA 1KXDA 1YM0A 3MNSA 1DOJA 1MKWK 1TMTH 1G3BA 1GGDC 1HFDA 1W9OA 4NSVA 3SNDA 1P3CA 1W11U 4GLYA 1YGCH 4I8JA 1C5PA 4X8TH 1PQ8A 4B2BA 4I7YH 1FN8A 5EG4A 2QGRA 3UIRA 3ZVAA 1V2JT 4E7RG 1K2I1 1MZAA 1SLXB 2A2QH 2UWPA 1ZHPA 2Z3CA<