3GDVA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yqf peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
316
structure length
295
Chain Sequence
b'DSTDETPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 61
structure length 295
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdvA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA01
3RXVA 1L6OA 1WJLA 2E7KA 1KWAA 5F8TA 3SOSA 2BM2A 3SHWA 3PROA 2R2WU 3FVFB 1YBOA 1OKXA 3DT0H 1IQMA 1EKBB 1QL7A 2G4TA 2ZIQH 4ISLA 4QT8C 1O2KA 1AHTH 1H9IE 4Q2PA 1DY9A 2ZFRH 4TY6A 3UREA 1ELTA 3GISB 1KXDA 4INHA 2G5NA 3UR6A 2J94A 1WFGA 5T6DA 2FPZA 1QJ7B 2A31A 2G8TA 4CHAB 5FX5A 5PTPA 4Z0KA 2PTCE 4DG4A 1QTFA 1K9OE 3GOVB 3GCTG 2I4SA 4R8TB 1UTNA 3S9CA 8GCHF 1MC7A 5A8ZA 4DVAU 1O2IA 1TOCB 2OTVA 1GJ7B 3HATH 4GHQA 3I78A 3BIVH 2WPIS 2IJOB 3MH7A 4KTUA 4K72A 1GL0E 4X0WU 4NXPA 1GBEA 2A4OA 3T28A 1SOZA 4JZFH 2D2DA 2I0LA 5GCHG 4OGXA 3TJNA 2BTCE 1UM1A 5E11A 3V13A 4X2VA 4B75A 1A1RA 1BDAA 2XRCA 2QA9E 2EV8A 3U1IB 2EEIA 1HRTH 4U2WA 3ZZBA 1TNJA 1GJ8B 3PB1E 1IQEA 1GI2A 5E8EH 2ZHWH 2KOJA 1HAYB 1O5CB 5HF4A 2F91A 3OSYA 1O3HA 1S6FA 3BTWE 4WJG2 2KA9A 1FY3A 1YC0A 4ZXXH 1HCGA 2GT8A 2VIVA 5EZ0A 4Q7ZA 5EQSA 1IQLA 3UFAA 4NG9H 3EA7A 1DS2E 4K8YA 1GCDA 4K5ZA 3BTEE 2XWAA 2XWBI 1ELBA 2V6NA 1GJAB 1GI7B 1BQYA 1OWEA 1PYTC 4B2AA 1ZJKA 1EXFA 1D6RA 2A45B 3HGNA 1O35A 1HIAB 3F9FA 1BMAA 4F4OC 4FU9A 3BG4B 4KP0A 2EGKA 2UUFB 2BY5X 3VB7A 1GJ6A 1AUJA 2KJDA 2L97A 1TGSZ 1B8QA 1Q3PA 2GDEH 1L0ZA 1V2OT 4CH2B 1Z8GA 4TPYA 1AB9B 1UK3A 3BTFE 2TGTA 4Q2KA 5EXNA 1BBRH 5TJXA 2AEIH 1IAUA 4E06H 5L6NH 2ZEBA 2H1UA 1O2QA 2QY0B 1U38A 2ZFSA 1NY22 2UUJB 3QN7A 1FC9A 3SGQE 1KXBA 4X1RU 1O2LA 5DP3A 1JRSA 2OUAA 3S9AA 4CR5A 1C1RA 1SBWA 1YPLH 3OU0A 4NA8A 4AORA 3RU4E 5HEDA 1UEQA 3M5LA 5AFZH 2GGVB 3K2UA 4O3UA 4BNRA 1SC8U 2M5TA 1LKBA 1UTKA 3QDZB 2QV1A 1SGTA 1GMCG 1EATA 2J38A 1XUGA 2HLCA 1D3PB 2W5EA 4XFQA 2VINA 2VIPA 4NA7A 2Z3CA 2XC5A 1EPTC 2V3OH 2FOEA 2FYRA 3RXTA 5LPRA 5E6PB 2HOBA 3DIWA 2R9PA 1M5ZA 1C9TA 3SV6A 1G36A 3TK9A 3U98H 3JXTA 4VGCB 5L2ZH 2Z9GA 2G5MB 4WYTA 1KXFA 3SI3H 3MO6A 3QWCH 2BQ6B 4X8UH 4DGJA 4WF8A 2ZCLP 1HAVB 2O8UA 2JETB 2KJPA 3Q00A 5FPTA 4B2CA 3TSZA 1Y3VA 4FGMA 1U39A 1LTOA 2BDGA 3RXFA 2OCVB 2PKUA 5AVDA 3AASA 1V3XA 4YZUA 3HKJB 1H9HE 1ETTH 2Q6DA 4ZAEA 1TALA 1IQFA 1IHSH 1SGFG 3LNXA 3KZDA 2A4GA 1UFXA 2VH6A 1GBLA 4UD9H 5T3HA 2FIRH 4FUHA 4NIYA 1Y5BT 5TCCA 4ISHH 1BFEA 2PR3A 2BY9X 2WUCA 4I8KA 3UQVA 2ZP0H 2PGQB 5D13A 1K28D 3RXIA 2AWWA 2JIKA 2ASUB 1SGPE 3A8CA 4ZHLU 4OGYA 3A83A 1CQQA 1HFDA 4JOPA 4NSYA 4X1NU 3ID4A 2XC0A 2VVVA 5T6FA 2ZCKP 1CGJE 2OQ5A 1WI4A 5ESBA 1V2RT 2A7JA 2BLQA 3RXQA 4GVUA 1SG8B 4AG2A 2V90A 5DK1A 1HV7A 1P11E 1O3OA 1O2YA 3MU1A 3RXLA 4CRCA 5JBAS 3SU3A 5JYIA 2QN5T 2Q9VA 2AS9A 1HNEE 5EYZA 2PA1A 1GGDB 4X6PA 1DE7H 1J16A 2WINI 8KME2 1CHOF 1GPZA 2ZZUH 2W7SA 2FEQH 4Y8ZA 3QUMP 2VGCC 7ESTE 1HAXB 4ZXYH 5L2YH 1Q3XA 1O2PA 1F2SE 4GCHG 1TIOA 2D92A 3GY4A 4DURA 2SGEE 1G30B 1WBGB 4WH6A 3TMHA 4WWYA 1ELEE 2OBQA 1N1LA 1P2JA 1SFIA 1FCFA 5TCAA 4D7GA 3VQFA 1P04A 5F8XA 3ZVAA 4M7GA 1Y7NA 2JH5D 1DSTA 1Y5AT 4FU7A 3MH4A 1DWDH 3GJ9A 5DG6A 4A7IB 1GJCB 1O34A 1XUIA 2GCHF 1UHBA 2A2XH 3NZIA 4NNMA 1C5SA 1E37B 1FMGA 1O0DH 1VITG 3A8DA 5HETA 3E6PH 2I6QA 1A2CH 3Q3KA 1FXYA 3RXHA 2BXTH 1GDQA 3K9XB 2KYLA 2RA0A 1D3TB 1XUFA 4TYDA 1N7EA 5EGMA 1BB0B 1DOJA 1V2TT 3MU8A 2AWXA 3UPEA 4K6YA 4AB9A 4BXWA 1C4V2 3QTOH 2FCFA 1V1TA 3S0NA 2OMJA 3R68A 1V2PT 1QJ6B 5GJ4B 1C5TA 2BD2A 3NFKA 5J4QA 2P3FH 4AN7A 1PPCE 2OP9A 2FI5E 2J4IA 2SNWA 1HAGE 4MNYA 1T2MA 3D65E 3LH3A 1X5RA 3SUZA 1HJ8A 3ZVBA 4Y0YE 1VJAU 1LVMA 1SGRE 2Z3DA 5HM9A 1Z8JB 3MOCA 4UONA 3ELAH 1WQVH 1P12E 2FX4A 3SZNA 1N6XA 1MTUA 1PPEE 2CN0H 3ZYDA 3SNEA 1P9UA 3BIUH 2TGAA 3SV7A 3TGIE 1WAYB 3K6YA 3LGUA 2GP9B 4D76A 3R3GB 2VPHA 1O2VA 3MNXA 1MTNB 1MTWA 4DY7B 1HPGA 1THSH 7GCHF 3ATMA 1LQDB 5DP9A 3ATLA 1O3NA 4UFGH 2ZU1A 2XNIA 2BD8A 3TLOA 2AH4X 4CHAC 5E1YA 3QZQA 3BN9A 1EJAA 4JYTA 1J8AA 3AW0A 1ZMNA 2OGPA 2A5KA 2ZPLA 5T6GA 3SU2A 4X2YA 1V2UT 1NC6A 1DLEA 3O8CA 3MYWA 1VCPA 4LZ4B 9ESTA 1ETRH 4K1EA 2FM2A 4FUJA 1SI5H 3SHAH 1XXDA 1GBFA 1C5PA 4B76A 1QAVA 1CO7E 1GVKB 4WY3A 1K1NA 4HI3A 4TY7A 3SGBE 1Y59T 1LHEH 2Y81A 3K82A 4I8HA 3NUMA 4XBDA 1GI1A 1SGNE 3M3SA 1EP5A 2EDZA 1B0EA 1C5YB 1QJ1B 3A7TA 3OYPA 3SUGA 4O06A 2G4UA 4CR9A 2B5TB 4UFEH 2ZHDA 1A4WH 4NWLA 5SGAE 1U37A 2MX6A 3LOXA 5ABWA 1SGDE 3SW2B 2ZWLH 3LT3A 1SGFA 3KCGH 1FC6A 2CSSA 1DITH 1BRAA 3SI4H 1KY9A 1QAUA 1UVPA 2M0ZA 3KQDA 1IQHA 1CHGA 1BMMH 8GCHG 1X5NA 1C2IA 1YLDA 1BITA 1AGJA 3RXJA 2FLBH 1NTEA 1MKWH 3MNSA 2JILA 3ZVEA 1HUTH 5LH8A 5HM2A 1OP0A 2CF9H 1C4U2 3PDVA 1G3DA 1YPHC 4ASHA 1TBRH 3TNSA 3TGJE 3QLPH 2KOHA 4BTIB 1GBHA 4CBOA 4K1TA 3G01A 4CBNA 1ANCA 5CE1A 2H2ZA 3F1SB 4JOEA 1HAOH 1AB9C 1CBWC 1DT2A 1SQAA 1C2LA 2FLRH 2LC7A 2RRMA 3UR9A 4CRDA 2BD9A 1F0SA 2VSPA 3A88A 1J9CH 2SFAA 1LHGH 3SU1A 1Y3XA 4OS2A 3VB6A 2Z9IA 1GI8B 2BQWB 2PKAB 2SGPE 1TP3A 2P8OC 2OC0A 1EPTB 3FP6E 3L33A 1Z1IA 2HNTE 3UWJH 1HXEH 2C4FH 3DUXH 1O2WA 2P3TB 4A1VA 1O3MA 3K1RA 1UJ1A 1V2MT 3VPKA 4Q7YA 1NTPA 1P02A 2QXIA 1ANDA 3FP7E 3CS7A 2C3SA 2D26C 2ZDMA 1PDRA 2HNTC 5DJ7A 2ZGCA 1AZZA 1YCPK 2BYGA 3U9AH 3B8JA 5DGJA 2G81E 4B2BA 7KMEH 4KELA 2P16A 2I6VA 4WMDA 5DP7A 3ID1A 4I33A 1EUFA 3P17H 2EEKA 3O8BA 1H9LB 2PLXA 3BEFB 2W3IA 1GHVH 1O39A 4VGCC 2PKAA 4GUXA 4GVDA 2AGIX 1I16A 1ORFA 1ZGVA 3RDZA 2JXOA 4FUGA 2A2QH 2G55A 3B9FH 4G69A 3GY8A 1TX6A 1YKTA 1E36B 1WF7A 2A7CA 3ZZ8A 4ABIA 1O33A 3NK8A 1ELGA 1UVOA 3BTME 4AG1A 2GTBA 2G00A 1QB9A 3GY6A 5HGGA 1BJUA 1NU7B 4JMYA 1AU8A 4I8JA 3RM0H 1QL8A 3VEQB 1EQ9A 5A8YA 1MAXA 1LDTT 1PPGE 1I92A 5EXLA 1TONA 3BF6H 2F9BH 2R3UA 3MHWU 2Q6GA 1AWFH 2H2BA 1C1WH 1YPKH 3CH8A 2GD4B 1DFPA 1E35B 1T7CA 2KBSA 1X6DA 4TPIZ 1RJXB 2NU1E 1BTHH 2VGCB 3O5NA 2J2UA 2P3UB 2EAQA 3ID3A 4A1XA 1ARCA 4YYXA 1SHHB 1Z7KA 2KG2A 1Z6JH 1MBMA 4D8NA 2OQSA 1DANH 4UE7H 1MFLA 3PMAB 1UHPA 1WF8A 1C5XB 3EGKH 2IWPA 1GBBA 3BPUA 5C1YA 1NS3A 2FNEA 2FWWA 4B74A 1GI6A 2KQFA 1V2KT 4Y6DA 2VIOA 5HFEA 1P1DA 4NWKA 3VGCC 1MMJN 2KAIB 4J2YB 4YDPA 1NT1A 1WHDA 4B73A 2FS8A 4NMOA 5F6MA 1YPMH 1JIRA 1K21H 1QGFA 1C9PA 3LGIA 4ZKOU 3OY5U 2HGAA 3SV2H 1L2EA 4FUCA 5E22A 2VZ5A 2H9EH 3IG6B 3ZVFA 4AFUA 6CHAC 3SORA 2ZFFH 3KQCA 1G3BA 3EGGC 2BD7A 4H6SB 1A7SA 2BLOA 2GT7A 3V3MA 1INCA 2ZFPH 4Y8XA 1NRNH 3S69A 1EAWA 3SJ9A 2PDZA 1SFQB 5I25A 3PLKA 4D7FA 4NIWA 1LPZB 2XCNA 3ODFA 2OCSA 3KGPA 1UK4A 5AF9H 2QG1A 2J9NA 3SUEA 4X2XA 2VWRA 1B5GH 2G51A 2AYWA 2DE9A 5E2OA 1CHOG 4IMZA 3R0FA 1JXPA 1C1UH 1W11U 4GHNA 1ZJDA 1SB1H 2OSGA 2HVXA 2FOAA 2Q3GA 2W3KA 1W0ZU 1CE5A 3S9BA 2STBE 2VNTA 4JZDH 2DUCA 3GY7A 7LPRA 1W0YH 2G5VA 1CT4E 3MWIU 1FONA 2ZDNA 4YM9A 1TPSA 1C2JA 2VJ1A 1U6QA 1C1NA 2JWEA 1KIGH 3DJAA 1NFXA 3QO6A 1PFXC 3UTUH 3SQHE 3H5CB 2A1DB 4SGBE 1QBNA 1P8VC 2M0TA 5E21A 1GI9B 1T8NA 3A82A 4X6MA 1QBVH 1WIFA 1SQTA 1A5GH 4Q2OA 5H3JA 1LHCH 2GCHG 2WL7A 4Z8JA 2IWOA 5EG4A 4E7NA 1CA8B 3UUZA 5JPMH 4K78A 1ABJH 3ZZ3A 1V6DA 2IWNA 3PTNA 5GDSH 2BDIA 1GBAA 2P94A 2DMZA 1GJDB 1EB1H 1PYTD 4ZHAA 2Y5FA 3KQBA 1LVYA 1MTNC 1P10A 2P93A 2V35A 3GDUA 3LH1A 2D8IA 3MI4A 2H3LA 1A5HA 1CT2E 4MNVA 4J1YA 5DP4A 3SV8A 1CGHA 1NFYA 4DJZB 1MQ6A 5CHAB 2F5YA 1FAKH 4LXBH 4NZLA 2OQUA 1UJVA 1MH0A 1CGIE 3BTTE 1RRKA 4ABEA 4XDEA 1WOFA 1D3QB 3GYMA 2Z6BD 4X1PU 2YUYA 3H7TA 1A3EH 1KTTB 2W7UA 1TX8A 1QA7A 1RGQA 1ZZZA 4I8LA 2QKUA 3U8RH 3SNBA 2L4SA 1TMTH 4MPXA 2KOMA 1YYY1 2F9PA 2BD3A 4JYVH 3R69A 5G1DA 1C2GA 2PGBB 3L6PA 3OX7U 2SGQE 1UEWA 3MU4A 1KXCA 3PLBA 2VWLA 1SLVB 2LOBA 3A86A 2R0KA 4H42U 3V12A 4E3BA 1BHXB 3RXUA 4B1TA 5JBBS 1UMAH 1C5WB 2BVXH 1FDPA 4BANB 2EGOA 1UTOA 2J92A 1S0QA 3BTQE 2DKRA 5GXPA 1E38B 4TWYA 2GZ9A 1AO5A 7GCHG 1UVTH 2C8ZB 1T31A 2XTTB 4JZEH 1FN8A 5IDKA 1TQ7B 1O5DH 2ANYA 3E17A 2XC4A 1Y5UT 2SGAA 2YOLA 1TRNA 3URCA 1T8MA 4TWWA 1CBWB 4AMHA 2F9OA 1O2MA 5LPEA 4I32A 1BE9A 2WUBA 3HPMA 1GBCA 1G32B 1ZOKA 4Y71A 3RMNH 2PNTA 2O9QA 2P8OB 5HYOA 3V0XA 4NXRA 1UTLM 1VR1H 3RXDA 1MFGA 2FYQA 1L1NA 1G3EA 1PQ7A 4RN6A 5JB9S 1OWKA 1TP5A 2DC2A 3I1EA 5C1UA 1DLKB 2UWOA 2THFB 1G2LA 1T32A 3KL6A 4ZKSU 3F9HA 3M36A 2I04A 4JK5A 1GI0A 3BTKE 4BTUB 3K6ZA 1MZAA 4NXQA 2EEJA 4F8KA 3IITA 3ESTA 5B6LA 4Q3HA 5FPYA 1TWXB 2QXGA 1Y3WA 2EI8A 1SGIB 3MNBA 3STIA 1GBJA 3RU4T 3MO3A 1N99A 5DPAA 3PS4A 1ZHPA 2BXUH 2WPKS 1ARBA 2Z9LA 2QGRA 4UDWH 1O37A 1OPHB 1S6HA 4ABBA 3O46A 2GMTC 1DXPA 3PYHA 4H6TA 2P59A 3VB4A 1XKBC 1P3CA 2XBWA 4MTBA 1SQOA 3BV9B 3RMLH 1C5UA 2ZPMA 1V2VT 1OWJA 5DP8A 1MCTA 4ABDA 1G37A 2WYGA 4NFEA 4ESTE 5C67A 2V3HH 3A7ZA 3LPRA 3SBKA 1NFUA 1RZXA 2I0IA 1RGRA 4JOGA 1O3EA 2XW9A 2ZTYA 4UU5A 3CC0A 3P70B 1ZTLA 1O3KA 2HWLB 3FP8E 2YNBA 2LC6A 1ANEA 4NSVA 1O2JA 3EYDA 2Y82A 1DDJA 1WQSA 1P0SH 1YPGH 4AOQA 2GCTC 3ZVCA 3ZZ5A 1MQ5A 1YF4A 4ZKRU 5HJ1A 4LOYH 2C90B 2DB5A 3HK6B 3MU0A 3UIRA 1CA0B 2OC7A 3MFJA 1IU2A 2AMQA 4U30A 3GY5A 2FX6A 4IMQA 1BRCE 3LGTA 3SU4A 1O2OA 3Q3YA 1MD7A 1L1JA 3PTBA 1XVMA 1AVWA 1K32A 1P1EA 1ZTJA 9LPRA 3K65B 4YOIA 3JZ2B 1ABIH 3F9GA 2VWMA 1UHBB 3U69H 1P05A 4LZ1H 5EW2H 3GCHC 3NXPA 2BB4A 5BRRE 2QT5A 1FJSA 1DICA 2ZA5A 3VGCB 3IWMA 2F83A 1QNJA 2Y80A 2TRMA 2IPHA 4ABGA 1JRTA 5HFDA 1MU6B 1D5GA 1GMHF 3EQ0H 1LPGB 6GCHG 4K69A 3LDXH 3DFJA 1GHAF 1HAZB 1ZOMA 1TGCA 6CHAB 4R2ZA 1GI4A 1MUEB 1C1VH 1QL9A 3A7YA 3DA9B 1DPOA 2QF3A 1FY4A 2Y7ZA 4ISNA 1W9QA 2PSYA 2ANWA 4U01A 1X7AC 4X6OA 1YPJH 2EI7A 3KF2A 1AQ7A 1O31A 3BTHE 3DHKH 1OXGA 3U8OH 3R0HA 5FPSA 2K1QA 3KEEA 1C2KA 1C1SA 5F8ZA 1GHYH 2OBOA 1UTJA 2LUIA 1TQ3A 1MTSA 3SNCA 1SLUB 1DWCH 1O5BB 4CRAA 4JK6A 1SVPA 3E0PB 1P2QA 2ANKH 1GDUA 2Q6FA 2AMPA 1AUTC 2IOTA 2ZU3A 1G3CA 1ID5H 2DM8A 3NPSA 5GPIB 3KHVA 2D90A 1GCTC 4LK4A 3EGHC 3GCTF 2AINA 3I18A 4MVNA 4NFFA 2R3YA 3B76A 1A0JA 4YO9A 3TPIZ 1C5NH 2ZPRA 5E0GA 2BVRH 3A8BA 1BT7A 3C1KA 4FUFA 2FOBA 4OAJA 1A5IA 3SJ8A 2BLWA 1OZIA 3RXOA 1E34B 5J4SA 3DJ1A 4O03A 3TNTA 2FI4E 1LVOA 1S82A 1AI8H 2BDCA 1W3CA 2GZVA 1QAVB 5DO4H 1GQ5A 4ISOA 3NGHA 4AX9H 1MD8A 1QQ4A 2R2MB 1RTKA 1WU1A 1SPJA 2F9VA 1SR5C 2TBSA 4A5TS 5C5NA 1RXPA 4Q2QA 3PMJA 2WPJS 4IGDA 3SOEA 2RDLA 3QGNB 4N6XA 2TPIZ 2ZQ1A 3TITA 1AWHB 1C1OA 3PV5A 1TLDA 5FB8C 2A5IA 2PFEA 3RXMA 1O2TA 3SHUA 3NCLA 1TABE 1TPOA 1UCYK 1HDTH 1SSXA 2HPPH 4RI0A 1VB7A 1S83A 2A5AA 3RXEA 3T27A 1TNHA 1W7GH 3UY9A 1UJDA 2NU2E 2PKTA 1UTPA 4SGAE 3TK6A 1BTXA 1YP9A 1HAIH 1GVZA 5E0JA 1OYTH 3ZZAA 1YPEH 4FUIA 4ABHA 1NRRH 2PHBA 5I46H 1WFVA 3DFLA 3EA8A 1XMNB 4HZHA 5CHAC 3ZZCA 3GYLB 3GICB 1LQEA 1GWAA 3UNRA 1NM6A 2FO9A 1GBKA 1BZXE 1OWIA 1SGQE 1LKAA 4CRBA 1F0RA 4GHTA 1DWBH 1EOLA 1C5QA 4WYUA 2Z3EA 5K7RA 1TGBA 1C5LH 3ATWA 1QRZA 1Q3OA 4D9QA 4Y76A 3PO1C 3GY2A 4NA9H 3BEIB 1AN1E 1LO6A 1AE8H 3ITIA 3GDSA 1AKSA 3S7KB 3CP7A 1O5EH 4Y8YA 4WXIA 1SLWB 1W9EA 2PUXB 1JIMA 1GMCF 2ZG0H 1NU9A 2GV6A 2HGTH 4D9RA 3T29A 4R0IA 2H6MA 4DOQA 4X1QU 3SNDA 3GDVA 1C5OH 1SGYE 1HBTH 1F7ZA 1T8LA 2ZECA 3TU7H 2OZFA 1O2GH 1IQGA 3WY8A 3Q76A 2UWLA 5EQRA 3TVJB 2G2LA 1ZSJA 3GGEA 3HKIB 3UNQA 3SJKA 1O30A 1RIWC 1F0TA 4NMQA 1OBXA 1IQNA 4Q7XA 2ZGJA 1GG6C 3TJUA 1K1MA 1O3LA 3ZZ7A 1C1MA 3SO3A 4BAHB 5EW1H 2QC2A 1AFEH 4Y7BA 3ZZ6A 2P95A 3EE0B 2GV7A 1JMOH 1ZR0A 2ZPQA 5JBCS 1O38A 3C27B 1AE5A 1TPPA 1O2HA 1UTMA 2JREA 1UCYE 4IC6A 2B9LA 2AGGX 2O8LA 4WH8A 4P2AB 2F9UA 1SMFE 4MLFB 5C2ZA 1FIWA 1TAWA 1ZGIA 4X8SH 3PMHB 3RXCA 3LGYA 2WYJA 3ZYEA 3U1JB 4BXSA 2GMTB 1V2ST 3E16B 4NMRA 1WSSH 2QXHA 2BDAA 1V5LA 1U3BA 1IQJA 3TIUA 1KDQA 1PPZA 2JH0D 1QCPA 1AVGH 1QR3E 2FESH 2ZGHA 2Y7XA 3LNYA 3SFJA 3P8GA 1FIZA 2BDHA 4Y79A 4IC5A 1EASA 2K1ZA 4LMMA 2KV8A 5FX6A 3RXKA 4YLQH 3KN2A 1O2XA 3M3VA 2I1NA 1C5ZB 2OD3B 3AVZA 1DVAH 2G52A 4K1SA 4INLA 2O2TA 1ZYOA 4WMEA 3N7OA 3UNSA 4HTCH 4OS1A 1GHBF 1J14A 1O3PB 1YCPH 2VRFA 2QBWA 5FHTA 1C2HA 5HFFA 1LHFH 3RXGA 2GCTB 1XM1A 2FN5A 2ALPA 2AWUA 1C1PA 2BDBA 1EZQA 3AXAA 1OP2A 3MU5A 1C4Y2 4MNXA 4Q6HA 1IHJA 1CVWH 2A32A 3DD2H 2M10A 2XXLA 1W13U 3TJVA 1B7XB 1GBDA 1XX9A 1ZUBA 2TGDA 2SGDE 2UWPA 1F92A 3ZZ4A 2ZO3H 2Y5GA 2ZPSA 1O3IA 4F49A 1LHDH 2KL1A 2ZDLA 1C1QA 4AFQA 2HE2A 2VVCA 1V62A 3WKMA 4HGCA 3M5OA 4P0CA 3BEUA 3M7UA 3ZZDA 5A0AE 4FU8A 3A85A 3GCHB 1DM4B 3U8TH 3MMGA 5L30H 1CA0C 2PKSC 4IN1A 1FUJA 2M0UA 3PDZA 1GJ9B 1OP8A 2PSXA 3D23A 1RY4A 1V2QT 4E7RG 1EJMA 4KGAA 1P2KA 3RC5A 1ESBA 2R4HA 1TMUH 1VGCC 1BMNH 1V2WT 4CRFA 5JBTA 1C2EA 2OC8A 4K3JA 2EDVA 1AFQC 1W7XH 4OS5A 4XSKU 2CJIA 3ZZ9A 1O3JA 1G9IE 3F68H 1MKXK 1ZSLA 4JL7A 3A8AA 1W12U 1P01A 3PLPA 1Q7XA 2IN2A 2RCEA 2WPMS 4AFSA 1FC7A 1UK2A 3RMMH 4DCDA 1ZPZA 1JWTA 1P3EA 4AGKA 2ZDKA 2ZI2H 2LNCA 1EAXA 4YLUA 4NMSA 1T8OA 4I31A 2FOHA 4X8VH 3LKWA 1SOTA 2F3CE 2ESTE 4WVPE 1GL1A 1L4DA 1QRXA 1EAUA 4Y0ZE 1LPKB 1HGTH 2EI6A 2JKHA 2ANMH 2FOMB 2AFQB 4ZUHA 1V2LT 3A7WA 1AIXH 1GCTB 2BDYA 1N8OC 3SV9A 1FNIA 2D8WA 1HYLA 3RL7A 1O2ZA 1TA2A 1AY6H 3TH2H 2DLSA 4B71A 1TNIA 4DW2U 1L1GA 3A81A 1TNGA 2VWOA 1AZ8A 4KTCA 1KYNA 4K60A 2HE4A 4YT6H 4NIXA 1M9UA 3OY6U 1GMHG 2EEHA 4X6NA 1NF3C 1FPCH 2V0BA 4BAMB 2GZ7A 2Y6TA 2ZU5A 3MH5A 4BOHA 2UZCA 2ZHFH 4BTTB 1EP6A 1K1IA 4Q80A 1PJPA 5FAHA 3TH3H 1VJ6A 4CREA 3LJJA 1EZXC 1XVOA 1TE0A 2NU0E 5BPEA 3V7TA 3SNAA 2QKVA 1ZLRA 1LCYA 3T2NA 5FCKA 3P8FA 5G4BA 6ESTA 1GMDF 1MBQA 2YT8A 1HJAB 4JCNA 2X7ZA 5HFBA 1O2RA 1VCWA 1C5VA 2WV5A 4THNH 5JDUB 1BTYA 2BD5A 2ZFTA 3P8OA 2ZFQH 2PW8H 4YT7H 1PPHE 3JZ1B 1O32A 1A61H 3ZRTA 2FI3E 4AGJA 5DKMA 1C1TA 2ZDVH 5IYTA 1VA8A 1NRSH 2YT7A 3ATIA 5E0HA 1GJ5H 4DT7B 1KLTA 2JH6D 1XZ9A 4UU6A 2ZKSA 4FUDA 1N6DA 1GBIA 4HOPA 1O2SA 1Y3YA 1VITH 3MNCA 3STJA 1YBWA 4FUBA 1W10U 2B8OH 3DJ3A 3PO1B 3GCOA 2M3MA 2M0VA 2CHAB 5H4IB 2ZNKH 1S84A 2QYIA 1NFWA 3LONA 4MNWA 5JXBA 4NMVA 1P57B 1BRUP 1H4WA 3EAJA 1ZSKA 4I7YH 2LPRA 1FQ3A 1JOUB 2W26A 4WXVA 1Q2WA 4MG3A 1QRWA 2J34A 2ZHEH 2GKVE 1HAPH 1ELFA 2BX3A 3A80A 4IS5A 2EA3A 1O3CA 4O97A 2H5DA 2UUKB 3TGKE 3HPKA 1BIOA 2Q1JA 1S0RA 2FOFA 5HMAA 3RU4D 2MHOA 3RUOA 2OINA 4ZKNU 4XBBA 4XHVA 1O3AA 1A3BH 2HALA 1EB2A 2ZC9H 3ATKA 1QB6A 1A0HB 2QXJA 4OS6A 1RIWB 2L4TA 1B0FA 1BA8B 1GG6B 3SN8A 4YESB 1BBRK 1PPFE 1HAHH 2REYA 1UEPA 1F0UA 4JOJA 1SLXB 2C93B 3HPTB 3M3TA 4AYYB 4DIHH 4MPVA 2BX4A 2ZGBH 5FBIA 1O2NA 2CSJA 3L3TA 2VIDA 1J17T 1NPMA 1BCUH 3Q3XA 5F3XA 4YTAA 1XXFA 3RXRA 3MH6A 1MTVA 4JOHA 4BAOB 3ID2A 1D4PB 4KFWA 1YCPM 3RLYH 1SL3A 4FVBA 2KPLA 1FV9A 2C8XB 1Z86A 2VIQA 2AGEX 2EC9H 4FUEA 5DP6A 2JOAA 1UVSH 2QKTA 4Q2NA 1BRBE 3LC5A 2OC1A 1L4ZA 3I4WA 3BTGE 3QK1A 1EJNA 1H1BA 3PM3A 3PV2A 1TYNA 4IW4E 1FLEE 3CBYA 2DJTA 4K75A 3M7TA 5EU8A 5F67A 1EZSC 3UOPA 1Y3UA 1HIAA 3FY5A 3CS0A 1TOMH 5FBEA 1DX5M 5HXFA 2FODA 3QTVH 1TFXA 3ODDA 4E34A 2NWNA 1W8BH 4EDJA 4ZROA 3RMOH 2BZAA 5C1XA 1Y8TA 2QF0A 1OX1A 1WI2A 3LJOA 1DY8A 1AVXA 1JBUH 4NNLA 1KLJH 1N6YA 1S85A 3LC3A 3SJIA 3QIKA 2VU8E 4GPGA 4AYVB 3QJNA 5G1EA 2WPHS 1W2KH 4GVCA 1P2MA 1YGCH 5HEYA 1BHXF 1QHRB 1XKAC 2BY8X 1WH1A 2ZU2A 1LVBA 2AMDA 3UQOA 1OWDA 1QY6A 4AZ2B 2Z94A 1BBRE 1GJ4H 3CBZA 1W14U 3RC6A 4YOGA 1ELAA 1K1LA 1QLCA 2GZ8A 2XBYA 1UITA 1GI5A 5CMXH 1P9SA 1O3DA 2PKSB 2QCYA 4RKOB 3GSLA 5C5OA 1WV7H 2H2CA 1VAEA 5DP5A 4OS4A 1TMBH 2EEGA 1RGWA 5EPYA 1KTSB 4A92A 1O36A 3I29A 1VGCB 3AW1A 3M5MA 1FAXA 1EX3A 3H7OA 2BOKA 1EAIA 4GAWA 2B0FA 1AFQB 4MDSA 3KIDU 3SQEE 1VCQA 2VIWA 3VFEA 1SGEE 4HFPB 1WYKA 1HAVA 1CU1A 2KJKA 4ZHMU 6LPRA 3Q77A 1Z6EA 3D49H 1S81A 2F9NA 3E90B 3W95A 1GHBG 1GHXH 1T4UH 4Z6AH 5C20A 2H5CA 2HNTF 1QIXB 5HDYA 1FY1A 3M35A 3RLWH 4REYA 3A84A 1TA6A 2BQ7B 2GX4A 3RXAA 1G9OA 2ULLA 4XOJA 2O8MA 4MQAA 8LPRA 2ILNA 2EHRA 3FFGA 2FP7B 3SGAE 1K1JA 1SGCA 3SUDA 2XYAA 4AB8A 1BTWA 3L4FD 1UF1A 4KFVA 4X8TH 1O5GH 3RP2A 2C8WB 1N8OB 3KQEA 3NFLA 1UM7A 2BVSH 1ESAA 1A0LA 1K1PA 3KHFA 3QJMA 3S7HB 3T25A 1OYQA 3E1XB 1UJUA 3OTJE 2GDDA 2FTMA 1O3FA 4NGAH 1IQIA 1CSOE 3LU9B 1NN6A 1GI3A 2FE5A 1ZPBA 4INKA 1K2I1 3M61U 4YOJA 1BJVA 4GSOA 4CRGA 2ZDAH 4NCYA 3QGJA 3TK5A 1KXAA 1ZMLA 3RXSA 1DSUA 1QFKH 2RG3A 1THPB 5F03A 1Q31A 1TB6H 4KKDA 5FCRA 2EDPA 4ISIH 1KEFA 4ABFA 3ZV8A 2KAWA 2BZ6H 2EGNA 1GBMA 1F5LA 2YUBA 2WV4A 1FY5A 1UVUH 4X1SU 4Y11E 1GDNA 3P8NA 4RSPA 2NU3E 3LGVA 1DUAA 2ALVA 1P09A 1THRH 4E05H 5ESTE 5LGOA 5GCHF 1GQ4A 3HVQC 3RM2H 5EXMA 2VSVA 4XBCA 1T4VH 1RFNA 4NMTA 1IQKA 3RC4A 1NZQH 1P06A 1BUIA 4I8GA 1N6EA 2XBXA 3VXEH 1Z8RA 2LA8A 1W9OA 5EPNA 1ETSH 4O9VA 1HJAC 1QBOA 3SUFA 4NMPA 2TIOA 5I7ZA 3MTYA 1GBTA 1AKSB 1N6FA 3BG8A 1KXEA 1PQAA 1TBZH 1H8DH 3B23B 1Z87A 1LMWB 2RA3A 3ENSB 2PWXA 2CV3A 1ELVA 1E0FD 2BMGB 3QDOA 4K2YA 1F5KU 2F0AA 1VJ9U 2Z17A 1ZHRA 1D6WA 1BTUA 3SHCH 3BTDE 1UEZA 3KZEA 3ZVGA 1ANBA 1ELDE 1UCYH 3EDXB 2JINA 3E0NB 1XUKA 3FANA 2YTWA 4K76A 1V2NT 1FZZA 1RS0A 2FS9A 1O3BA 2FZZA 2FOCA 2AIQA 2Z7FE 2AIPA 1V6BA 4NZQA 2PUQH 2CHAC 1HJ9A 4BAKB 1GMDG 3P92A 4CH8B 3VB3A 3I77A 5A8XA 1S5SA 1MAYA 3A89A 1D3DB 1NRQH 1TGTA 3PWCA 1MKWK 3CYYA 1ESTA 5GIBA 2A4QA 1WHAA 1WTHD 2FOGA 4RKJB 2HPQH 2STAE 2IWQA 3GCNA 4UEHH 4K8BA 2VH0A 1C2FA 3UOUA 2QIQA 2BY6X 1KDQB 1YPHE 2ZGXH 1QQUA 4GLYA 4BAQB 5GNDA 1QA0A 4AFZA 1DUEA 3E3TA 1TPAE 4E35A 2A0QB 2ZHQH 4Z33A 1K1OA 1UTQA 3HK3B 1OS8A 2ZU4A 5HF1A 2C8YB 1BTZA 2OLGA 5FXLA 5HFCA 2BY7X 3BG4C 3M37A 3URDA 1SHYA 4ABJA 1IU0A 3SU6A 5A09A 1AD8H 5AFYH 3EA9A 3O8DA 4IN2A 2ODPA 4JZIA 4H4FA 2H9HA 1C2MA 1DXWA 3P6ZB 4X2WA 2FXRA 1DWEH 5JB8S 1IOEA 5A2MH 2B7DH 4U32A 3M7QA 3RL8A 1PQ8A 2EXGA 1HXFH 3LGWA 1Z8IB 3RLEA 2YNAA 1TGNA 1RTLA 3RXBA 4A6LA 4MPUA 4KTSA 4ABAA 4PQWA 1ZPCA 2ZTXA 2BYAX 3FZZA 1VZQH 4L8NA 2OS6A 4Q6SA 1KSNA 2CXVA 2OPGA 1TQ0B 1CT0E 3ZVDA 4OEOA 1FY8E 1K22H 2A7HA 3SU5A 3E8LA 4DIIH 3T26A 2PZDA 3F9EA 4H11A 1HB0B 1O2UA 2J95A 2Z9KA 1O3GA 2TGPZ 3LIWA 3CBXA 1ZMJA 2A4RA 1WCZA 1ZHMA 3K50A 1X5QA 1RTFB 1GM1A 4JYUH 2FMJA 3PWBA 4ZMAH 2VVUA 2P3WA 1C5RA 3AAUA 1NRPH 1EZUC 1C5MD 8ESTE 4XE4A 5B6OA 1P2OA 2ENOA 1TNKA 1Z1JA 3SU0A 2VB0A 4MPWA 5EQQA 3F6UH 2ZTZA 1QB1A 1KLIH 4OEPA 1EPTA 3E91A 4JOFA 3HGPA 1WG6A 3UWIA 2R0LA 1V2JT 4GCHF 1OWHA 5LPFA 3TJOA 1N7FA 2JETC 2ZQ2A 1G2MA 5C3NA 6GCHF 5HEBA 4FVDA 3QE1A 1ZTKA 1BOQA 4IBLH 4JORA 1AMHA 1GVLA 1WUNH 2ZF0H 3WKLA 2H3MA 1O5FH 2SGFE 1QURH 3PMBB 5ETXA 2WPLS 4PROA 1TRMA 2PTNA 1NESE 4OS7A 2CGAA 3BSQA 1H8IH 5GLJA 4UFFH 1GHZA 2CS5A 1OSSA 2BLVA 3MO9A 4ZH8A 3PV4A 4JOKA 1TRYA 3M5NA 1D9IA 4NIVA 1VITF 5E2PA 3TH4H 5GWZA 1BTPA 3CENA 1C2DA 4O3TA 4WMFA 3SJOA 2KRGA 1FI8A 2ZCHP 1EOJA 3NWUA 1P2NA 3VB5A 1MU8B 2H9TH 5EODA 2EJYA 2DLUA 2AERH 5A0BA 2W7RA 3O8RA 3NKKA 3QX5H 1HLTH 1YM0A 3T62A 4JZ1A 1R6JA 4Y7AA 3DORA 1J15A 1PQ5A 4MPAA 2D1JA 1WTGH 1OBZA 1F5RA 1IHTH 5DTHA 2XBVA 5K0HA 3TSWA 2XCFA 3FAOA 2ODYB 1Z71A 2VWNA 2V1WA 1NO9H 2CF8H 1GGDC 3A7XA 1FN6A 1A46H 3OTPA 2ODQA 3P95A 2FTLE 2BD4A 1ZRBA 1TNLA 3GY3A 1OBYA 1MCVA 2I6SA 4UFDH 2GVFA 1MKXH 1X8SA 3QZRA 2W4FA 5EOKA 3FZDA 1V5QA 1UO6A 3QGLA 2HRVA 2UUYA 2Z9JA 2RCZA 1PPBH 1O5AB 2CMYA 2BHGA 1P2IA 3VXFH 2Y5HA 5A0CA 4FXGH 3KNXA 3VQGA 4Y10E 1ELCA 2FDAA 1P03A 1N7TA 2SNVA 3A7VA 1YLCA 1GJBB 1ZRKA 3TSVA 2NU4E 3A87A 1XUJA 1TBQH 2BOHB 4A1TA 1TX7A 1X45A 3AAVA 1XUHA 3ZV9A 1MZDA 2O8TA 2OXSA 3RXPA 2DAZA 1ACBE 1FPHH 2QAAA 1NROH 1GHAG 1RD3B 3T5FH 5A2PA 1BMLA 2PV9B 3D62A 2KPKA 2O8WA 2KAIA 3W94A 5AHGH 2DE8A 1GHWH 1OOKB 2K20A 4HOPB
chains in the Genus database with same CATH superfamily
3RXVA 1L6OA 1WJLA 2E7KA 1KWAA 2QE7D 5F8TA 3SOSA 2BM2A 3FOAA 3SHWA 3PROA 2R2WU 3F0PA 3FVFB 1YBOA 1OKXA 3DT0H 1IQMA 1EKBB 1QL7A 2G4TA 2ZIQH 4ISLA 4QT8C 1O2KA 1AHTH 1H9IE 4Q2PA 5IK2D 1DY9A 2ZFRH 4TY6A 4RT1A 3UREA 2KCAA 1ELTA 3GISB 1KXDA 4INHA 5C0TA 2G5NA 3UR6A 2J94A 1WFGA 5T6DA 2FPZA 1QJ7B 2A31A 2G8TA 2J97A 5FX5A 4CHAB 5PTPA 4Z0KA 2PTCE 4DG4A 1QTFA 1K9OE 5ILBA 3GOVB 3GCTG 2I4SA 4R8TB 1UTNA 3S9CA 8GCHF 1MC7A 5A8ZA 4DVAU 1O2IA 2QF5A 1TOCB 2OTVA 1GJ7B 3HATH 4GHQA 3I78A 3BIVH 2WPIS 2IJOB 3MH7A 4KTUA 4K72A 1GL0E 4XD7D 5B42A 4X0WU 4NXPA 1GBEA 2A4OA 3T28A 1SOZA 4JZFH 2D2DA 2I0LA 5GCHG 4OGXA 3TJNA 2BTCE 1UM1A 5E11A 3V13A 4X2VA 4B75A 3N7EA 1A1RA 1BDAA 2XRCA 2QA9E 2EV8A 3U1IB 2EEIA 1HRTH 4U2WA 3ZZBA 1TNJA 1GJ8B 3PB1E 1IQEA 1GI2A 5E8EH 2ZHWH 2KOJA 1HAYB 1O5CB 5HF4A 2F91A 3OSYA 1O3HA 1S6FA 3BTWE 4WJG2 2KA9A 1FY3A 1YC0A 4ZXXH 1HCGA 2GT8A 2VIVA 5EZ0A 4Q7ZA 5EQSA 1IQLA 3UFAA 4NG9H 3EA7A 1DS2E 4K8YA 1GCDA 4K5ZA 3BTEE 2XWAA 2XWBI 1ELBA 2V6NA 1GJAB 2M2AA 1GI7B 1BQYA 1OWEA 1PYTC 4B2AA 1ZJKA 1EXFA 1D6RA 2A45B 3HGNA 3OEED 1O35A 1HIAB 3F9FA 1BMAA 4F4OC 4FU9A 3BG4B 4KP0A 4B6FA 2EGKA 5C0UA 2UUFB 2BY5X 2QF4A 3VB7A 1GJ6A 1AUJA 2KJDA 2L97A 1TGSZ 1B8QA 1Q3PA 2GDEH 1L0ZA 1V2OT 4CH2B 1Z8GA 4TPYA 1AB9B 1UK3A 3BTFE 2TGTA 4Q2KA 5EXNA 1BBRH 5TJXA 2AEIH 1IAUA 4E06H 2YMSC 5L6NH 2ZEBA 2H1UA 1O2QA 2QY0B 1U38A 2ZFSA 1NY22 2UUJB 3QN7A 1FC9A 3SGQE 1KXBA 4X1RU 1O2LA 5DP3A 1JRSA 2OUAA 3S9AA 4CR5A 1C1RA 1SBWA 1YPLH 3GABA 3OU0A 4NA8A 4AORA 3RU4E 5HEDA 2W6JD 1UEQA 3M5LA 2RFKC 5AFZH 2GGVB 3K2UA 4O3UA 4BNRA 1SC8U 2M5TA 1LKBA 1UTKA 3QDZB 2QV1A 1SGTA 1GMCG 1EATA 2J38A 1XUGA 2HLCA 1VKYA 1D3PB 2W5EA 4XFQA 2VINA 2VIPA 4NA7A 2Z3CA 2XC5A 1EPTC 2V3OH 2FOEA 2FYRA 3RXTA 5LPRA 5E6PB 2HOBA 4F55A 3DIWA 2R9PA 1M5ZA 1C9TA 3SV6A 1G36A 3TK9A 3U98H 3JXTA 4VGCB 5L2ZH 2Z9GA 2G5MB 4WYTA 1KXFA 3SI3H 3MO6A 3QWCH 2BQ6B 4X8UH 4DGJA 4WF8A 2ZCLP 1HAVB 2O8UA 2JETB 2KJPA 3Q00A 5FPTA 4B2CA 3TSZA 1Y3VA 4FGMA 1U39A 1LTOA 2BDGA 3RXFA 2OCVB 2PKUA 5AVDA 3AASA 1V3XA 3OEHD 4YZUA 3HKJB 1H9HE 1ETTH 2Q6DA 4ZAEA 1TALA 1IQFA 1IHSH 1SGFG 3LNXA 3PRBA 3KZDA 2A4GA 1UFXA 2VH6A 1GBLA 4UD9H 5T3HA 2FIRH 4FUHA 4NIYA 1Y5BT 5TCCA 4ISHH 1BFEA 2PR3A 2BY9X 2WUCA 4I8KA 3UQVA 2ZP0H 2PGQB 5D13A 1K28D 1S6LA 2AWWA 2JIKA 3RXIA 2ASUB 1SGPE 3A8CA 1FX0B 4ZHLU 4OGYA 3A83A 1CQQA 1HFDA 4JOPA 2K0QA 4NSYA 4X1NU 3KDKA 3ID4A 2XC0A 2VVVA 5T6FA 2ZCKP 1CGJE 2OQ5A 1WI4A 5ESBA 1V2RT 2EQNA 2A7JA 2BLQA 3RXQA 4GVUA 1SG8B 4AG2A 2V90A 5DK1A 1HV7A 1P11E 1O3OA 1O2YA 3MU1A 3RXLA 4CRCA 5JBAS 3SU3A 5JYIA 2QN5T 2Q9VA 2AS9A 1HNEE 5EYZA 2PA1A 1GGDB 4X6PA 1DE7H 1J16A 2WINI 8KME2 1CHOF 1GPZA 2ZZUH 3KYGA 2W7SA 2FEQH 4Y8ZA 3QUMP 2VGCC 7ESTE 1HAXB 4ZXYH 5L2YH 1Q3XA 1O2PA 1F2SE 4GCHG 3DSOA 1TIOA 2D92A 3GY4A 4DURA 2SGEE 1G30B 1WBGB 4WH6A 3TMHA 4WWYA 1ELEE 2OBQA 1N1LA 1P2JA 1SFIA 2GEFA 1FCFA 5TCAA 4D7GA 3VQFA 1P04A 5F8XA 3ZVAA 4M7GA 1Y7NA 2JH5D 1DSTA 1Y5AT 4FU7A 3MH4A 1DWDH 3GJ9A 5DG6A 4A7IB 1GJCB 1O34A 2WPDD 1XUIA 2GCHF 1UHBA 2A2XH 3NZIA 1W0JD 4NNMA 1C5SA 1E37B 1FMGA 1O0DH 1VITG 3A8DA 5HETA 1MABB 2I6QA 3E6PH 1A2CH 3Q3KA 2JJ2D 1FXYA 3RXHA 2BXTH 1GDQA 3K9XB 2KYLA 2RA0A 1D3TB 1XUFA 4TYDA 2JSNA 1N7EA 5EGMA 1BB0B 1DOJA 1V2TT 3MU8A 2AWXA 3UPEA 4K6YA 4AB9A 4BXWA 1C4V2 3QTOH 2FCFA 1V1TA 3S0NA 2OMJA 3R68A 1V2PT 1QJ6B 5GJ4B 1C5TA 2BD2A 3NFKA 5J4QA 3FO8D 2P3FH 4AN7A 1PPCE 2OP9A 2FI5E 2J4IA 2SNWA 1HAGE 4MNYA 1T2MA 3D65E 3LH3A 1X5RA 3SUZA 1HJ8A 3ZVBA 4Y0YE 1VJAU 1LVMA 1SGRE 2Z3DA 5HM9A 1Z8JB 3MOCA 4UONA 3ELAH 1WQVH 3WWBA 1P12E 2FX4A 3SZNA 1N6XA 1MTUA 1PPEE 2CN0H 3ZYDA 3SNEA 1P9UA 3BIUH 2TGAA 3SV7A 3TGIE 1WAYB 3K6YA 3LGUA 2GP9B 4D76A 3R3GB 2VPHA 1O2VA 3MNXA 1MTNB 1MTWA 4DY7B 1HPGA 1THSH 7GCHF 3ATMA 1LQDB 5DP9A 3ATLA 1O3NA 1UW7A 4UFGH 1SKYE 2ZU1A 2XNIA 2BD8A 3TLOA 2AH4X 4CHAC 5E1YA 3QZQA 3BN9A 1EJAA 4JYTA 1J8AA 3AW0A 1ZMNA 2OGPA 2A5KA 2ZPLA 5T6GA 3SU2A 4X2YA 1V2UT 1NC6A 1DLEA 3O8CA 3MYWA 1VCPA 4LZ4B 9ESTA 5HIZA 1ETRH 4K1EA 2FM2A 4FUJA 1SI5H 3SHAH 1XXDA 1GBFA 1C5PA 4B76A 1QAVA 1CO7E 1GVKB 4WY3A 1K1NA 4HI3A 4TY7A 3SGBE 1Y59T 1LHEH 2Y81A 3K82A 4I8HA 3NUMA 4XBDA 1GI1A 2OK5A 1SGNE 3M3SA 1EP5A 1WDIA 2EDZA 1B0EA 1C5YB 1QJ1B 3A7TA 3OYPA 5DSFA 3SUGA 4O06A 3SYJA 2G4UA 4CR9A 2B5TB 2KFWA 3MQKC 4UFEH 2ZHDA 1A4WH 4NWLA 5SGAE 1U37A 2MX6A 3LOXA 5ABWA 1SGDE 3SW2B 2ZWLH 3LT3A 1SGFA 3KCGH 5KECA 1FC6A 2CSSA 1DITH 1BRAA 3SI4H 1KY9A 1QAUA 1NBMD 1UVPA 2M0ZA 3KQDA 1IQHA 1CHGA 1BMMH 8GCHG 1X5NA 1C2IA 1YLDA 1BITA 1AGJA 2F4LA 3RXJA 2FLBH 1NTEA 1MKWH 3MNSA 2YMSB 2JILA 3ZVEA 1HUTH 5LH8A 5HM2A 1OP0A 2CF9H 1C4U2 3PDVA 1G3DA 1YPHC 4ASHA 1TBRH 3TNSA 3TGJE 3QLPH 2KOHA 4BTIB 1GBHA 4CBOA 4K1TA 3G01A 4CBNA 1ANCA 5CE1A 2H2ZA 3F1SB 4JOEA 1HAOH 1AB9C 1CBWC 1DT2A 1SQAA 1C2LA 2FLRH 2LC7A 2RRMA 3UR9A 4CRDA 2BD9A 1F0SA 2VSPA 3A88A 1J9CH 2SFAA 1LHGH 3SU1A 1Y3XA 4OS2A 4Q63A 2Z9IA 1GI8B 2BQWB 2PKAB 2SGPE 1TP3A 2P8OC 2OC0A 1EPTB 3FP6E 3L33A 1Z1IA 3WWFA 2HNTE 3UWJH 1HXEH 2C4FH 3DUXH 1O2WA 2P3TB 4A1VA 1O3MA 3K1RA 2WHXA 1UJ1A 1V2MT 3VPKA 4Q7YA 1NTPA 1P02A 2QXIA 1ANDA 3FP7E 1NBME 3CS7A 2C3SA 2D26C 2ZDMA 1PDRA 2HNTC 5DJ7A 2ZGCA 1AZZA 1YCPK 2BYGA 3U9AH 3B8JA 5DGJA 2G81E 4B2BA 7KMEH 4KELA 3NRLA 2P16A 3KYFA 2I6VA 4WMDA 5DP7A 3ID1A 4I33A 1OHHD 1EUFA 3P17H 2EEKA 3O8BA 1H9LB 2PLXA 3BEFB 2W3IA 1GHVH 1O39A 4VGCC 2KCOA 2PKAA 4GUXA 4GVDA 2AGIX 1I16A 1ORFA 1ZGVA 2K8IA 3RDZA 2JXOA 4FUGA 2A2QH 2G55A 3B9FH 4G69A 3GY8A 1TX6A 1YKTA 1E36B 1WF7A 2A7CA 3ZZ8A 4ABIA 1O33A 3NK8A 1ELGA 1UVOA 3BTME 4AG1A 2GTBA 2G00A 1QB9A 3GY6A 5HGGA 1BJUA 1NU7B 4JMYA 1AU8A 4I8JA 3RM0H 1QL8A 3VEQB 1EQ9A 5A8YA 1H8ED 1MAXA 1LDTT 1PPGE 1I92A 5EXLA 1TONA 3BF6H 2F9BH 2R3UA 3MHWU 2Q6GA 3W1EA 1AWFH 2H2BA 1C1WH 1YWUA 1YPKH 3U28C 3CH8A 2GD4B 1DFPA 1E35B 1T7CA 2KBSA 1X6DA 4TPIZ 1RJXB 2NU1E 1BTHH 2VGCB 3O5NA 2J2UA 2P3UB 2EAQA 3ID3A 4A1XA 1ARCA 4YYXA 1SHHB 1Z7KA 2KG2A 1Z6JH 1MBMA 4D8NA 2OQSA 1DANH 4UE7H 1MFLA 3PMAB 1UHPA 1WF8A 1C5XB 3EGKH 2IWPA 4ZCNA 1GBBA 3BPUA 5C1YA 2WZQA 1NS3A 2FNEA 2FWWA 4B74A 1GI6A 2KQFA 1V2KT 4Y6DA 2WSSD 2VIOA 5HFEA 1P1DA 4NWKA 3VGCC 3F0OA 1MMJN 2KAIB 4J2YB 4YDPA 1NT1A 1WHDA 5KEDA 3CNRA 4B73A 2FS8A 4NMOA 5F6MA 1YPMH 1JIRA 1K21H 1QGFA 1C9PA 3LGIA 4ZKOU 3OY5U 2HGAA 3SV2H 1L2EA 4FUCA 2PP6A 5E22A 2VZ5A 1E79D 2H9EH 3IG6B 3ZVFA 4AFUA 6CHAC 1K0HA 3SORA 2ZFFH 3KQCA 1G3BA 3EGGC 2BD7A 4H6SB 1A7SA 2BLOA 2GT7A 3V3MA 1INCA 2ZFPH 4Y8XA 1NRNH 3S69A 1EAWA 3SJ9A 2PDZA 1SFQB 5I25A 3PLKA 4D7FA 4NIWA 1LPZB 2XCNA 3ODFA 2OCSA 3KGPA 1UK4A 5AF9H 2QG1A 2J9NA 3SUEA 4X2XA 2VWRA 1B5GH 2G51A 2AYWA 2DE9A 5E2OA 1CHOG 4IMZA 3R0FA 1JXPA 1C1UH 1W11U 4GHNA 1ZJDA 1SB1H 2OSGA 2HVXA 2FOAA 2Q3GA 2W3KA 1W0ZU 1CE5A 3S9BA 2STBE 2VNTA 4JZDH 2DUCA 3GY7A 7LPRA 1W0YH 2G5VA 1CT4E 3MWIU 1FONA 2ZDNA 4YM9A 1TPSA 1C2JA 2VJ1A 1U6QA 1C1NA 4AC9A 2JWEA 1KIGH 3DJAA 1NFXA 5CHBA 3QO6A 1PFXC 3UTUH 3SQHE 3H5CB 2A1DB 4SGBE 1QBNA 1P8VC 2M0TA 5E21A 1GI9B 1T8NA 3A82A 4X6MA 1QBVH 1WIFA 1SQTA 1A5GH 4Q2OA 5H3JA 1LHCH 2GCHG 2WL7A 4Z8JA 2IWOA 5EG4A 4E7NA 1CA8B 3UUZA 5JPMH 4K78A 1ABJH 3ZZ3A 1V6DA 3WW7A 2IWNA 3PTNA 5GDSH 2BDIA 1GBAA 2P94A 2DMZA 1GJDB 1EB1H 1PYTD 4ZHAA 2Y5FA 3KQBA 1LVYA 1MTNC 1P10A 2P93A 2V35A 3GDUA 3LH1A 2D8IA 3MI4A 2H3LA 1A5HA 1CT2E 4MNVA 4J1YA 5DP4A 3SV8A 1CGHA 1NFYA 4DJZB 1MQ6A 5CHAB 2F5YA 1FAKH 4LXBH 4NZLA 2OQUA 1UJVA 1MH0A 4ACAA 1CGIE 3BTTE 1RRKA 4ABEA 4XDEA 1WOFA 1D3QB 3GYMA 2Z6BD 4X1PU 2YUYA 3H7TA 1A3EH 1KTTB 2W7UA 1TX8A 1QA7A 2YMSD 1RGQA 1ZZZA 4I8LA 2QKUA 3U8RH 3SNBA 2L4SA 1TMTH 4MPXA 2W6ID 2KOMA 1YYY1 2F9PA 2BD3A 4JYVH 3R69A 5G1DA 1C2GA 2PGBB 3L6PA 3OX7U 2SGQE 1UEWA 3MU4A 1KXCA 3PLBA 2VWLA 1SLVB 2LOBA 3A86A 2R0KA 4H42U 3V12A 4E3BA 1BHXB 3RXUA 4B1TA 5JBBS 1UMAH 1C5WB 2BVXH 1FDPA 4BANB 2EGOA 1UTOA 2J92A 1S0QA 3BTQE 2DKRA 5GXPA 1E38B 4TWYA 2GZ9A 1AO5A 7GCHG 1UVTH 2C8ZB 1T31A 2XTTB 4JZEH 1FN8A 5IDKA 1TQ7B 1O5DH 2ANYA 3E17A 2XC4A 1Y5UT 2SGAA 2YOLA 1TRNA 3URCA 1T8MA 4TWWA 1CBWB 4AMHA 2F9OA 1O2MA 5LPEA 4I32A 1BE9A 2WUBA 3HPMA 1GBCA 1G32B 1ZOKA 4Y71A 3RMNH 2PNTA 2O9QA 2P8OB 5HYOA 3V0XA 4NXRA 1UTLM 1VR1H 3RXDA 1MFGA 2FYQA 1L1NA 1G3EA 1PQ7A 4RN6A 5JB9S 1OWKA 1TP5A 2DC2A 3I1EA 5C1UA 1DLKB 2UWOA 2THFB 1G2LA 1T32A 3KL6A 4ZKSU 3F9HA 3M36A 2I04A 4JK5A 1GI0A 3BTKE 4BTUB 3K6ZA 1MZAA 4NXQA 2EEJA 4F8KA 3IITA 3ESTA 5B6LA 4Q3HA 5FPYA 1TWXB 2QXGA 1Y3WA 2EI8A 1SGIB 3MNBA 3STIA 1GBJA 3RU4T 3MO3A 1N99A 5DPAA 3PS4A 1ZHPA 2BXUH 2WPKS 1ARBA 2Z9LA 2QGRA 4UDWH 3SZEA 1O37A 1OPHB 1S6HA 4ABBA 3O46A 2GMTC 1DXPA 3PYHA 4H6TA 2P59A 3VB4A 1XKBC 1P3CA 2XBWA 4MTBA 3N99A 1SQOA 1H8HD 3BV9B 1C5UA 3RMLH 2ZPMA 3UAIC 1V2VT 1OWJA 5DP8A 1MCTA 4ABDA 1G37A 2WYGA 4NFEA 4ESTE 5C67A 1YLNA 2V3HH 3A7ZA 3LPRA 3SBKA 3N7DA 1NFUA 1RZXA 2I0IA 1RGRA 4JOGA 1O3EA 2XW9A 2ZTYA 4UU5A 3CC0A 3P70B 1ZTLA 1O3KA 2HWLB 3FP8E 2YNBA 2LC6A 1ANEA 4NSVA 1O2JA 3EYDA 2Y82A 1DDJA 1WQSA 1P0SH 1YPGH 4AOQA 2GCTC 3ZVCA 3ZZ5A 1MQ5A 1YF4A 4ZKRU 5HJ1A 4LOYH 2C90B 2DB5A 3HK6B 3MU0A 3UIRA 1CA0B 4XRNA 3UB0A 2OC7A 3MFJA 1IU2A 2AMQA 4U30A 3GY5A 2L74A 2FX6A 4IMQA 1BRCE 3LGTA 3SU4A 1O2OA 3Q3YA 1MD7A 1L1JA 3PTBA 1XVMA 1AVWA 1K32A 1P1EA 1ZTJA 9LPRA 3K65B 4YOIA 3JZ2B 1ABIH 3F9GA 2VWMA 1UHBB 3U69H 1P05A 4LZ1H 5EW2H 3GCHC 3NXPA 2BB4A 5BRRE 2HVYB 2QT5A 1FJSA 1DICA 2ZA5A 3VGCB 3IWMA 2F83A 1QNJA 2Y80A 2TRMA 2IPHA 4ABGA 4ASUD 1JRTA 5HFDA 1MU6B 1D5GA 1GMHF 3EQ0H 1LPGB 6GCHG 4K69A 3LDXH 3DFJA 1GHAF 1HAZB 1ZOMA 1TGCA 6CHAB 4R2ZA 1GI4A 1MUEB 1C1VH 1QL9A 2KZ4A 3A7YA 3DA9B 1DPOA 2QF3A 1FY4A 2Y7ZA 4ISNA 1W9QA 2PSYA 2ANWA 4U01A 1X7AC 4X6OA 1YPJH 2EI7A 3KF2A 1AQ7A 1O31A 3BTHE 3DHKH 1OXGA 3U8OH 3R0HA 5FPSA 2K1QA 3KEEA 1C2KA 1C1SA 5F8ZA 1GHYH 2OBOA 1UTJA 2LUIA 1TQ3A 1MTSA 3SNCA 1SLUB 1DWCH 1O5BB 4CRAA 4JK6A 1SVPA 3E0PB 1P2QA 2ANKH 1GDUA 2Q6FA 2AMPA 1AUTC 2IOTA 2ZU3A 1G3CA 1ID5H 5EJZA 2DM8A 3NPSA 5GPIB 3KHVA 2D90A 1GCTC 4LK4A 4B6EA 3EGHC 3GCTF 2AINA 3I18A 4MVNA 4NFFA 2R3YA 3B76A 1A0JA 4YO9A 3TPIZ 1C5NH 2ZPRA 5E0GA 2BVRH 3A8BA 1BT7A 3C1KA 4FUFA 2FOBA 4OAJA 1A5IA 3SJ8A 2BLWA 1OZIA 3RXOA 1E34B 5J4SA 3DJ1A 4O03A 3TNTA 2FI4E 1LVOA 1S82A 1AI8H 2BDCA 1W3CA 2GZVA 1QAVB 5DO4H 1GQ5A 4ISOA 3NGHA 4FETA 4AX9H 1MD8A 1QQ4A 2R2MB 1RTKA 1E1RD 1WU1A 1SPJA 2F9VA 1SR5C 2TBSA 4A5TS 5C5NA 1RXPA 4Q2QA 3PMJA 2WPJS 4IGDA 3SOEA 2RDLA 3QGNB 4N6XA 2TPIZ 2ZQ1A 3TITA 1AWHB 1C1OA 3PV5A 1TLDA 5FB8C 2A5IA 2PFEA 2V3MA 3RXMA 1O2TA 3SHUA 3NCLA 1TABE 1TPOA 1UCYK 1HDTH 1SSXA 2HPPH 4RI0A 1VB7A 1S83A 2A5AA 3RXEA 3T27A 1TNHA 1W7GH 3UY9A 4Z1MD 1UJDA 2NU2E 2PKTA 1UTPA 4SGAE 3TK6A 1BTXA 1YP9A 1HAIH 1GVZA 5E0JA 1OYTH 3ZZAA 1YPEH 4FUIA 4ABHA 1NRRH 2PHBA 5I46H 1WFVA 3DFLA 3EA8A 1XMNB 4HZHA 5CHAC 3ZZCA 3GYLB 3GICB 1LQEA 2JIZD 1GWAA 3UNRA 1NM6A 2FO9A 1GBKA 1BZXE 1OWIA 1SGQE 1LKAA 4CRBA 1F0RA 4GHTA 1DWBH 1EOLA 1C5QA 4WYUA 2Z3EA 5K7RA 1TGBA 1C5LH 3ATWA 1QRZA 1Q3OA 4D9QA 4Y76A 3PO1C 3GY2A 4NA9H 3H09A 3BEIB 1AN1E 1LO6A 1AE8H 3ITIA 3GDSA 1AKSA 3S7KB 3CP7A 1O5EH 4Y8YA 4WXIA 1SLWB 1W9EA 2PUXB 1JIMA 1GMCF 2ZG0H 1NU9A 2GV6A 2HGTH 2J98A 4D9RA 3T29A 4R0IA 2H6MA 4DOQA 4X1QU 3SNDA 3GDVA 1C5OH 1SGYE 1HBTH 1F7ZA 1T8LA 2KM0A 2ZECA 3TU7H 2OZFA 1O2GH 1IQGA 5HIYA 3KDGA 3WY8A 3Q76A 2UWLA 5EQRA 3TVJB 2G2LA 1ZSJA 3GGEA 3HKIB 4JJ3A 3SJKA 3UNQA 1O30A 1RIWC 1F0TA 4NMQA 1OBXA 1IQNA 4Q7XA 2ZGJA 1GG6C 3TJUA 1K1MA 1O3LA 3ZZ7A 1C1MA 3SO3A 4BAHB 3FKSD 5EW1H 2QC2A 1AFEH 4Y7BA 3ZZ6A 2P95A 3EE0B 2GV7A 1JMOH 1ZR0A 2ZPQA 5JBCS 1O38A 3C27B 1AE5A 1TPPA 1O2HA 1UTMA 2JREA 1UCYE 4IC6A 2B9LA 2AGGX 2O8LA 4WH8A 4P2AB 5EIYA 2F9UA 1SMFE 4MLFB 5C2ZA 1FIWA 1TAWA 1ZGIA 4FOUC 4X8SH 3PMHB 3RXCA 3LGYA 2WYJA 3ZYEA 3U1JB 4BXSA 2GMTB 1V2ST 3E16B 4NMRA 1WSSH 2QXHA 2BDAA 3EE7A 1V5LA 1U3BA 1IQJA 3TIUA 1KDQA 1PPZA 2JH0D 1QCPA 1AVGH 1QR3E 2FESH 2ZGHA 4DT4A 2Y7XA 3LNYA 3SFJA 3P8GA 1FIZA 2BDHA 4Y79A 4IC5A 5FL7D 1EASA 2K1ZA 4LMMA 2KV8A 5FX6A 3RXKA 4YLQH 3KN2A 1O2XA 3M3VA 2I1NA 1C5ZB 2OD3B 3AVZA 1DVAH 2G52A 4K1SA 4INLA 2O2TA 1ZYOA 3FN8A 3N7OA 4WMEA 4HTCH 3UNSA 4OS1A 1GHBF 1J14A 1O3PB 4JJ0A 1YCPH 2VRFA 2QBWA 5FHTA 1C2HA 5HFFA 1LHFH 3RXGA 2F43B 2GCTB 1XM1A 2FN5A 2ALPA 2AWUA 1C1PA 2BDBA 1EZQA 3AXAA 1OP2A 3MU5A 1C4Y2 4MNXA 4Q6HA 1IHJA 1CVWH 2A32A 3DD2H 2M10A 2XXLA 1W13U 3TJVA 1B7XB 1GBDA 1XX9A 3F2GA 1ZUBA 2TGDA 2SGDE 2UWPA 1F92A 3ZZ4A 2ZO3H 2Y5GA 2ZPSA 2V7QD 1O3IA 2KCYA 4F49A 1LHDH 2KL1A 2ZDLA 1C1QA 4AFQA 2HE2A 2VVCA 1V62A 3WKMA 4HGCA 3M5OA 4P0CA 2KCPA 3BEUA 3M7UA 3ZZDA 5A0AE 4FU8A 3A85A 3GCHB 1X9ZA 1DM4B 3U8TH 3NCVA 3MMGA 5L30H 1CA0C 2PKSC 4IN1A 1FUJA 2M0UA 3PDZA 1GJ9B 1OP8A 2PSXA 3D23A 1RY4A 1V2QT 4E7RG 1EJMA 4KGAA 1P2KA 3RC5A 1ESBA 2R4HA 1TMUH 1VGCC 1BMNH 1V2WT 4CRFA 5JBTA 1C2EA 2OC8A 4K3JA 2EDVA 1AFQC 1W7XH 4OS5A 4XSKU 2CJIA 3ZZ9A 1O3JA 1G9IE 3F68H 1MKXK 5IL9A 1ZSLA 4JL7A 3A8AA 1W12U 1P01A 3PLPA 1Q7XA 2IN2A 2RCEA 2WPMS 4AFSA 1FC7A 1UK2A 3RMMH 4DCDA 1ZPZA 1JWTA 1P3EA 4AGKA 2ZDKA 2ZI2H 2LNCA 1EAXA 4Q4LA 4YLUA 4NMSA 1T8OA 4I31A 2FOHA 4X8VH 3LKWA 1SOTA 2F3CE 2ESTE 4WVPE 1GL1A 1L4DA 1QRXA 1EAUA 4Y0ZE 2LP6A 1LPKB 1HGTH 2EI6A 2JKHA 5DN6D 2ANMH 2FOMB 2AFQB 4ZUHA 1V2LT 4TSFD 3A7WA 1AIXH 1GCTB 2BDYA 1N8OC 3SV9A 1FNIA 2D8WA 1HYLA 3RL7A 1O2ZA 1TA2A 1AY6H 3TH2H 2DLSA 4B71A 1TNIA 4DW2U 1L1GA 3A81A 1TNGA 2VWOA 1AZ8A 4KTCA 1SQRA 1KYNA 4K60A 2HE4A 4TT3D 4YT6H 4NIXA 1M9UA 3OY6U 1GMHG 2EEHA 4X6NA 1NF3C 1FPCH 2V0BA 4BAMB 2GZ7A 2Y6TA 2ZU5A 3MH5A 4BOHA 2UZCA 2ZHFH 4BTTB 1EP6A 1K1IA 4Q80A 1PJPA 5FAHA 3GS9A 1VJ6A 3TH3H 4CREA 3LJJA 1EZXC 1XVOA 1TE0A 2NU0E 5BPEA 3V7TA 3SNAA 2QKVA 1ZLRA 5C94A 1LCYA 3T2NA 5FCKA 3P8FA 5G4BA 6ESTA 1GMDF 1MBQA 2YT8A 1HJAB 4JCNA 2X7ZA 5HFBA 1O2RA 1VCWA 1C5VA 2WV5A 4THNH 5JDUB 1BTYA 2BD5A 2ZFTA 1YY3A 4RT0A 3P8OA 2ZFQH 2PW8H 4YT7H 1PPHE 3JZ1B 1O32A 1A61H 3ZRTA 2FI3E 4AGJA 5DKMA 1C1TA 2ZDVH 5IYTA 1VA8A 1NRSH 2YT7A 3ATIA 5E0HA 1GJ5H 4DT7B 1KLTA 2VBCA 2JH6D 1XZ9A 4UU6A 2ZKSA 4FUDA 1N6DA 1GBIA 5KGOA 4HOPA 1O2SA 1Y3YA 1VITH 3MNCA 3STJA 1YBWA 4FUBA 1W10U 2B8OH 3DJ3A 3PO1B 3GCOA 2M3MA 2M0VA 2CHAB 5H4IB 2ZNKH 1S84A 2QYIA 1NFWA 3LONA 4MNWA 5JXBA 4NMVA 1P57B 1BRUP 1H4WA 3EAJA 1ZSKA 4I7YH 2LPRA 1FQ3A 1JOUB 2W26A 4WXVA 1Q2WA 4MG3A 1QRWA 2J34A 2ZHEH 2GKVE 1HAPH 1ELFA 2BX3A 3A80A 4IS5A 2EA3A 1O3CA 4O97A 2H5DA 2UUKB 3TGKE 3HPKA 1BIOA 2Q1JA 1S0RA 2FOFA 5HMAA 3RU4D 2MHOA 3RUOA 2OINA 4ZKNU 4XBBA 4XHVA 1O3AA 1A3BH 1QZ8A 2HALA 1EB2A 2ZC9H 3ATKA 1QB6A 1A0HB 2QXJA 4OS6A 1RIWB 2L4TA 1B0FA 1BA8B 1GG6B 3SN8A 4YESB 1BBRK 1PPFE 1HAHH 2REYA 1UEPA 1F0UA 4JOJA 1SLXB 2C93B 3HPTB 3M3TA 4AYYB 4DIHH 4MPVA 2BX4A 2ZGBH 5FBIA 1O2NA 2CSJA 3L3TA 2VIDA 1J17T 1NPMA 1BCUH 3Q3XA 5F3XA 4YTAA 1XXFA 5EJLA 3RXRA 3MH6A 1MTVA 4JOHA 4BAOB 3ID2A 1D4PB 4KFWA 1YCPM 3RLYH 5EJ1A 1SL3A 4FVBA 2KPLA 1FV9A 2C8XB 1Z86A 2VIQA 2AGEX 2EC9H 2EY4C 4FUEA 2JOAA 1UVSH 2QKTA 4Q2NA 1BRBE 5DP6A 3LC5A 2OC1A 1L4ZA 3I4WA 2WV9A 3BTGE 3QK1A 1EJNA 1H1BA 3PM3A 3PV2A 1TYNA 4IW4E 1FLEE 3CBYA 2RDEA 2DJTA 4K75A 3M7TA 5EU8A 5F67A 1EZSC 3UOPA 1Y3UA 1HIAA 3FY5A 3CS0A 1TOMH 5FBEA 1DX5M 5HXFA 2FODA 3QTVH 1TFXA 3DSPA 4E34A 2NWNA 1W8BH 4EDJA 3ODDA 4ZROA 3RMOH 2BZAA 5C1XA 1Y8TA 2QF0A 1OX1A 1WI2A 3LJOA 1DY8A 1AVXA 1JBUH 2L6OA 4NNLA 1KLJH 1N6YA 1S85A 3LC3A 3SJIA 3QIKA 2VU8E 4GPGA 4AYVB 3QJNA 5G1EA 2JDID 2WPHS 1W2KH 2GJGA 4GVCA 1P2MA 1YGCH 5HEYA 1BHXF 1QHRB 1XKAC 2BY8X 1WH1A 2ZU2A 1LVBA 2AMDA 3UQOA 1OWDA 1QY6A 4AZ2B 2Z94A 1BBRE 1GJ4H 3CBZA 1W14U 3RC6A 4YOGA 1ELAA 1K1LA 1QLCA 2GZ8A 2XBYA 1UITA 1GI5A 5CMXH 1P9SA 1O3DA 2PKSB 2QCYA 4RKOB 3GSLA 2KR7A 5C5OA 1WV7H 2H2CA 1VAEA 5DP5A 4OS4A 1TMBH 2EEGA 1RGWA 5EPYA 1KTSB 4A92A 1O36A 3I29A 3VG8A 1VGCB 3AW1A 3M5MA 1FAXA 1EX3A 3H7OA 2BOKA 1EAIA 4GAWA 3DSGA 2B0FA 1AFQB 4MDSA 3KIDU 1EFRD 2XNDD 4YXWD 3SQEE 1VCQA 2VIWA 3VFEA 1SGEE 4HFPB 1WYKA 1HAVA 1CU1A 2KJKA 4ZHMU 6LPRA 3Q77A 1Z6EA 3D49H 1S81A 2F9NA 3E90B 3W95A 1GHBG 1GHXH 1T4UH 4Z6AH 5C20A 2H5CA 2HNTF 1QIXB 5HDYA 1FY1A 3M35A 3RLWH 4REYA 5T1VA 1E1QD 3A84A 1TA6A 5C17A 2BQ7B 2GX4A 3RXAA 1G9OA 2ULLA 4XOJA 2O8MA 4MQAA 8LPRA 2ILNA 2EHRA 3FFGA 2FP7B 3SGAE 1K1JA 1SGCA 3SUDA 2XYAA 4AB8A 1BTWA 1COWD 3L4FD 1UF1A 4KFVA 4X8TH 1O5GH 3RP2A 2C8WB 1N8OB 3KQEA 3NFLA 1UM7A 2BVSH 1ESAA 1A0LA 1K1PA 3KHFA 3QJMA 3S7HB 2J5UA 3T25A 1OYQA 3E1XB 1UJUA 3OTJE 2GDDA 2FTMA 1O3FA 4NGAH 1IQIA 1CSOE 3LU9B 1NN6A 1GI3A 2FE5A 1ZPBA 4INKA 1K2I1 3M61U 4YOJA 1BJVA 4GSOA 4CRGA 2ZDAH 4NCYA 3QGJA 3TK5A 1KXAA 1ZMLA 3RXSA 1DSUA 1QFKH 2RG3A 1THPB 5F03A 1Q31A 1TB6H 4KKDA 3VB6A 5FCRA 2EDPA 4ISIH 1KEFA 4ABFA 3ZV8A 2KAWA 2BZ6H 2EGNA 1GBMA 1F5LA 2YUBA 2WV4A 1FY5A 1UVUH 4X1SU 4Y11E 1GDNA 3P8NA 4RSPA 2NU3E 3LGVA 1DUAA 2ALVA 1P09A 1THRH 4E05H 5ESTE 5LGOA 5GCHF 1GQ4A 5HKKD 2IPQX 3HVQC 3RM2H 5EXMA 2VSVA 4XBCA 1T4VH 1RFNA 4NMTA 2IJD1 1IQKA 3RC4A 1NZQH 1P06A 1BUIA 4I8GA 1N6EA 2XBXA 3VXEH 1Z8RA 2LA8A 1W9OA 5EPNA 1ETSH 4O9VA 1HJAC 1QBOA 3SUFA 4NMPA 2TIOA 5I7ZA 2XOKD 3MTYA 1GBTA 1AKSB 1N6FA 3BG8A 1KXEA 1PQAA 1TBZH 1H8DH 3B23B 1Z87A 1LMWB 2RA3A 3ENSB 2PWXA 2J98B 2CV3A 1ELVA 1E0FD 2BMGB 3QDOA 4K2YA 1F5KU 2F0AA 1VJ9U 2Z17A 1ZHRA 3F2HA 1D6WA 1BTUA 3SHCH 3OFND 3BTDE 1UEZA 3KZEA 3ZVGA 1ANBA 1ELDE 4FLNA 1UCYH 3EDXB 2JINA 3E0NB 1XUKA 3FANA 2YTWA 4K76A 1V2NT 1FZZA 1RS0A 2FS9A 1O3BA 2FZZA 2FOCA 4OM9A 2CK3D 2AIQA 2Z7FE 2AIPA 1V6BA 4NZQA 2PUQH 2CHAC 1HJ9A 4BAKB 1GMDG 3P92A 4CH8B 3VB3A 3I77A 5A8XA 1S5SA 1MAYA 3A89A 1D3DB 1NRQH 1TGTA 3PWCA 1MKWK 3CYYA 1ESTA 5GIBA 2A4QA 1WHAA 1WTHD 2FOGA 4RKJB 2HPQH 2STAE 2IWQA 3GCNA 4UEHH 1KMHB 2VH0A 4K8BA 1C2FA 3UOUA 2QIQA 2BY6X 1KDQB 1YPHE 2ZGXH 1QQUA 4GLYA 4HG6A 4BAQB 5GNDA 1QA0A 4AFZA 2AHME 1DUEA 3E3TA 1TPAE 4E35A 2A0QB 2ZHQH 4Z33A 1K1OA 1UTQA 3HK3B 1OS8A 2ZU4A 5HF1A 2C8YB 1BTZA 2OLGA 4P02A 5FXLA 5HFCA 2BY7X 3BG4C 3M37A 3URDA 1SHYA 4ACBA 4ABJA 1IU0A 3SU6A 5A09A 1BMFD 1AD8H 5AFYH 3EA9A 3ZIAD 3O8DA 4IN2A 2ODPA 4JZIA 4H4FA 2H9HA 1C2MA 4I86A 1DXWA 3P6ZB 4X2WA 2FXRA 1DWEH 5JB8S 1IOEA 5A2MH 2B7DH 4U32A 3M7QA 3RL8A 1PQ8A 2EXGA 1HXFH 3LGWA 1Z8IB 3RLEA 2YNAA 1TGNA 1RTLA 3RXBA 4A6LA 4MPUA 4KTSA 4ABAA 4PQWA 1ZPCA 2ZTXA 2BYAX 3PRDA 3FZZA 3DCLA 1VZQH 4L8NA 2OS6A 4Q6SA 1KSNA 2CXVA 2OPGA 1TQ0B 1CT0E 3ZVDA 4OEOA 1FY8E 1K22H 2A7HA 3SU5A 3E8LA 4DIIH 3T26A 2PZDA 3F9EA 4H11A 1HB0B 1O2UA 2J95A 2Z9KA 1O3GA 2TGPZ 3LIWA 3CBXA 1ZMJA 2KX4A 2A4RA 1WCZA 1ZHMA 3K50A 4F48B 1X5QA 1RTFB 1GM1A 4JYUH 2FMJA 3PWBA 4ZMAH 2VVUA 2P3WA 1C5RA 3AAUA 1NRPH 1EZUC 3F2FA 1C5MD 8ESTE 4XE4A 5B6OA 1P2OA 2ENOA 1TNKA 1Z1JA 3SU0A 2VB0A 4MPWA 5EQQA 3F6UH 2ZTZA 1QB1A 1KLIH 4OEPA 1EPTA 3E91A 4JOFA 3HGPA 1WG6A 3UWIA 2R0LA 1V2JT 4GCHF 1OWHA 4M9FA 5LPFA 3TJOA 1N7FA 2JETC 2ZQ2A 1G2MA 5C3NA 6GCHF 5HEBA 4FVDA 3QE1A 1ZTKA 1BOQA 4IBLH 4JORA 1AMHA 1GVLA 1WUNH 3OE7D 5F53A 2ZF0H 3WKLA 2H3MA 1O5FH 2SGFE 1QURH 3KQ5A 3PMBB 2WPLS 4PROA 5ETXA 1TRMA 2PTNA 1NESE 4OS7A 5CDFE 2CGAA 3BSQA 1H8IH 5GLJA 4UFFH 1GHZA 2CS5A 1OSSA 2BLVA 3MO9A 4ZH8A 3PV4A 4JOKA 1TRYA 3M5NA 1D9IA 4NIVA 1VITF 3OAAD 5E2PA 3TH4H 5GWZA 1BTPA 3CENA 1C2DA 4O3TA 4WMFA 3SJOA 2KRGA 1FI8A 2ZCHP 1EOJA 3NWUA 1P2NA 3VB5A 1MU8B 2H9TH 5EODA 2EJYA 2DLUA 2AERH 5A0BA 2W7RA 3O8RA 3NKKA 3QX5H 1HLTH 1YM0A 3T62A 4JZ1A 1R6JA 1W0KD 4Y7AA 3DORA 1J15A 1PQ5A 4MPAA 2D1JA 1WTGH 1OBZA 1F5RA 1IHTH 5DTHA 2XBVA 5K0HA 1WXRA 3TSWA 2XCFA 3FAOA 2ODYB 1Z71A 2VWNA 2V1WA 1NO9H 2CF8H 1GGDC 3A7XA 1FN6A 1A46H 3OTPA 2ODQA 3P95A 2FTLE 2BD4A 1ZRBA 1TNLA 3GY3A 2JJ1D 1OBYA 1MCVA 2I6SA 4UFDH 2GVFA 1MKXH 1X8SA 3QZRA 2W4FA 5EOKA 3FZDA 1V5QA 1UO6A 3QGLA 2HRVA 2UUYA 2Z9JA 2RCZA 1PPBH 1O5AB 2CMYA 3AK5A 2BHGA 1P2IA 3VXFH 2Y5HA 5A0CA 2LELA 4FXGH 3KNXA 4P00A 3VQGA 4Y10E 1ELCA 2FDAA 2HLDD 1P03A 1N7TA 2SNVA 3A7VA 1YLCA 1GJBB 1ZRKA 3TSVA 2NU4E 3A87A 1XUJA 1TBQH 2BOHB 4A1TA 1TX7A 1X45A 3AAVA 1XUHA 3ZV9A 1MZDA 2O8TA 2OXSA 3RXPA 2DAZA 1ACBE 1FPHH 2QAAA 3F3BA 1NROH 1RD3B 1GHAG 3T5FH 5A2PA 1BMLA 2PV9B 3D62A 2KPKA 2O8WA 2KAIA 3W94A 5AHGH 2DE8A 1GHWH 1OOKB 2K20A 4HOPB
chains in the Genus database with same CATH topology
3RXVA 1L6OA 1WJLA 2E7KA 1KWAA 5F8TA 3SOSA 2BM2A 3SHWA 3PROA 2R2WU 3FVFB 1YBOA 1OKXA 3DT0H 1IQMA 1EKBB 1QL7A 2G4TA 2ZIQH 4ISLA 4QT8C 1O2KA 1AHTH 1H9IE 4Q2PA 1DY9A 2ZFRH 4TY6A 3UREA 1ELTA 3GISB 1KXDA 4INHA 2G5NA 3UR6A 2J94A 1WFGA 5T6DA 2FPZA 1QJ7B 2A31A 2G8TA 4CHAB 5FX5A 5PTPA 4Z0KA 2PTCE 4DG4A 1QTFA 1K9OE 5ILBA 3GOVB 3GCTG 2I4SA 4R8TB 1UTNA 3S9CA 8GCHF 1MC7A 5A8ZA 4DVAU 1O2IA 1TOCB 2OTVA 1GJ7B 3HATH 4GHQA 3I78A 3BIVH 2WPIS 2IJOB 3MH7A 4KTUA 4K72A 1GL0E 5B42A 4X0WU 4NXPA 1GBEA 2A4OA 3T28A 1SOZA 4JZFH 2D2DA 2I0LA 5GCHG 4OGXA 3TJNA 2BTCE 1UM1A 5E11A 3V13A 4X2VA 4B75A 1A1RA 1BDAA 2XRCA 2QA9E 2EV8A 3U1IB 2EEIA 1HRTH 4U2WA 3ZZBA 1TNJA 1GJ8B 3PB1E 1IQEA 1GI2A 5E8EH 2ZHWH 2KOJA 1HAYB 1O5CB 5HF4A 2F91A 3OSYA 1O3HA 1S6FA 3BTWE 4WJG2 2KA9A 1FY3A 1YC0A 4ZXXH 1HCGA 2GT8A 2VIVA 5EZ0A 4Q7ZA 5EQSA 1IQLA 3UFAA 4NG9H 3EA7A 1DS2E 4K8YA 1GCDA 4K5ZA 3BTEE 2XWAA 2XWBI 1ELBA 2V6NA 1GJAB 1GI7B 1BQYA 1OWEA 1PYTC 4B2AA 1ZJKA 1EXFA 1D6RA 2A45B 3HGNA 1O35A 1HIAB 3F9FA 1BMAA 4F4OC 4FU9A 3BG4B 4KP0A 2EGKA 2UUFB 2BY5X 3VB7A 1GJ6A 1AUJA 2KJDA 2L97A 1TGSZ 1B8QA 1Q3PA 2GDEH 1L0ZA 1V2OT 4CH2B 1Z8GA 4TPYA 1AB9B 1UK3A 3BTFE 2TGTA 4Q2KA 5EXNA 1BBRH 5TJXA 2AEIH 1IAUA 4E06H 5L6NH 2ZEBA 2H1UA 1O2QA 2QY0B 1U38A 2ZFSA 1NY22 2UUJB 3QN7A 1FC9A 3SGQE 1KXBA 4X1RU 1O2LA 5DP3A 1JRSA 2OUAA 3S9AA 4CR5A 1C1RA 1SBWA 1YPLH 3GABA 3OU0A 4NA8A 4AORA 3RU4E 5HEDA 1UEQA 3M5LA 5AFZH 2GGVB 3K2UA 4O3UA 4BNRA 1SC8U 2M5TA 1LKBA 1UTKA 3QDZB 2QV1A 1SGTA 1GMCG 1EATA 2J38A 1XUGA 2HLCA 1D3PB 2W5EA 4XFQA 2VINA 2VIPA 4NA7A 2Z3CA 2XC5A 1EPTC 2V3OH 2FOEA 2FYRA 3RXTA 5LPRA 5E6PB 2HOBA 3DIWA 2R9PA 1M5ZA 1C9TA 3SV6A 1G36A 3TK9A 3U98H 3JXTA 4VGCB 5L2ZH 2Z9GA 2G5MB 4WYTA 1KXFA 3SI3H 3MO6A 3QWCH 2BQ6B 4X8UH 4DGJA 4WF8A 2ZCLP 1HAVB 2O8UA 2JETB 2KJPA 3Q00A 5FPTA 4B2CA 3TSZA 1Y3VA 4FGMA 1U39A 1LTOA 2BDGA 3RXFA 2OCVB 2PKUA 5AVDA 3AASA 1V3XA 4YZUA 3HKJB 1H9HE 1ETTH 2Q6DA 4ZAEA 1TALA 1IQFA 1IHSH 1SGFG 3LNXA 3KZDA 2A4GA 1UFXA 2VH6A 1GBLA 4UD9H 5T3HA 2FIRH 4FUHA 4NIYA 1Y5BT 5TCCA 4ISHH 1BFEA 2PR3A 2BY9X 2WUCA 4I8KA 3UQVA 2ZP0H 2PGQB 5D13A 1K28D 3RXIA 2AWWA 2JIK