3GDVA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yqf peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
316
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 61
structure length 295
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdvA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA01
2BY5X 1ANBA 1DANH 2JWEA 2UZCA 2W7RA 1O2XA 2W5EA 3P8FA 1VCQA 2UUFB 2Y5HA 4K8YA 1VA8A 1EPTB 1GMDG 4CRDA 1BRUP 1K32A 2ZGBH 1NT1A 1G37A 1U38A 2OSGA 5ETXA 1UF1A 3RMOH 3PS4A 4B2AA 1HJ8A 3SJIA 2FOBA 3ID3A 1TGNA 5GIBA 4DT7B 3BV9B 2M5TA 1IQKA 1C4Y2 2Z9IA 2EI7A 2OBQA 7LPRA 3E0PB 3ZVEA 4IS5A 1O5CB 1C9PA 2P3FH 2J34A 1AKSB 1HUTH 1WFGA 2LA8A 2PUQH 3F9HA 1YBOA 2R9PA 5DP6A 4Y79A 2VWLA 3KZEA 2ZECA 1T4UH 1OX1A 2O9QA 1NROH 5A0CA 1O3PB 1IQFA 1Y3XA 3NCLA 3MNSA 1O5AB 1O38A 2Z9JA 1GGDB 1GBFA 4NGAH 1LDTT 3UREA 4Q7ZA 5C1UA 2BY7X 1GJ9B 4KFVA 2LC6A 1YPHE 3BEUA 3A88A 1GI4A 1BZXE 2F0AA 3LNXA 4R8TB 2Y81A 1SOZA 1IQEA 2UUYA 1UEWA 4JK6A 3DFJA 3TVJB 3SQEE 4AG2A 1FDPA 2AIPA 2VH0A 3BEIB 1WAYB 1P1EA 4CRAA 2PUXB 1FC9A 1MCVA 5B6OA 1S5SA 3PV5A 2ZFPH 1BMNH 3IWMA 1BE9A 1UJUA 1VR1H 2W4FA 1TX6A 4DGJA 4ABDA 1LVYA 1YPLH 2KPKA 3BF6H 2TRMA 3NWUA 3K65B 1TBZH 3UNQA 1GBTA 1SQTA 1QURH 3RL7A 1SHHB 3RXEA 4A6LA 1O3AA 5BRRE 1B0FA 3FANA 1W9EA 1FV9A 3QJNA 1AN1E 5LPEA 3P6ZB 1W3CA 1GHYH 2ZKSA 4BAOB 3VFEA 4U2WA 3TMHA 5EQRA 4UDWH 2VIDA 3ZZ6A 1UTMA 4AORA 2E7KA 3Q3YA 1UMAH 4WXIA 2LC7A 2FP7B 3DJAA 4HOPB 3SO3A 3TJOA 1G3DA 1UO6A 2A32A 2KAWA 1V2TT 2Q3GA 1QRZA 2FE5A 4FGMA 1F92A 2JREA 3O8DA 1O3FA 1P9SA 1BJVA 1TA6A 1O2OA 1P2OA 2A7CA 2F9UA 2IWNA 1CA0C 4LZ4B 1CT4E 1B7XB 4NXRA 4I8JA 2UUJB 3PROA 3SOEA 1YGCH 2ANWA 2FYRA 3OYPA 1ETSH 5JPMH 4XBCA 2TIOA 1AB9B 2XC4A 2AS9A 3SV2H 3VGCB 2AYWA 1C1NA 3KEEA 1FAXA 3SQHE 2FESH 1H9HE 3NPSA 2J2UA 1AD8H 2A2QH 1UEPA 2FDAA 2GCTC 2QGRA 2BQ7B 5GNDA 1P10A 3GY4A 1BTZA 1QA0A 3QX5H 3SU0A 1O3LA 2PW8H 2M0TA 5SGAE 1QRXA 4Q7XA 1P2MA 2R2MB 1OYQA 2FI3E 3PMAB 6CHAC 1IQLA 3P8NA 4ISHH 1UTNA 3A7XA 4BOHA 1OOKB 1GMHF 1JIRA 3RXGA 2OTVA 4H11A 1TNHA 3SNCA 1BHXB 4E34A 1C5LH 3MU0A 2AIQA 3M3VA 1V5QA 3A83A 1V2UT 1B0EA 1U39A 4NCYA 5EZ0A 1PPZA 2DB5A 1UHBB 2Z6BD 4AFSA 5GPIB 1TE0A 2FIRH 1ELGA 2EV8A 1DOJA 5CHAB 2EI6A 3I4WA 2O8MA 4OS4A 7ESTE 3RMLH 3KL6A 1DFPA 1C1OA 1BTXA 5L30H 2G5VA 1MKWH 5AVDA 1OBYA 1OWHA 3AW0A 1IQNA 2BXTH 5I7ZA 1ABJH 1C1RA 3OY5U 3R68A 3TGKE 2BD5A 4B73A 1ZPZA 2WPLS 3ZVDA 4N6XA 2BD7A 3ZZAA 2MX6A 1W7GH 2NU0E 4JZIA 2AH4X 3RM2H 1FZZA 1W8BH 2BY9X 2I6SA 3V3MA 4D8NA 1FNIA 2BTCE 1OP0A 3QN7A 1DY9A 1Y3YA 2JH0D 2OC7A 2ESTE 4FUIA 1Z1JA 1EPTC 3HGNA 4UU6A 3GDSA 2HGTH 3EGKH 2G5MB 4MPAA 2V90A 3MH4A 4ZHMU 3O8CA 3FP8E 2AGGX 2ASUB 1KDQB 3RXFA 4FUBA 1BMAA 1BQYA 2P3WA 4JORA 3LONA 1FONA 3LGYA 2Y80A 3BG8A 2BLWA 3RU4E 3AW1A 2DMZA 3MO9A 3SU4A 4CR5A 1YM0A 3TSWA 1C5OH 3VXFH 5ABWA 3EE0B 1YCPH 1HAHH 1P8VC 1SGEE 3QJMA 1K1JA 2I0LA 5F3XA 2CHAC 4DCDA 8KME2 1R6JA 3K2UA 1C4U2 1V5LA 2DM8A 1GGDC 1ZSLA 2YT7A 4KELA 4HGCA 1NU7B 3ZVCA 2XBXA 1HIAA 1O3KA 1S0RA 5HFFA 1HJAB 4NA9H 5L6NH 4K1TA 1ABIH 1C2MA 1KLJH 1QHRB 2BHGA 2DE9A 3ODDA 1PJPA 4UFGH 2I1NA 2WUBA 2XYAA 3MI4A 1UVUH 2WPMS 3RXBA 2CN0H 2ENOA 4JOGA 1QBOA 8ESTE 1SGFA 3F9GA 1ESAA 2BDHA 1O3OA 5CMXH 3NUMA 2EC9H 1PPEE 2RDLA 1C5NH 1DLEA 2ZC9H 1K1NA 4FU9A 1SGTA 1NRPH 4NMQA 5D13A 3I77A 2ZDAH 1XMNB 3A80A 1V6BA 4DG4A 2VSPA 1TAWA 2ZFFH 3QGNB 4WH8A 4CH8B 1D3DB 1TA2A 2B5TB 4NFFA 2O8UA 5GDSH 2WV5A 4VGCC 1YF4A 5EOKA 1IOEA 2FO9A 3RU4T 1HXEH 2BX4A 5E0HA 2BM2A 5C5NA 1SPJA 2EEHA 1MUEB 1CHOG 4YT7H 2JOAA 4ISIH 3RXAA 2FS8A 1Z6JH 1TONA 1XUJA 2O8WA 1DWCH 1IU0A 2DKRA 2HVXA 3PLKA 5TJXA 1KLIH 5I46H 4K1SA 1CU1A 2BQ6B 2D2DA 4CH2B 3AVZA 4NMVA 3BSQA 2FODA 1C1VH 1THSH 1TRMA 1MU6B 1U37A 1CGIE 1NZQH 1ZMLA 1EJAA 3SJKA 3D65E 1AQ7A 4IGDA 2BY6X 3LC5A 1MMJN 4I33A 1FPHH 4QT8C 1AB9C 1LHEH 1GBHA 1QL7A 3VGCC 1LVMA 3HK6B 2Y7XA 3ID1A 1N8OB 1TNKA 3VQFA 3VB5A 4J2YB 1I16A 4WYTA 4JL7A 3SFJA 2STAE 3A8AA 3A8CA 3A85A 4MNYA 4E05H 1N7FA 2GZ8A 2GV7A 5T6FA 1ANCA 3A8BA 4Y8XA 3L6PA 5GJ4B 1LQEA 2BQWB 1NM6A 2V0BA 4B2BA 1FN8A 4Q80A 1TNIA 1XZ9A 3K50A 1N6XA 2KJPA 2FOGA 3U69H 3UWIA 2PKUA 2YUBA 2B8OH 2XTTB 4MQAA 2EDVA 3QGJA 4X1NU 1SOTA 3E17A 3I18A 2BOHB 1HYLA 1PPCE 1LHFH 1EJNA 4X8SH 3DJ3A 2OMJA 1FJSA 1ZTJA 3FVFB 3F68H 2PSXA 1RGQA 4Y11E 5CHAC 2FOCA 3MYWA 3VB6A 1TQ0B 1TALA 4CRGA 4KTSA 1ZZZA 2ZU5A 2ODQA 2BD2A 3EA9A 2YNAA 1TPAE 1V2QT 4I7YH 1P2QA 1DSTA 5HF4A 4X1PU 2KOMA 1EATA 3ZVBA 3SZNA 2M0VA 3GYMA 2XWAA 1FY1A 1ELAA 1Y5AT 4ZHLU 1MD8A 1O0DH 2HNTE 2A4RA 2VNTA 1K1OA 3WKLA 1TIOA 2KRGA 1GI0A 2J94A 2XCNA 4TYDA 1QB6A 2BXUH 8LPRA 4IN1A 4Z8JA 1ANDA 2ZPRA 1GCDA 3E16B 3QO6A 1EZSC 5L2ZH 3STIA 5FAHA 1C1SA 1H4WA 1J14A 3QE1A 1NS3A 4B71A 4OS5A 2ALVA 1HAVA 3ATKA 2ZCLP 1T7CA 3U8TH 3SBKA 1K22H 4THNH 1XVOA 3PV2A 4PROA 2EEJA 4AYVB 3R69A 3MU4A 2ANMH 2PFEA 1ZHMA 3TJVA 2VRFA 5EG4A 3GCOA 5T6DA 1LPZB 1C4V2 3K6ZA 3A7ZA 5FXLA 3EGHC 1JOUB 2LUIA 4JCNA 2XRCA 4X2WA 2D8WA 1OP2A 3FZDA 3SUZA 4HZHA 1QLCA 3GCHC 1SFQB 1NFYA 1SGCA 3R0HA 2G52A 4K76A 1FCFA 2WV4A 2EEKA 2M0UA 2GD4B 1GI6A 1C5QA 1T31A 1VITF 1BBRH 5EW1H 3CP7A 3I1EA 1O2WA 1BTYA 2OZFA 1ZHRA 2ZGHA 1HJAC 3ODFA 4Y7BA 3U1JB 1DVAH 4Z33A 3LGIA 1GBEA 3LH1A 1IAUA 2DUCA 3SNEA 7GCHF 1K1LA 2H9TH 4OAJA 2M3MA 4JZDH 1TNLA 1RIWB 2W26A 3KHVA 2TGTA 2QXGA 1WHAA 2KQFA 3MO6A 1XKAC 5JBCS 4OS1A 2BDBA 1L0ZA 1Q3PA 1OYTH 3PLPA 3SUDA 2JINA 4WXVA 3TIUA 3D23A 4JMYA 3S69A 2PKAB 4K2YA 1UJVA 1ACBE 4NMPA 1GDNA 2OC0A 1UJ1A 3DHKH 3LU9B 4ESTE 2R4HA 5JYIA 2WYJA 1O37A 1H8DH 1UTQA 4X8VH 1S82A 1G9IE 5HXFA 2R3YA 1ELEE 1NU9A 5C1XA 2RA0A 5FX6A 3ZYDA 3RXLA 1UVOA 2D90A 1O2IA 1O2RA 5G1EA 4BTUB 4REYA 2Y82A 3A7YA 1HFDA 1TBRH 5FPTA 2A4GA 2BVRH 4AZ2B 2GX4A 1V2RT 1ZUBA 2R0LA 1P2IA 2EHRA 1TQ3A 1AZZA 2BZAA 4GCHG 3HK3B 1BRAA 3UQVA 1BA8B 3SNBA 1QAVA 2HOBA 2W3KA 1LKBA 1EXFA 1SLWB 4KTUA 3TLOA 3EA7A 1D3QB 5A0BA 5J4QA 1BITA 4Y6DA 3UR9A 5C1YA 9LPRA 2I4SA 2TBSA 1BMMH 2Z3DA 1W10U 3H5CB 4H4FA 4BNRA 5HJ1A 2WPJS 5EPNA 1OBXA 1P01A 2HPQH 2F91A 4UEHH 3SGAE 2RG3A 4NSVA 4MPVA 3ZZBA 2GKVE 2TGDA 2ZTXA 3TNSA 1W13U 1WH1A 1AY6H 1N8OC 1NPMA 1DY8A 2QBWA 1KXBA 2VGCB 5FBIA 1O2GH 1PQ8A 1P3CA 1C1QA 1Z87A 4GVDA 2FZZA 3LDXH 3VXEH 3MO3A 4JOKA 1GHZA 1UHPA 2HALA 1ZSJA 2PDZA 3RUOA 3PMJA 1GVKB 1SMFE 4Q2NA 5GCHG 3RLWH 1GBAA 3TNTA 1E0FD 3BN9A 1ELDE 2C3SA 5C3NA 2XC0A 2RCZA 2ZDLA 1GVZA 2SGFE 1CBWC 2VJ1A 2C8YB 2D26C 3E0NB 1F0UA 2G55A 1KWAA 2XBYA 4ISOA 1EZUC 5ESBA 1A2CH 2H2BA 4NWKA 3M5MA 3RXIA 1OP8A 4GHQA 3LGVA 4NA7A 4MTBA 1LHDH 2NU4E 1PQ5A 4Q2OA 3IG6B 2GTBA 2ZIQH 1GI7B 3MTYA 5DTHA 1W14U 1P02A 1QB1A 5LPFA 1ARBA 1ZPBA 3PO1B 2A31A 4I8GA 2R0KA 1V3XA 2TGAA 2NU1E 4GVCA 1DT2A 1TGSZ 1Z71A 1PPGE 3PTNA 2AMPA 3RXSA 3A86A 2AMQA 2CHAB 3LH3A 2HGAA 2OS6A 1DLKB 1O34A 2J9NA 1HIAB 1KTSB 1KXDA 2A5AA 4ABHA 2F9OA 1RRKA 2H9HA 1ZPCA 1HNEE 2M0ZA 1F2SE 1C2DA 5F6MA 2CJIA 3QDOA 3FFGA 1RTLA 1RY4A 3LGWA 2F9PA 1XX9A 3SHAH 1TPPA 2PKTA 4ABEA 5LGOA 1AVXA 2ZHEH 1O2QA 1DUEA 1WQSA 4YZUA 4XHVA 4M7GA 1SG8B 3HATH 4NMRA 4E7NA 3AASA 3ID2A 1C2GA 3RXUA 4K5ZA 1MZDA 3ZZ8A 2BYAX 4A5TS 1L1JA 4K8BA 3TJNA 3EYDA 2YTWA 3VB4A 4IC5A 3UFAA 2VIPA 1D9IA 1V2OT 1QJ1B 1V2JT 5HM2A 3SGQE 1XXFA 2F3CE 2O8TA 2P59A 1LQDB 1A46H 1FC7A 1OZIA 2Z3EA 2PTCE 1XUKA 4IN2A 4VGCB 5T6GA 3RLEA 3I78A 2JH6D 3BTGE 2R3UA 1N6DA 1FIWA 5EGMA 3O46A 1XUIA 2VVUA 2BLVA 4YOJA 1ELTA 1O36A 1YPKH 2EDPA 1Z7KA 5EXMA 1C5VA 1G2MA 4FVBA 3AAVA 4I31A 3RXDA 1O2MA 1C1UH 4F4OC 1QQ4A 1N6FA 2A4OA 6GCHG 1TX8A 1RZXA 1RIWC 4RI0A 1G9OA 1T8OA 1FY8E 2XWBI 1O2ZA 1JWTA 1QCPA 3MWIU 1E34B 4ZROA 1MKXK 3SORA 1C5RA 1Y5UT 2PHBA 3PM3A 1BJUA 2P93A 5F8TA 5EXLA 2OLGA 3P95A 2F9BH 1WJLA 4ZHAA 1SQOA 1W2KH 1N7EA 2DC2A 2QF0A 1JRSA 2BDGA 4NIVA 3A84A 1A61H 3H7OA 1INCA 1IQJA 1EB2A 1C5XB 5HMAA 2BX3A 1WF8A 3KNXA 1BFEA 1QY6A 8GCHF 1NRSH 3A82A 1W9OA 2H3MA 2HLCA 3M5OA 1HGTH 2VWMA 4IC6A 2WYGA 4CRBA 4Z0KA 4JK5A 3RXPA 1P2NA 1CHGA 1SC8U 2RA3A 4NIXA 2BD4A 2BOKA 3UQOA 1FQ3A 1KXFA 1P0SH 3U8OH 2Z3CA 2V6NA 2FX4A 3D62A 1ESBA 5T3HA 3RXHA 1BTWA 1KLTA 5HF1A 3KF2A 2F5YA 1AUJA 2ZPQA 3RXTA 2DE8A 5I25A 2ALPA 3SHWA 2G2LA 1LPKB 2V35A 3NKKA 2WPHS 4X2VA 1SGQE 3T27A 4TPIZ 2ILNA 4D7FA 3QZQA 2QYIA 4B2CA 1GHAF 2EJYA 1H8IH 2FEQH 1BMLA 2ZO3H 4FUFA 2VIVA 1X5QA 3E6PH 1F5LA 1TNGA 2BYGA 1W0YH 3E3TA 3QDZB 4YOIA 3RC6A 4Y8YA 1Y5BT 1HAYB 1OXGA 3ZZ7A 1W9QA 1ZRBA 1YPHC 3Q00A 1GL0E 1HAXB 5E0JA 1EAWA 4OEPA 2Z17A 1A3EH 2OUAA 5JBAS 3CENA 1BT7A 1MTNC 2QAAA 1T8MA 1WUNH 1RTKA 5A8XA 2D1JA 3CBYA 5DP8A 5DP5A 2VGCC 4AFQA 1V2NT 2KJKA 1DWEH 4ZAEA 2QXHA 4JOPA 1MH0A 1GDUA 2FLRH 3ATLA 1EUFA 1Y59T 1O39A 4JYVH 4WF8A 1AWFH 1HBTH 4YYXA 3M7UA 4JOJA 1NTPA 2ZTZA 2BDYA 2WINI 5HETA 4WMEA 2CV3A 4P0CA 1ZTKA 2I6VA 3ESTA 1NRQH 2OINA 1TP3A 1GI2A 1WTGH 3ZYEA 3SNDA 3CBXA 2GGVB 3RLYH 2UWPA 2JXOA 2Q6FA 4DVAU 2EI8A 5C2ZA 1X8SA 1LKAA 3UOUA 3SU3A 1HLTH 1OWJA 1WFVA 1YKTA 2PR3A 1FN6A 3KZDA 1O2JA 1W11U 4RN6A 1IHJA 3GJ9A 3RXQA 3PO1C 1UTJA 4OEOA 4X1SU 1QL9A 1L1NA 2M10A 4YT6H 3LC3A 2H5DA 3T28A 2ZPSA 5HYOA 3S9CA 3GCHB 5FPYA 4OS7A 2H9EH 2ODPA 3WKMA 2XBWA 2A45B 4XBBA 1NC6A 4MNXA 1FXYA 4KFWA 3NZIA 4JZFH 3SU6A 1ZMNA 4DIHH 2SFAA 1W0ZU 2YNBA 4JYTA 3QK1A 1IU2A 1SHYA 1O3CA 1QR3E 1AKSA 2TGPZ 3KHFA 1U3BA 1AI8H 3RC4A 4AB9A 5HGGA 1GJ8B 1KY9A 2G00A 2VU8E 1D3TB 3DJ1A 5LPRA 2FX6A 3SU1A 2FXRA 4AG1A 3SW2B 1UTLM 2RCEA 1FAKH 1O5FH 1FI8A 4ZKOU 4DOQA 3KQEA 3E8LA 3MU5A 1P03A 1BUIA 2CSSA 1SBWA 1A5HA 3UNRA 1O2PA 4MDSA 2LPRA 2WPIS 3SI3H 4JOHA 4RSPA 3QTVH 2QKTA 1A0LA 3QIKA 2XXLA 1O3GA 4G69A 1SB1H 1AO5A 1WCZA 2UUKB 1N6YA 1TABE 5FBEA 2PKSB 3LNYA 3A81A 1GMCF 1GHVH 4LMMA 2KBSA 1C1MA 5HDYA 1TPOA 4DIIH 2FN5A 1SGRE 1Q3OA 2UWLA 2C8ZB 1EQ9A 4OGXA 3GCNA 5FCRA 1YYY1 1YPGH 4HFPB 1T4VH 2I04A 1GI9B 3MNCA 4O97A 2VIWA 1GMHG 1NY22 2QXJA 2X7ZA 2A1DB 2GP9B 4BANB 2OCSA 2SGPE 2FTMA 1FY5A 4HI3A 2L4TA 2A7HA 3B9FH 4LOYH 5EW2H 1S6FA 1OWEA 1P04A 1ZHPA 1KXAA 2HWLB 4NNLA 4ABFA 2PSYA 4JZ1A 2A5IA 2CSJA 2OGPA 1A3BH 1EJMA 1O33A 3AAUA 1GI3A 4MNWA 4AMHA 1HV7A 1DITH 2VPHA 4B75A 3PTBA 3GCTF 3P17H 1O30A 4NG9H 2XC5A 1P06A 1PYTC 1NN6A 4CHAB 4A7IB 1DPOA 2ZU2A 1BIOA 1AVGH 1NRRH 1C5ZB 4FXGH 3TK9A 2G51A 1FIZA 1UEZA 2ZPLA 1YLDA 1SI5H 1G2LA 3BTEE 3DORA 2BVSH 5E1YA 1AZ8A 4O3UA 3VEQB 4GUXA 1ELVA 3TK6A 1XVMA 2B9LA 4FUCA 3QZRA 5E8EH 4ABJA 2AERH 2BD9A 2Z94A 5HFBA 1C9TA 1O5EH 4UE7H 4NNMA 1SGNE 1UTKA 2O8LA 3G01A 3NFLA 3CS7A 1CBWB 1GJ7B 1TGBA 3HGPA 5F8XA 1HPGA 1UCYK 4AGKA 3SJ8A 3SV9A 4TPYA 1P05A 4X8UH 4WMDA 4Q2PA 1PYTD 5EXNA 5JB9S 1G32B 1QTFA 4TWWA 4KGAA 2Q9VA 4IBLH 1H9LB 9ESTA 2GCHF 2GZ9A 2W7SA 3S9BA 3BG4B 4O03A 3PDVA 1ETTH 1JRTA 2KOHA 2IWQA 1UK3A 3KQCA 4U30A 1VCWA 1K21H 3FZZA 1YP9A 3TH4H 5E2PA 2Y7ZA 2AINA 3M7TA 4Q6SA 1O5DH 3SHUA 3K82A 3A8DA 1NTEA 1ZTLA 1K2I1 1UK4A 1D6WA 2ZGCA 3SNAA 1O2HA 1C2IA 3W94A 2ZHDA 2VVCA 2SGQE 1GHBF 1UVTH 2XW9A 1I92A 1MKXH 1TFXA 4Q2KA 3TH2H 1ZMJA 1O35A 1WBGB 3MH7A 4UU5A 3OSYA 2VIOA 2ZTYA 1HXFH 4X2YA 1O2LA 1N99A 1X7AC 2ZGJA 2GMTB 1GMDF 1P3EA 3JXTA 3AXAA 4ZKNU 3GISB 3B23B 2H2ZA 3M3SA 3TITA 2G4TA 1MU8B 1GJBB 1O3IA 2ODYB 2BVXH 4Y76A 3MNBA 4X1QU 2OBOA 4X6PA 1K1PA 3PYHA 5E0GA 3SI4H 3SU5A 1BOQA 3MU1A 4F49A 1TP5A 1EAIA 2HPPH 1NF3C 3RXJA 2IPHA 2A5KA 4NZQA 4ABAA 1KDQA 3GY2A 5JBTA 2SGDE 2F9NA 6LPRA 1C2HA 4SGBE 5A2PA 2H5CA 2B0FA 3SN8A 3VPKA 1XUGA 5GXPA 1E35B 1FY3A 4UONA 3ATMA 4BAMB 1E37B 1FUJA 2GZ7A 1QA7A 1GI5A 3LIWA 5DP3A 1F0RA 1CVWH 2CGAA 2EAQA 2STBE 2XNIA 4OS2A 1OPHB 5TCAA 1QNJA 1AMHA 4JYUH 2EEIA 2Q1JA 1UTOA 3PWBA 5PTPA 1T32A 2GV6A 2ZWLH 3M35A 4O06A 1N7TA 1GCTC 1GWAA 3RMNH 2KJDA 1MKWK 3A7TA 1WIFA 3LKWA 4KKDA 1L1GA 1ZLRA 2ZG0H 2ZHQH 3ELAH 1A0JA 2G81E 3M7QA 4IMQA 2QKVA 1LTOA 1QRWA 1NFWA 1DUAA 1E36B 3SU2A 4A1TA 1EKBB 1GJCB 1SGIB 1E38B 1LHCH 3V7TA 1CSOE 1DM4B 2ZQ2A 3Q3KA 1O3DA 5HFDA 2CS5A 3LJOA 1QB9A 4Q6HA 3A7WA 2PKSC 3KQDA 2OP9A 1DWBH 4H6TA 5ESTE 1O3BA 3MNXA 2A4QA 1QGFA 2BDIA 2XBVA 1OBZA 1A5IA 2J38A 3OX7U 1HCGA 5C67A 4TY7A 3V12A 1O32A 5A8YA 1O2UA 2F83A 2EA3A 2ZP0H 4LK4A 3SUFA 3SV8A 1HAGE 1PQAA 2KPLA 4HTCH 1EB1H 4MLFB 2C8XB 2KV8A 2EEGA 1NFXA 1BRBE 1OKXA 3HPKA 2REYA 1O2SA 1IHTH 1SGFG 2ZU1A 1TMBH 3PLBA 1ZJDA 3N7OA 4WWYA 1M5ZA 1TWXB 1IQGA 1TRYA 1Z1IA 2F9VA 3RL8A 2YOLA 4KP0A 1VJ6A 1RGRA 4NWLA 3GY6A 1XXDA 4AFZA 1YCPK 4AB8A 1V2LT 1J16A 2AGIX 1V2VT 1AE8H 1SGDE 1UFXA 4JOEA 2NU2E 1UTPA 2AMDA 1EOJA 1YBWA 3STJA 1MTNB 1AU8A 2FPZA 4CREA 2WUCA 4GSOA 1K9OE 1TNJA 2BD3A 2FOFA 1QBNA 4ABIA 1GG6C 4CHAC 1KXCA 3DFLA 3PMHB 4O3TA 5DP7A 5G1DA 3FAOA 5JBBS 1QQUA 2A7JA 4FVDA 4U32A 2C8WB 3NGHA 1UK2A 2Y6TA 1GBBA 2AWXA 1C2LA 3K6YA 3R0FA 1UITA 3K1RA 1MCTA 1EP5A 3UTUH 1FMGA 2FOMB 1QAUA 4UD9H 2H1UA 1TMTH 1V2ST 1Y3UA 1MQ6A 3HKJB 1F5KU 4X6NA 1MTSA 2ZI2H 1C2KA 3CYYA 1C5SA 2Y5GA 1Z8IB 1C1TA 1ZSKA 1MZAA 1F5RA 4DW2U 3M5NA 5GLJA 1HAZB 4XBDA 1KEFA 2D8IA 3B8JA 1THRH 1FC6A 1N6EA 4X6MA 3RXKA 3UNSA 4D76A 3TGJE 1ID5H 3EGGC 4Q3HA 1O2YA 1HB0B 5HFCA 3BG4C 1B8QA 1V62A 5K0HA 2FI4E 1AVWA 1LMWB 1WU1A 1WG6A 1CGHA 4YLUA 3P8GA 1X45A 2G8TA 1GI1A 2FTLE 2PA1A 2YT8A 1DDJA 2VWOA 3R3GB 3ZVGA 3ZVFA 2V1WA 1VGCB 2ZFQH 1F0TA 1ZJKA 4FU8A 1Y3WA 1S0QA 2H2CA 4ZKSU 1G3CA 3T2NA 4WY3A 5DKMA 4YO9A 1Q2WA 1ELFA 1JBUH 3VB7A 3QTOH 4X0WU 5C20A 5G4BA 2VWRA 3BTTE 1VITG 2ZHWH 4MPWA 2P94A 1D5GA 2P3UB 5EU8A 1V2WT 2HNTF 2K20A 5DPAA 2BLOA 1UM7A 3B76A 2Z9GA 3A7VA 2H6MA 2HRVA 2GMTC 2WL7A 3KGPA 4IW4E 4MVNA 2ZDNA 7GCHG 5HEBA 1SLVB 4NIYA 1AFQC 1VJAU 1TOCB 1GJ6A 3C27B 1HRTH 1ANEA 5C5OA 5EYZA 1C5UA 1LHGH 3CH8A 1OS8A 4NSYA 1AGJA 2AGEX 2PLXA 4X6OA 4WMFA 3ZZ4A 4TWYA 2BLQA 3K9XB 1P12E 1L4ZA 4FUGA 2KAIA 3PDZA 4K75A 1ZRKA 4TY6A 1IQMA 3L4FD 3OY6U 5H4IB 4MNVA 4MPXA 3ID4A 2ANKH 1J17T 5A8ZA 1A0HB 2Z9KA 1UCYH 1SLXB 2P95A 3EQ0H 3F9FA 2BD8A 3QLPH 1C2JA 1KTTB 3DIWA 2ZFRH 4IMZA 5E21A 4YM9A 1VJ9U 1Y8TA 1PPBH 1SLUB 1ESTA 2Y5FA 3DA9B 4B1TA 2BB4A 2G4UA 3M3TA 1P09A 2L4SA 2ZCHP 3A87A 1GBCA 3SUGA 4L8NA 3NFKA 4Q2QA 3UR6A 3TH3H 5TCCA 2FWWA 3P8OA 1U6QA 1ORFA 3Q76A 3UPEA 1Y3VA 3W95A 1WTHD 1GBIA 3Q3XA 3SUEA 4AX9H 5IDKA 4K3JA 3ZZDA 1UVPA 1AE5A 1THPB 2QXIA 4X1RU 3JZ2B 2KG2A 3O5NA 1V2MT 4DURA 4DJZB 1YC0A 4RKJB 3T26A 3ENSB 4XFQA 4Y8ZA 4ZUHA 4ZMAH 1C5YB 1CT0E 1WI2A 1UCYE 2A0QB 5AF9H 2NWNA 3LGUA 1J8AA 2Q6DA 5E6PB 4Y71A 1ELBA 5FHTA 1C2FA 2J4IA 3UWJH 2BY8X 3KN2A 4D9QA 2PKAA 1PQ7A 1DX5M 2DLUA 1W7XH 1MFGA 1EAUA 2QIQA 2TPIZ 2PWXA 3D49H 2CXVA 1QIXB 3MFJA 2HE2A 2ZQ1A 3MU8A 1ZOMA 1O2KA 2EGKA 1YCPM 1LO6A 3UUZA 3ZZ9A 1CGJE 3CBZA 2BZ6H 5CE1A 1ARCA 2IWOA 2GDEH 1WOFA 2VSVA 2VWNA 1F0SA 4YTAA 1MFLA 1PDRA 1CHOF 1TGCA 2NU3E 3BTFE 1TX7A 1GVLA 1MTWA 3GGEA 4BAHB 1GPZA 3E1XB 3ATWA 2JIKA 3LJJA 1DWDH 5DP4A 2ZPMA 2FI5E 3RXCA 1AWHB 3SJ9A 5A09A 3DD2H 2ZHFH 2JETC 3RDZA 1X5RA 1MD7A 1BBRK 2P8OB 1EZXC 2PNTA 1MAXA 1GHWH 3PMBB 5EQSA 1WHDA 2KOJA 4E06H 1QJ6B 1TLDA 3A89A 3M36A 4K1EA 2CF9H 1Q7XA 1V6DA 2FOEA 5A2MH 1Y7NA 3T62A 2QG1A 1O2VA 2QCYA 3F9EA 5AFYH 3MHWU 2ZZUH 5JB8S 1DSUA 3BTDE 3MH6A 1TGTA 2AEIH 4Y0ZE 1TPSA 5F8ZA 1TB6H 2SNVA 1T8LA 1GBJA 4XOJA 1S83A 2R2WU 3SOSA 1P2JA 3MOCA 1VITH 1HAVB 2OPGA 2ULLA 1SGPE 2LOBA 1GDQA 1Q3XA 1O5GH 2ZDVH 4E3BA 1Z8GA 1M9UA 2ZU3A 1S6HA 3FP6E 3BTQE 3GICB 3S9AA 3ZZ5A 3SV6A 3GY5A 3GYLB 2OQUA 1OWDA 1PPHE 3HKIB 2WPKS 4R2ZA 4KTCA 2QC2A 4Q7YA 1TYNA 4WYUA 2OC8A 1FY4A 1V2KT 2ZFTA 2GVFA 1EPTA 1SSXA 1MQ5A 1EASA 5AFZH 4A1VA 6ESTA 5EPYA 1YLCA 2QKUA 5BPEA 2C90B 2G5NA 2A2XH 1T8NA 2VIQA 1GBMA 5E11A 2FMJA 1T2MA 2JKHA 5DK1A 1VGCC 4AN7A 4I32A 2FLBH 3FP7E 4ZKRU 4JZEH 1G3EA 3PWCA 1JXPA 3LGTA 1ZYOA 4INKA 2RRMA 5K7RA 1CA8B 1TQ7B 4SGAE 4WVPE 2FS9A 3OU0A 2IWPA 3URCA 4GLYA 3S7KB 3PV4A 1FPCH 3KIDU 4INLA 2GT8A 4UFFH 5EQQA 2KA9A 3JZ1B 1RD3B 4WH6A 2JH5D 3DUXH 1SGYE 1J15A 4NXQA 1ZGIA 1SR5C 1K28D 1GCTB 4CRFA 1GI8B 3P70B 2ZA5A 1L4DA 4X2XA 1GHXH 2BMGB 2I6QA 2PTNA 1RGWA 1ZGVA 2L97A 1TMUH 4H42U 2EGNA 1K1MA 4ABGA 1OWIA 4BAQB 4O9VA 3C1KA 4K72A 1PFXC 3HPMA 1YPJH 3BTME 1S84A 1PPFE 1P11E 4GHTA 1O3JA 1UM1A 2B7DH 1HAPH 2ANYA 1S81A 4K60A 4Y0YE 1WYKA 1BCUH 4I8LA 2GZVA 1GJ4H 3BIUH 2SNWA 1WV7H 4FUEA 5E2OA 3MH5A 2EDZA 1KYNA 4GAWA 4Y7AA 3BTWE 3F1SB 2HE4A 8GCHG 3U98H 2FNEA 2V3HH 4Y10E 1BRCE 2W7UA 1QAVB 1QJ7B 4E35A 1L2EA 3CC0A 1GBLA 1MTUA 1L6OA 1AHTH 1IQHA 4DY7B 1V1TA 3UY9A 2ZEBA 5H3JA 1P57B 3L3TA 3RC5A 5J4SA 1VB7A 2YUYA 4GHNA 3EDXB 1Z8RA 2BDCA 4GPGA 5F67A 1G36A 4UFDH 1RFNA 2IN2A 3M37A 4A1XA 3NK8A 3GSLA 3O8RA 1YPEH 1UVSH 4CR9A 1WI4A 2CMYA 4NFEA 1GHAG 4E7RG 5E22A 1DXPA 1KXEA 2VB0A 2AWUA 4NMOA 4AFUA 4HOPA 1LCYA 3ZRTA 1HAOH 2MHOA 1MAYA 2OD3B 1H9IE 4FUJA 2QY0B 1GG6B 2QF3A 3ZVAA 5DP9A 1SQAA 3GY8A 1CO7E 4D7GA 1EOLA 1GBKA 1N1LA 1VZQH 2XCFA 1AFEH 3SJOA 4K6YA 1C5PA 1XUHA 2AWWA 2QN5T 4LZ1H 3I29A 3ZV9A 4BXWA 1MBMA 3SGBE 3PB1E 3T29A 2PGQB 3M5LA 3FY5A 1NRNH 3WY8A 4ASHA 5L2YH 3LOXA 3T5FH 4NZLA 1NFUA 1AUTC 1OWKA 1X6DA 3LT3A 2FM2A 4EDJA 1JIMA 2ZF0H 4GCHF 4WJG2 4ZXYH 3RMMH 3RM0H 4YDPA 1EP6A 1XKBC 2Z7FE 5FPSA 3RXMA 1VCPA 4H6SB 3VQGA 5JDUB 5HM9A 4B74A 2CF8H 2FYQA 2IOTA 3U9AH 1X5NA 1ELCA 4AYYB 1GJ5H 2PZDA 3HPTB 3L33A 3QWCH 1GQ5A 1A5GH 3RU4D 1P9UA 2P8OC 4UFEH 4AOQA 2LNCA 4NXPA 3V0XA 2DAZA 1VAEA 2K1ZA 1Z8JB 3SV7A 4BXSA 4OS6A 4K78A 2VINA 1V2PT 5DG6A 3ZZCA 3BPUA 1JMOH 1UHBA 4NA8A 5JXBA 2OXSA 3O8BA 3ZZ3A 3CS0A 1QL8A 1Z6EA 3TSZA 1UEQA 3KCGH 3RXRA 1KSNA 5DO4H 4MG3A 2SGAA 5FB8C 3BIVH 1TBQH 4AGJA 1D3PB 5GCHF 2FOHA 1Q31A 3Q77A 1GJDB 4I8HA 1AFQB 4GVUA 1IQIA 1O3HA 1A4WH 1ZR0A 1NO9H 2ZU4A 1BTPA 5DJ7A 1C5TA 1O31A 1AIXH 1KIGH 1A1RA 4ABBA 3V13A 4D9RA 1CQQA 2ZDMA 4BTIB 2ZNKH 1EAXA 2KAIB 5F03A 4PQWA 3URDA 1G3BA 3E91A 2AFQB 3TK5A 3F6UH 4ZH8A 1O2TA 2VZ5A 1WF7A 4ISLA 2JILA 2Z9LA 2BDAA 4JOFA 1P1DA 1DE7H 1TOMH 5AHGH 4INHA 1LVBA 1RTFB 4XSKU 4U01A 3GDUA 5B6LA 1SFIA 2V3OH 2KYLA 3DT0H 3TGIE 3RXOA 1D4PB 5DGJA 5A0AE 1LVOA 1GMCG 2DLSA 3KQBA 5FX5A 1D6RA 3P92A 1QFKH 1GL1A 3QUMP 1WQVH 1XUFA 1P2KA 3EAJA 1XM1A 2GDDA 3SHCH 3QGLA 2UWOA 2ZCKP 2ZGXH 1LPGB 4Z6AH 7KMEH 2DJTA 4CRCA 4A92A 1SVPA 1BHXF 1RXPA 1FLEE 1J9CH 1RS0A 2QA9E 3GDVA 1GM1A 1H1BA 1EX3A 2FOAA 5LH8A 1O3NA 1EZQA 3OTJE 3HVQC 2SGEE 2ZDKA 1HJ9A 1MBQA 3LPRA 4BAKB 5IYTA 1BTUA 3GY7A 4RKOB 1G30B 2W3IA 3TJUA 1CA0B 4X8TH 5FCKA 3S0NA 4OGYA 3GCTG 1DS2E 1GQ4A 2O2TA 3BTKE 4B76A 1W12U 4P2AB 1GBDA 5HEDA 3GY3A 1C1PA 2EXGA 5HFEA 2PGBB 2C93B 4NMSA 2QV1A 5GWZA 1UJDA 2QT5A 3UOPA 1C5WB 1BBRE 1O3MA 4YLQH 1BTHH 1B5GH 2VH6A 1HDTH 1C2EA 3ATIA 2OCVB 3TU7H 3RP2A 1O3EA 5EODA 2GCTB 1F7ZA 2J92A 3E90B 2J95A 5HEYA 1S85A 3ITIA 2VVVA 1CT2E 4K69A 1OSSA 6CHAB 6GCHF 2HNTC 1C1WH 3EA8A 2OQ5A 1A7SA 3M61U 4ZXXH 3ZV8A 4YOGA 3OTPA 1IHSH 3NXPA 1ETRH 4FUDA 1TRNA 2JETB 3U1IB 3GOVB 2C4FH 1WSSH 4CBNA 3T25A 1NESE 3TSVA 1BDAA 4CBOA 1HAIH 1O5BB 4MPUA 1Z86A 4I8KA 2GCHG 3S7HB 4FU7A 2GT7A 1K1IA 1DICA 2IJOB 3TPIZ 2KL1A 3RXVA 2OQSA 4F8KA 3BTHE 4J1YA 2K1QA 3VB3A 3UIRA 2P3TB 1RJXB 4LXBH 4NMTA 4NIWA 4YESB 4FUHA 1DXWA 4ISNA 3BEFB 3IITA 1CE5A 2P16A 4XDEA 2Q6GA 4BTTB 2THFB 2OC1A 1MC7A 1MTVA 1C5MD 2PV9B 4XE4A 2FCFA 1GJAB 1SL3A 2EGOA 2ZFSA 1O2NA 1QBVH 1YPMH 3MMGA 4R0IA 1BB0B 2D92A 1GHBG 3H7TA 1ZOKA 2H3LA 2I0IA 3U8RH
chains in the Genus database with same CATH superfamily
2BY5X 1ANBA 1DANH 2JWEA 2UZCA 2W7RA 1O2XA 2W5EA 3P8FA 1VCQA 2UUFB 2Y5HA 4K8YA 2RFKC 1VA8A 1EPTB 1GMDG 4CRDA 1BRUP 3OFND 1K32A 2ZGBH 3OE7D 1NT1A 1G37A 1U38A 2OSGA 5ETXA 1UF1A 3RMOH 3PS4A 4B2AA 1HJ8A 3SJIA 2FOBA 3ID3A 1TGNA 5GIBA 4DT7B 3BV9B 2M5TA 5C17A 1IQKA 1C4Y2 2Z9IA 2EI7A 2OBQA 7LPRA 3E0PB 3ZVEA 4IS5A 1O5CB 1C9PA 2P3FH 2J34A 1AKSB 1HUTH 1WFGA 2LA8A 2PUQH 3F9HA 1YBOA 2R9PA 3OAAD 5HIYA 5DP6A 4Y79A 2VWLA 3KZEA 2ZECA 1T4UH 1OX1A 2O9QA 1NROH 5A0CA 1O3PB 1IQFA 1Y3XA 3NCLA 2V3MA 3MNSA 1O5AB 1O38A 2V7QD 2Z9JA 1GGDB 1GBFA 4NGAH 1LDTT 3UREA 4Q7ZA 5C1UA 2BY7X 1GJ9B 4KFVA 2LC6A 1YPHE 3BEUA 3A88A 1GI4A 1BZXE 2F0AA 3LNXA 4R8TB 2Y81A 1SOZA 1YLNA 1IQEA 2UUYA 1UEWA 4JK6A 3DFJA 3TVJB 3SQEE 4AG2A 1FDPA 2AIPA 2VH0A 3BEIB 1WAYB 1P1EA 4CRAA 2PUXB 1FC9A 4P02A 1MCVA 5B6OA 1S5SA 3PV5A 2ZFPH 1BMNH 3IWMA 1BE9A 1UJUA 1VR1H 2W4FA 1TX6A 4DGJA 4ABDA 1LVYA 1YPLH 2WV9A 2KPKA 3BF6H 2TRMA 3NWUA 3K65B 1TBZH 3UNQA 1GBTA 1SQTA 1QURH 3RL7A 3F2HA 1SHHB 3RXEA 3DSGA 4A6LA 1O3AA 5BRRE 1B0FA 3FANA 1W9EA 1FV9A 3QJNA 1AN1E 5LPEA 3P6ZB 1W3CA 1GHYH 2ZKSA 4BAOB 3VFEA 4U2WA 3TMHA 5EQRA 4UDWH 2VIDA 3ZZ6A 1UTMA 5C0UA 4AORA 2E7KA 3Q3YA 1UMAH 4WXIA 2LC7A 2FP7B 3DJAA 4HOPB 3SO3A 3TJOA 1G3DA 1UO6A 2A32A 2KAWA 1V2TT 2Q3GA 1QRZA 1UW7A 2FE5A 1W0KD 4FGMA 1F92A 2JREA 3O8DA 1O3FA 1P9SA 1BJVA 1TA6A 1O2OA 1P2OA 2A7CA 2F9UA 2IWNA 4JJ3A 1CA0C 4LZ4B 1CT4E 1B7XB 4NXRA 4I8JA 2UUJB 3PROA 3SOEA 1YGCH 3FN8A 2KCAA 2ANWA 2FYRA 3OYPA 1ETSH 5JPMH 4XBCA 2TIOA 1AB9B 2XC4A 2AS9A 3SV2H 3VGCB 2AYWA 1C1NA 3KEEA 1FAXA 3SQHE 2FESH 1H9HE 3NPSA 2J2UA 5C94A 1AD8H 2A2QH 1UEPA 2FDAA 2GCTC 2QGRA 2BQ7B 5GNDA 1P10A 3GY4A 1BTZA 1QA0A 3QX5H 3SU0A 1O3LA 2PW8H 2M0TA 5SGAE 1QRXA 4Q7XA 1P2MA 2R2MB 1OYQA 2FI3E 3PMAB 6CHAC 1IQLA 3P8NA 4ISHH 1UTNA 3A7XA 4BOHA 1OOKB 1GMHF 1JIRA 3RXGA 2OTVA 4H11A 1TNHA 3SNCA 1BHXB 4E34A 1C5LH 3MU0A 2AIQA 3M3VA 1V5QA 3A83A 1V2UT 1B0EA 1U39A 4NCYA 5EZ0A 1PPZA 2DB5A 3EE7A 1UHBB 2Z6BD 4AFSA 5GPIB 1TE0A 2FIRH 2VBCA 4XD7D 1ELGA 4Q4LA 2EV8A 1DOJA 5CHAB 2EI6A 3I4WA 2O8MA 4OS4A 7ESTE 3RMLH 3KL6A 1DFPA 1C1OA 1BTXA 5L30H 2G5VA 1MKWH 5AVDA 1OBYA 1OWHA 3AW0A 1OHHD 1IQNA 2BXTH 5I7ZA 1ABJH 1C1RA 3OY5U 3R68A 3TGKE 2BD5A 4B73A 1ZPZA 2WPLS 3ZVDA 4N6XA 2BD7A 3ZZAA 2MX6A 1W7GH 2NU0E 4JZIA 2AH4X 3RM2H 1FZZA 1W8BH 2BY9X 2I6SA 3V3MA 4D8NA 1FNIA 2BTCE 1OP0A 3QN7A 1DY9A 1Y3YA 2JH0D 2OC7A 2ESTE 4FUIA 1Z1JA 1EPTC 3HGNA 4UU6A 4ZCNA 3GDSA 2HGTH 3EGKH 2G5MB 4MPAA 2V90A 3MH4A 4ZHMU 3O8CA 3FP8E 2AGGX 2ASUB 1KDQB 3RXFA 4FUBA 1BMAA 1BQYA 2P3WA 4JORA 3LONA 1FONA 3LGYA 2Y80A 3BG8A 5B42A 2BLWA 3RU4E 3AW1A 2DMZA 3MO9A 3SU4A 4CR5A 1W0JD 3TSWA 1C5OH 1YM0A 3VXFH 5ABWA 3EE0B 1YCPH 1HAHH 1P8VC 1SGEE 3QJMA 1K1JA 2I0LA 2KX4A 5F3XA 2CHAC 4DCDA 8KME2 1R6JA 3K2UA 1C4U2 1V5LA 2DM8A 1GGDC 1ZSLA 2YT7A 4KELA 4HGCA 2K0QA 1NU7B 3ZVCA 2XBXA 1HIAA 1O3KA 1S0RA 5HFFA 1HJAB 4NA9H 5L6NH 4K1TA 1ABIH 1C2MA 1KLJH 1QHRB 2BHGA 2DE9A 3ODDA 1PJPA 4UFGH 2I1NA 2WUBA 2XYAA 3MI4A 1UVUH 2WPMS 3RXBA 2CN0H 2ENOA 4JOGA 1QBOA 8ESTE 1SGFA 3F9GA 1ESAA 2BDHA 1O3OA 5CMXH 3NUMA 2EC9H 1PPEE 2RDLA 1C5NH 1DLEA 2ZC9H 3ZIAD 1K1NA 4FU9A 1SGTA 1NRPH 4NMQA 5D13A 3I77A 2ZDAH 1NBME 1XMNB 3A80A 1V6BA 4DG4A 2VSPA 1TAWA 2ZFFH 3QGNB 4WH8A 4CH8B 1D3DB 1TA2A 2B5TB 4NFFA 2O8UA 5GDSH 2WV5A 4VGCC 1YF4A 5EOKA 1IOEA 2FO9A 3RU4T 1HXEH 2BX4A 2KR7A 5E0HA 3MQKC 2BM2A 5C5NA 1SPJA 2EEHA 1MUEB 1CHOG 4YT7H 2JOAA 4ISIH 3RXAA 2FS8A 1Z6JH 1TONA 1XUJA 2O8WA 1DWCH 1IU0A 2DKRA 2HVXA 3PLKA 5TJXA 1KLIH 5I46H 4K1SA 1CU1A 2BQ6B 3F3BA 2D2DA 4CH2B 3AVZA 4NMVA 3BSQA 2FODA 1C1VH 1THSH 1TRMA 1MU6B 1U37A 1CGIE 1NZQH 1ZMLA 1EJAA 3SJKA 3D65E 1AQ7A 4IGDA 2BY6X 3LC5A 1MMJN 4I33A 1FPHH 4QT8C 1AB9C 1LHEH 1GBHA 1QL7A 2XOKD 3VGCC 1LVMA 1EFRD 3HK6B 2Y7XA 3ID1A 1N8OB 1TNKA 2QF5A 3VQFA 3VB5A 4J2YB 1I16A 4WYTA 4JL7A 3SFJA 2STAE 3A8AA 3A8CA 3A85A 4MNYA 4E05H 1N7FA 2GZ8A 2GV7A 5T6FA 1ANCA 3A8BA 4Y8XA 3L6PA 4I86A 5GJ4B 1LQEA 2BQWB 1NM6A 2V0BA 4B2BA 1FN8A 4Q80A 1XZ9A 1TNIA 3K50A 1N6XA 2KJPA 2FOGA 2GEFA 3U69H 3UWIA 2PKUA 2YUBA 2B8OH 2XTTB 4MQAA 2EDVA 3QGJA 4X1NU 1SOTA 3E17A 3I18A 2BOHB 1HYLA 2J5UA 1PPCE 1LHFH 1EJNA 3N99A 4X8SH 3DJ3A 2OMJA 1FJSA 1ZTJA 3FVFB 3F68H 2PSXA 1RGQA 4Y11E 2QE7D 5CHAC 2FOCA 3MYWA 3VB6A 1TQ0B 1TALA 3F2GA 4CRGA 4KTSA 1ZZZA 2ZU5A 2ODQA 2BD2A 3EA9A 2YNAA 1TPAE 1V2QT 4I7YH 1P2QA 3WWBA 1DSTA 5HF4A 4X1PU 2KOMA 1EATA 3ZVBA 3SZNA 2M0VA 3GYMA 2XWAA 1FY1A 1ELAA 1Y5AT 4ZHLU 1MD8A 1O0DH 2HNTE 2A4RA 2VNTA 1K1OA 3WKLA 1TIOA 2KRGA 1GI0A 2J94A 2XCNA 4TYDA 1QB6A 2BXUH 8LPRA 4IN1A 4Z8JA 1ANDA 2ZPRA 1GCDA 4ACBA 3E16B 3QO6A 1EZSC 5L2ZH 3STIA 5FAHA 1C1SA 1H4WA 1J14A 3QE1A 1NS3A 4B71A 4OS5A 2ALVA 5ILBA 1HAVA 3ATKA 2ZCLP 1T7CA 3U8TH 3SBKA 1K22H 2JDID 4THNH 1XVOA 3PV2A 4PROA 2EEJA 4AYVB 3R69A 3MU4A 2ANMH 2PFEA 1ZHMA 3TJVA 2VRFA 5EG4A 3GCOA 2WHXA 5T6DA 1LPZB 1C4V2 3K6ZA 3A7ZA 5FXLA 3EGHC 1JOUB 2LUIA 4JCNA 2XRCA 4X2WA 2D8WA 1OP2A 3FZDA 3SUZA 4HZHA 4TSFD 1QLCA 3GCHC 1SFQB 1NFYA 1SGCA 5CDFE 3R0HA 2G52A 4K76A 1FCFA 2WV4A 2EEKA 2LP6A 2M0UA 2GD4B 1GI6A 1C5QA 1T31A 1VITF 1BBRH 3F0PA 5EW1H 3CP7A 3I1EA 1O2WA 1BTYA 2OZFA 1ZHRA 2ZGHA 1HJAC 3ODFA 4Y7BA 3U1JB 1DVAH 4Z33A 3LGIA 1GBEA 3LH1A 1IAUA 2DUCA 3SNEA 7GCHF 1K1LA 2H9TH 4OAJA 2M3MA 4JZDH 1TNLA 1RIWB 2W26A 4DT4A 3KHVA 2TGTA 2QXGA 1WHAA 2KQFA 3MO6A 1XKAC 5JBCS 4OS1A 2BDBA 1L0ZA 1Q3PA 1OYTH 3PLPA 3SUDA 3WWFA 2JINA 4WXVA 3TIUA 3D23A 4JMYA 3S69A 2PKAB 1YY3A 4K2YA 1UJVA 1ACBE 4NMPA 1GDNA 2OC0A 1UJ1A 3DHKH 3LU9B 4ESTE 2R4HA 5JYIA 2WYJA 2J98A 1O37A 1H8DH 1UTQA 3F0OA 4X8VH 1S82A 1G9IE 5HXFA 2R3YA 1ELEE 1NU9A 5C1XA 2RA0A 5FX6A 3ZYDA 3RXLA 1UVOA 2D90A 1O2IA 1O2RA 5G1EA 4BTUB 4REYA 2Y82A 3A7YA 1HFDA 1TBRH 2WPDD 5FPTA 2A4GA 2BVRH 4AZ2B 2GX4A 3FKSD 1V2RT 1ZUBA 2R0LA 1P2IA 2EHRA 1TQ3A 1AZZA 2BZAA 4GCHG 4ASUD 3HK3B 1BRAA 3UQVA 1BA8B 3SNBA 1QAVA 2HOBA 2W3KA 1LKBA 1EXFA 1SLWB 4KTUA 3TLOA 3EA7A 1D3QB 5A0BA 5J4QA 1BITA 4Y6DA 3UR9A 5C1YA 9LPRA 2I4SA 2TBSA 1BMMH 2Z3DA 1W10U 3H5CB 4H4FA 4BNRA 5HJ1A 2YMSB 2WPJS 5EPNA 1OBXA 1P01A 2HPQH 2F91A 4UEHH 3SGAE 2RG3A 4NSVA 4MPVA 3ZZBA 2GKVE 2TGDA 2ZTXA 3TNSA 1W13U 1WH1A 1AY6H 1N8OC 1NPMA 1DY8A 2QBWA 1KXBA 2VGCB 5FBIA 1O2GH 1PQ8A 1P3CA 1C1QA 1Z87A 4GVDA 2FZZA 3LDXH 3VXEH 3MO3A 4JOKA 1GHZA 1UHPA 2HALA 1ZSJA 2PDZA 3RUOA 3PMJA 1GVKB 1SMFE 4Q2NA 5GCHG 3RLWH 1GBAA 3TNTA 1E0FD 3BN9A 1ELDE 2C3SA 5C3NA 2XC0A 2RCZA 2ZDLA 1GVZA 2SGFE 1CBWC 2VJ1A 2C8YB 2D26C 3E0NB 1F0UA 2G55A 5DN6D 1KWAA 2XBYA 4ISOA 1EZUC 5ESBA 1A2CH 2H2BA 2AHME 3M5MA 4NWKA 3RXIA 1OP8A 4GHQA 3LGVA 4NA7A 4MTBA 1LHDH 2NU4E 1PQ5A 4Q2OA 3IG6B 2GTBA 2ZIQH 1GI7B 3MTYA 1MABB 5DTHA 1W14U 1P02A 1QB1A 5LPFA 1ARBA 1ZPBA 3PO1B 2A31A 4I8GA 1WDIA 2R0KA 1V3XA 2TGAA 2NU1E 4GVCA 1DT2A 1TGSZ 1Z71A 1PPGE 3PTNA 2AMPA 3RXSA 3A86A 2AMQA 2CHAB 3LH3A 2HGAA 2OS6A 1DLKB 1O34A 2J9NA 1HIAB 1KTSB 1KXDA 2A5AA 4ABHA 2F9OA 1RRKA 2H9HA 1ZPCA 1HNEE 2M0ZA 1F2SE 1C2DA 5F6MA 2CJIA 3QDOA 3FFGA 1RTLA 1RY4A 3LGWA 2F9PA 1XX9A 3SHAH 1TPPA 2PKTA 4ABEA 5LGOA 1AVXA 2ZHEH 1O2QA 3U28C 1DUEA 1WQSA 4YZUA 4XHVA 4M7GA 1SG8B 3HATH 4NMRA 4E7NA 3AASA 3ID2A 1C2GA 3RXUA 4K5ZA 1MZDA 3ZZ8A 3KDGA 2BYAX 4A5TS 1L1JA 4K8BA 3TJNA 3EYDA 2YTWA 3VB4A 4IC5A 3UFAA 2VIPA 1D9IA 1V2OT 4FOUC 1QJ1B 1V2JT 3GABA 5HM2A 3SGQE 1XXFA 2F3CE 2O8TA 2P59A 1LQDB 1A46H 1FC7A 1OZIA 2Z3EA 2PTCE 1XUKA 4IN2A 4VGCB 5T6GA 3RLEA 3I78A 2JSNA 2JH6D 3BTGE 2R3UA 1N6DA 1FIWA 5EGMA 5KECA 3O46A 1XUIA 2VVUA 2BLVA 4YOJA 1ELTA 1O36A 1YPKH 2EDPA 1Z7KA 5EXMA 1C5VA 1G2MA 4FVBA 1VKYA 3AAVA 4I31A 3RXDA 1O2MA 1C1UH 4F4OC 1QQ4A 1N6FA 2A4OA 6GCHG 1TX8A 1RZXA 1RIWC 4RI0A 1G9OA 1T8OA 1FY8E 2XWBI 1O2ZA 1JWTA 1QCPA 3MWIU 1E34B 4ZROA 1MKXK 3SORA 1C5RA 1Y5UT 2PHBA 3PM3A 1BJUA 2P93A 5F8TA 5EXLA 2OLGA 3P95A 2F9BH 1WJLA 4ZHAA 1SQOA 1W2KH 1N7EA 2DC2A 2QF0A 1JRSA 2BDGA 4NIVA 3A84A 1A61H 3H7OA 1INCA 1IQJA 1EB2A 1C5XB 5HMAA 2BX3A 1WF8A 3KNXA 1BFEA 1QY6A 8GCHF 1NRSH 3A82A 1W9OA 2H3MA 2HLCA 3M5OA 1HGTH 2VWMA 4IC6A 2WYGA 4CRBA 4Z0KA 4JK5A 3RXPA 1P2NA 1CHGA 1SC8U 2LELA 2RA3A 2BD4A 4NIXA 2BOKA 3UQOA 1FQ3A 1KXFA 1P0SH 3U8OH 2Z3CA 2V6NA 2FX4A 3D62A 1ESBA 5T3HA 3RXHA 1BTWA 1KLTA 5HF1A 3KF2A 4Z1MD 2F5YA 1AUJA 2ZPQA 3RXTA 2DE8A 5I25A 2OK5A 1E79D 3SHWA 2G2LA 1LPKB 2ALPA 2V35A 2WPHS 3NKKA 4X2VA 1SGQE 3T27A 4TPIZ 2ILNA 4D7FA 3QZQA 2QYIA 4OM9A 4B2CA 1GHAF 2EJYA 1H8IH 2FEQH 1BMLA 2ZO3H 4FUFA 2VIVA 1X5QA 3E6PH 1F5LA 1TNGA 2BYGA 1W0YH 3E3TA 3QDZB 4YOIA 3RC6A 4Y8YA 1Y5BT 1HAYB 1OXGA 4B6FA 2YMSC 3ZZ7A 1W9QA 1ZRBA 1YPHC 3Q00A 1GL0E 1HAXB 5E0JA 1EAWA 4OEPA 2Z17A 1A3EH 2OUAA 5EJ1A 5JBAS 3CENA 1BT7A 1MTNC 2QAAA 1T8MA 1WUNH 1RTKA 5A8XA 2D1JA 3CBYA 5DP8A 2J97A 5DP5A 2VGCC 4AFQA 1V2NT 2KJKA 1DWEH 4ZAEA 2QXHA 3SYJA 4JOPA 1MH0A 1GDUA 2FLRH 3ATLA 1S6LA 1EUFA 1Y59T 1O39A 4JYVH 4WF8A 1AWFH 1HBTH 4YYXA 2YMSD 3M7UA 4JOJA 1NTPA 3KDKA 2ZTZA 2BDYA 2WINI 5HETA 4WMEA 3NRLA 2CV3A 4P0CA 1ZTKA 2I6VA 3ESTA 5KEDA 1NRQH 2OINA 1TP3A 1GI2A 1WTGH 2W6ID 3SNDA 3ZYEA 3CBXA 2GGVB 3RLYH 2UWPA 2JXOA 2Q6FA 3OEED 4DVAU 2EI8A 5C2ZA 1X8SA 1LKAA 2L6OA 3UOUA 3SU3A 1HLTH 1OWJA 1WFVA 1YKTA 2PR3A 1FN6A 3KZDA 1O2JA 1W11U 4RN6A 1IHJA 3GJ9A 3RXQA 3PO1C 1UTJA 4OEOA 4X1SU 1QL9A 1E1RD 1L1NA 2M10A 4YT6H 3LC3A 2H5DA 3T28A 2ZPSA 5HYOA 3S9CA 3GCHB 5FPYA 4OS7A 2H9EH 2ODPA 3WKMA 2XBWA 2A45B 4XBBA 1NC6A 4MNXA 1FXYA 4KFWA 3NZIA 4JZFH 3SU6A 1ZMNA 4DIHH 2SFAA 1W0ZU 2YNBA 4JYTA 3QK1A 1IU2A 1SHYA 1O3CA 1QR3E 1AKSA 2TGPZ 3KHFA 1U3BA 1AI8H 3RC4A 4AB9A 5HGGA 1GJ8B 1KY9A 2G00A 2VU8E 1D3TB 3DJ1A 5LPRA 2FX6A 3SU1A 2FXRA 4AG1A 3SW2B 1UTLM 2RCEA 1FAKH 1O5FH 1FI8A 4ZKOU 4DOQA 3KQEA 3E8LA 3MU5A 1P03A 1BUIA 2CSSA 1SBWA 1A5HA 3UNRA 1O2PA 4MDSA 2LPRA 2WPIS 3SI3H 4JOHA 4RSPA 3QTVH 2QKTA 1A0LA 3QIKA 2XXLA 1O3GA 4G69A 1SB1H 1AO5A 1WCZA 3PRBA 2UUKB 1N6YA 1TABE 5FBEA 2PKSB 3DCLA 3LNYA 3A81A 1GMCF 1GHVH 4LMMA 2KBSA 1C1MA 5HDYA 1TPOA 4DIIH 5IL9A 2FN5A 1SGRE 1Q3OA 2UWLA 2C8ZB 1EQ9A 2JJ2D 3GCNA 4OGXA 5FCRA 1YYY1 1YPGH 4HFPB 1T4VH 2I04A 1GI9B 2HVYB 3MNCA 1SQRA 4O97A 2VIWA 1GMHG 1NY22 2QXJA 2X7ZA 2A1DB 2GP9B 4BANB 2OCSA 2SGPE 2FTMA 1FY5A 4HI3A 4YXWD 2L4TA 2A7HA 3B9FH 2F43B 4LOYH 5EW2H 1S6FA 1OWEA 1P04A 1ZHPA 1KXAA 2HWLB 4NNLA 4ABFA 2PSYA 4JZ1A 2A5IA 2CSJA 5EJZA 2OGPA 1A3BH 1EJMA 1KMHB 1O33A 1GI3A 3AAUA 4MNWA 4AMHA 1HV7A 1DITH 2VPHA 4B75A 3PTBA 3GCTF 3P17H 1O30A 4NG9H 2XC5A 1P06A 1PYTC 1NN6A 4CHAB 4A7IB 1DPOA 2ZU2A 1BIOA 1AVGH 1NRRH 1C5ZB 4FXGH 3TK9A 5EJLA 2G51A 1FIZA 1UEZA 2ZPLA 1YLDA 1SI5H 1G2LA 3BTEE 3DORA 2BVSH 5E1YA 1AZ8A 4O3UA 3VEQB 4GUXA 5HKKD 1ELVA 3TK6A 1XVMA 2B9LA 4FUCA 3QZRA 5E8EH 4ABJA 2AERH 2BD9A 2Z94A 5HFBA 1C9TA 1O5EH 4UE7H 4NNMA 1SGNE 1UTKA 2O8LA 3G01A 3NFLA 3CS7A 1CBWB 1GJ7B 1TGBA 3HGPA 5F8XA 1HPGA 1UCYK 4AGKA 4M9FA 3SJ8A 3SV9A 4TPYA 1P05A 4X8UH 4WMDA 4Q2PA 1PYTD 5EXNA 5JB9S 1G32B 1QTFA 4TWWA 4KGAA 2Q9VA 4IBLH 1H9LB 9ESTA 2GCHF 2GZ9A 2W7SA 3S9BA 3BG4B 4O03A 3PDVA 1ETTH 1JRTA 2KOHA 2IWQA 1UK3A 3KQCA 4U30A 1VCWA 1K21H 3FZZA 1YP9A 3TH4H 5E2PA 2Y7ZA 2AINA 3M7TA 4Q6SA 1O5DH 3SHUA 3K82A 3A8DA 1NTEA 1ZTLA 1K2I1 1UK4A 1D6WA 2ZGCA 3SNAA 1O2HA 1C2IA 3W94A 2ZHDA 2VVCA 2SGQE 1GHBF 1UVTH 2XW9A 1I92A 1MKXH 1TFXA 4Q2KA 3TH2H 1ZMJA 1O35A 1WBGB 3MH7A 4UU5A 3OSYA 2VIOA 2ZTYA 1HXFH 4X2YA 1O2LA 1N99A 1X7AC 2ZGJA 2GMTB 2PP6A 4AC9A 1GMDF 1P3EA 3JXTA 3AXAA 4ZKNU 3GISB 3B23B 2H2ZA 3M3SA 3TITA 2G4TA 1MU8B 1GJBB 1O3IA 2ODYB 2BVXH 4Y76A 3MNBA 4X1QU 2OBOA 3KYFA 4X6PA 1K1PA 3PYHA 5E0GA 3SI4H 3SU5A 1BOQA 3MU1A 4F49A 1TP5A 1EAIA 2HPPH 2WSSD 1NF3C 3KYGA 2K8IA 3RXJA 2IPHA 2A5KA 4NZQA 4ABAA 1KDQA 3GY2A 5JBTA 2EQNA 2SGDE 2F9NA 6LPRA 1C2HA 4SGBE 5A2PA 2H5CA 2B0FA 3SN8A 3VPKA 1XUGA 5GXPA 1E35B 1FY3A 4UONA 3ATMA 4F55A 4BAMB 1E37B 1FUJA 2GZ7A 1QA7A 1GI5A 3LIWA 3WW7A 5DP3A 1F0RA 1CVWH 2CGAA 2EAQA 2STBE 2XNIA 4OS2A 1OPHB 5TCAA 1QNJA 1AMHA 4JYUH 2EEIA 2Q1JA 1UTOA 3PWBA 4RT0A 5PTPA 1T32A 2GV6A 2ZWLH 3M35A 4O06A 1N7TA 1GCTC 1GWAA 3RMNH 2KJDA 1MKWK 3A7TA 1WIFA 3LKWA 4KKDA 1L1GA 1ZLRA 2ZG0H 2ZHQH 3ELAH 1A0JA 2G81E 3M7QA 4IMQA 2QKVA 1LTOA 1QRWA 1NFWA 1DUAA 1E36B 3SU2A 4A1TA 1EKBB 1QZ8A 1GJCB 1SGIB 1E38B 1LHCH 3V7TA 1CSOE 1DM4B 2ZQ2A 3Q3KA 1O3DA 5HFDA 2CS5A 3LJOA 1QB9A 4Q6HA 3A7WA 3UB0A 2PKSC 3KQDA 2OP9A 1DWBH 4H6TA 5ESTE 1O3BA 3MNXA 2A4QA 1QGFA 2BDIA 2XBVA 5EIYA 1OBZA 1A5IA 2J38A 3OX7U 1HCGA 5C67A 4TY7A 3V12A 1O32A 3DSPA 5A8YA 1O2UA 2F83A 2EA3A 2ZP0H 4LK4A 3SUFA 4TT3D 3SV8A 1HAGE 1PQAA 2KPLA 4HTCH 1EB1H 4MLFB 2C8XB 2KV8A 2EEGA 1NFXA 1BRBE 1OKXA 3HPKA 2REYA 2KM0A 1O2SA 1IHTH 1SGFG 2ZU1A 1TMBH 3PLBA 1ZJDA 3N7OA 4WWYA 1M5ZA 1TWXB 1IQGA 1TRYA 1Z1IA 2F9VA 3RL8A 2YOLA 4KP0A 1VJ6A 1RGRA 4NWLA 3GY6A 1XXDA 4AFZA 1YCPK 4AB8A 1V2LT 1J16A 2AGIX 1V2VT 1AE8H 1SGDE 1UFXA 4JOEA 2NU2E 1UTPA 2AMDA 1EOJA 1YBWA 3STJA 1MTNB 1AU8A 2FPZA 4CREA 2WUCA 4GSOA 1K9OE 1TNJA 2BD3A 2FOFA 1QBNA 4ABIA 1GG6C 4CHAC 1KXCA 3DFLA 3PMHB 4O3TA 5DP7A 5G1DA 3FAOA 1X9ZA 5JBBS 1QQUA 2A7JA 4FVDA 4U32A 2C8WB 3NGHA 1UK2A 2Y6TA 1GBBA 2AWXA 1C2LA 3K6YA 3R0FA 1UITA 3K1RA 1MCTA 1EP5A 3UTUH 1FMGA 2FOMB 1QAUA 4UD9H 2H1UA 1TMTH 1V2ST 1Y3UA 1MQ6A 3HKJB 1F5KU 4X6NA 1MTSA 2ZI2H 1C2KA 3CYYA 1C5SA 2Y5GA 1Z8IB 1C1TA 1ZSKA 3GS9A 1MZAA 1F5RA 4DW2U 3M5NA 5GLJA 1HAZB 4XBDA 1KEFA 2D8IA 3B8JA 1THRH 1FC6A 1N6EA 4X6MA 3RXKA 3UNSA 4D76A 3TGJE 1ID5H 3EGGC 4Q3HA 1O2YA 1HB0B 5HFCA 2KFWA 3BG4C 1B8QA 1V62A 5K0HA 2FI4E 1AVWA 1LMWB 1WU1A 1WG6A 1CGHA 4YLUA 3P8GA 1X45A 2G8TA 1GI1A 2FTLE 2PA1A 2YT8A 1DDJA 2VWOA 3R3GB 3ZVGA 3ZVFA 2V1WA 1VGCB 2ZFQH 1F0TA 1ZJKA 4FU8A 1Y3WA 1S0QA 2H2CA 4ZKSU 1G3CA 3T2NA 4WY3A 5DKMA 4YO9A 1Q2WA 1ELFA 1JBUH 3VB7A 3QTOH 4X0WU 5C20A 5G4BA 2VWRA 3BTTE 1VITG 2ZHWH 4MPWA 2P94A 1D5GA 2P3UB 5EU8A 1V2WT 2HNTF 2K20A 5DPAA 2BLOA 1UM7A 3B76A 2Z9GA 3A7VA 2H6MA 2HRVA 2GMTC 2WL7A 3KGPA 4IW4E 4MVNA 2ZDNA 7GCHG 5HEBA 1SLVB 4NIYA 1AFQC 1VJAU 1TOCB 1GJ6A 3C27B 1HRTH 1ANEA 5C5OA 5EYZA 1C5UA 1LHGH 3CH8A 1OS8A 4NSYA 1AGJA 2AGEX 2PLXA 2F4LA 4X6OA 4WMFA 3ZZ4A 4TWYA 2BLQA 3K9XB 1P12E 2KCYA 1L4ZA 4FUGA 2KAIA 3PDZA 4FETA 4K75A 1ZRKA 4TY6A 1IQMA 3L4FD 3OY6U 5H4IB 4MNVA 4MPXA 3ID4A 4JJ0A 2ANKH 1J17T 5A8ZA 5T1VA 1A0HB 2Z9KA 1UCYH 1SLXB 2P95A 3EQ0H 3F9FA 5DSFA 2BD8A 3QLPH 1C2JA 1KTTB 3DIWA 2ZFRH 4IMZA 5E21A 4YM9A 1VJ9U 1Y8TA 1H8HD 1PPBH 1SLUB 1ESTA 2Y5FA 3DA9B 4B1TA 2BB4A 2G4UA 3M3TA 1P09A 2L4SA 2ZCHP 3A87A 1GBCA 3SUGA 4L8NA 3NFKA 4Q2QA 3UR6A 3TH3H 5TCCA 2FWWA 4RT1A 2KCPA 3P8OA 1U6QA 1ORFA 3Q76A 4FLNA 3UPEA 1Y3VA 4HG6A 3W95A 1WTHD 1GBIA 3Q3XA 3SUEA 4AX9H 2JJ1D 5IDKA 4K3JA 3ZZDA 1UVPA 1AE5A 1THPB 2QXIA 2IJD1 4X1RU 3JZ2B 2KG2A 3O5NA 1V2MT 4DURA 4DJZB 1YC0A 4RKJB 3T26A 3ENSB 4XFQA 4Y8ZA 4ZUHA 4ZMAH 1C5YB 1CT0E 1WI2A 1UCYE 2A0QB 5AF9H 2NWNA 3LGUA 1J8AA 2Q6DA 5E6PB 4Y71A 1ELBA 5FHTA 1C2FA 2J4IA 3UWJH 2BY8X 3KN2A 2WZQA 4D9QA 2PKAA 1PQ7A 1DX5M 2DLUA 1W7XH 1MFGA 1EAUA 2QIQA 2TPIZ 2PWXA 3D49H 2CXVA 1QIXB 3MFJA 2HE2A 2ZQ1A 3MU8A 1ZOMA 1O2KA 2EGKA 1YCPM 1LO6A 3UUZA 3ZZ9A 1CGJE 3CBZA 2BZ6H 5CE1A 1ARCA 2IWOA 2GDEH 1WOFA 2KCOA 3N7DA 2VSVA 2VWNA 1F0SA 4YTAA 1MFLA 1PDRA 1CHOF 1TGCA 2NU3E 3BTFE 1TX7A 1GVLA 1MTWA 3GGEA 4BAHB 1GPZA 3E1XB 3ATWA 2JIKA 3LJJA 1DWDH 5DP4A 2ZPMA 2FI5E 3RXCA 1AWHB 3SJ9A 3CNRA 5A09A 3DD2H 5C0TA 2ZHFH 2JETC 3RDZA 1X5RA 1MD7A 1BBRK 2P8OB 1EZXC 2PNTA 1MAXA 1GHWH 3PMBB 5EQSA 1WHDA 2KOJA 4E06H 1QJ6B 1TLDA 3A89A 3M36A 4K1EA 2CF9H 1Q7XA 1V6DA 2FOEA 5A2MH 1Y7NA 1WXRA 3T62A 2QG1A 1O2VA 2QCYA 3F9EA 5AFYH 3MHWU 2ZZUH 5JB8S 1DSUA 3BTDE 3MH6A 1TGTA 2AEIH 4Y0ZE 1TPSA 5F8ZA 1TB6H 2SNVA 1T8LA 1GBJA 3FOAA 4XOJA 1S83A 2R2WU 2EY4C 3SOSA 1P2JA 2M2AA 3MOCA 1VITH 1HAVB 2OPGA 2ULLA 2W6JD 1SGPE 2LOBA 1GDQA 1Q3XA 1O5GH 2ZDVH 4E3BA 1Z8GA 1M9UA 2ZU3A 1S6HA 3FP6E 3BTQE 3GICB 3S9AA 3ZZ5A 3SV6A 3GY5A 3GYLB 2OQUA 1OWDA 1PPHE 3HKIB 2WPKS 4R2ZA 4KTCA 2QC2A 4Q7YA 4B6EA 1TYNA 4WYUA 2OC8A 1FY4A 4XRNA 1V2KT 2ZFTA 3NCVA 2GVFA 1EPTA 1SSXA 1MQ5A 1EASA 2XNDD 5AFZH 4A1VA 6ESTA 5EPYA 1YLCA 2QKUA 5BPEA 2C90B 2G5NA 2A2XH 1T8NA 2VIQA 1GBMA 5E11A 2FMJA 1T2MA 2JKHA 5DK1A 1VGCC 4AN7A 4I32A 2FLBH 2JIZD 3FP7E 4ZKRU 4JZEH 1G3EA 3PWCA 1JXPA 3LGTA 1ZYOA 4INKA 2RRMA 5K7RA 1CA8B 1TQ7B 4P00A 4SGAE 2FS9A 4WVPE 3OU0A 2IWPA 3KQ5A 3URCA 4GLYA 3S7KB 3PV4A 1FPCH 3KIDU 4INLA 2GT8A 4UFFH 5EQQA 2KA9A 3JZ1B 1RD3B 4WH6A 2JH5D 3DUXH 1SGYE 1J15A 4NXQA 1ZGIA 1SR5C 1K28D 1GCTB 4CRFA 1GI8B 3P70B 2ZA5A 1L4DA 4X2XA 1GHXH 2BMGB 4F48B 2I6QA 2PTNA 3W1EA 1RGWA 1ZGVA 2L97A 1TMUH 1COWD 2EGNA 1K1MA 2J98B 1OWIA 4H42U 4ABGA 2L74A 4BAQB 4O9VA 3C1KA 4K72A 1PFXC 3HPMA 1YPJH 3BTME 1S84A 1PPFE 1P11E 4GHTA 1O3JA 1UM1A 2B7DH 1HAPH 2ANYA 1S81A 4K60A 4Y0YE 1WYKA 1BCUH 4I8LA 2GZVA 1GJ4H 3BIUH 2SNWA 5KGOA 1WV7H 4FUEA 5E2OA 3MH5A 2EDZA 1KYNA 4GAWA 4Y7AA 3BTWE 3F1SB 2HE4A 8GCHG 3U98H 2FNEA 2V3HH 4Y10E 1BMFD 1BRCE 2W7UA 1QAVB 1QJ7B 4E35A 1L2EA 3CC0A 1GBLA 1MTUA 1L6OA 1AHTH 1IQHA 3DSOA 4DY7B 1V1TA 3UY9A 2ZEBA 5H3JA 1P57B 3L3TA 3RC5A 5J4SA 1VB7A 2YUYA 4GHNA 3EDXB 1Z8RA 2BDCA 4GPGA 5F67A 1G36A 4UFDH 1RFNA 2IN2A 5F53A 3M37A 4A1XA 3NK8A 3GSLA 3O8RA 1YPEH 1UVSH 4CR9A 1WI4A 2CMYA 4NFEA 1GHAG 4E7RG 5E22A 1DXPA 1KXEA 2VB0A 2AWUA 4NMOA 5IK2D 3OEHD 4AFUA 4HOPA 1LCYA 3ZRTA 1HAOH 2MHOA 1MAYA 2OD3B 1H9IE 4FUJA 2QY0B 1GG6B 2QF3A 3ZVAA 5DP9A 1SQAA 3GY8A 1CO7E 4D7GA 1EOLA 1GBKA 1N1LA 1VZQH 2XCFA 1AFEH 3SJOA 4K6YA 1C5PA 1XUHA 2AWWA 2QN5T 4LZ1H 3I29A 3N7EA 3ZV9A 4BXWA 1MBMA 3SGBE 3PB1E 3T29A 2IPQX 2PGQB 3M5LA 3FY5A 1NRNH 3WY8A 4ASHA 5L2YH 3LOXA 3T5FH 4NZLA 1NFUA 1AUTC 1OWKA 1X6DA 3LT3A 2FM2A 4EDJA 1JIMA 2ZF0H 4GCHF 4WJG2 4ZXYH 3RMMH 3RM0H 4YDPA 1EP6A 1XKBC 2Z7FE 5FPSA 3RXMA 1VCPA 4H6SB 3VQGA 5JDUB 5HM9A 4B74A 2CF8H 2FYQA 2IOTA 3U9AH 1X5NA 1ELCA 4AYYB 1GJ5H 2PZDA 3HPTB 3L33A 3QWCH 1GQ5A 1A5GH 3RU4D 1P9UA 2P8OC 4UFEH 5FL7D 4AOQA 2LNCA 4NXPA 3V0XA 2DAZA 1VAEA 2K1ZA 1Z8JB 3SV7A 4BXSA 2RDEA 4OS6A 4K78A 2VINA 1V2PT 5DG6A 3ZZCA 3BPUA 1JMOH 1UHBA 4NA8A 5JXBA 2OXSA 3O8BA 3ZZ3A 3CS0A 1QL8A 1Z6EA 3TSZA 1UEQA 3KCGH 3RXRA 1KSNA 5DO4H 4MG3A 2SGAA 5FB8C 3BIVH 1TBQH 4AGJA 3H09A 1D3PB 5GCHF 5CHBA 2FOHA 1Q31A 3Q77A 1GJDB 4I8HA 1AFQB 4GVUA 1IQIA 1O3HA 1A4WH 1ZR0A 1NO9H 2ZU4A 1BTPA 2HLDD 1C5TA 5DJ7A 1O31A 1AIXH 1KIGH 1A1RA 4ABBA 3V13A 3UAIC 4D9RA 1CQQA 2ZDMA 4BTIB 2ZNKH 1EAXA 2KAIB 5F03A 4PQWA 1NBMD 3URDA 1G3BA 3E91A 2AFQB 3TK5A 3F6UH 4ZH8A 1O2TA 3F2FA 2VZ5A 1WF7A 4ISLA 2JILA 2Z9LA 1E1QD 2BDAA 4JOFA 1P1DA 1DE7H 1TOMH 5AHGH 4INHA 1LVBA 1RTFB 4XSKU 3VG8A 4U01A 3GDUA 5B6LA 1SFIA 2V3OH 1SKYE 2KYLA 3DT0H 3TGIE 3RXOA 1D4PB 5DGJA 5A0AE 1LVOA 1GMCG 2DLSA 3KQBA 5FX5A 1D6RA 3PRDA 3P92A 1QFKH 1GL1A 3QUMP 1WQVH 1XUFA 3AK5A 1P2KA 3EAJA 1XM1A 3SZEA 2GDDA 3SHCH 3QGLA 2UWOA 3FO8D 2ZCKP 2ZGXH 1LPGB 4Z6AH 7KMEH 2DJTA 4CRCA 4A92A 1SVPA 1BHXF 1RXPA 1FLEE 1J9CH 1RS0A 2QA9E 3GDVA 1GM1A 1H1BA 2CK3D 1EX3A 2FOAA 5LH8A 1O3NA 1EZQA 3OTJE 3HVQC 2SGEE 2ZDKA 1HJ9A 1MBQA 3LPRA 4BAKB 5IYTA 1BTUA 3GY7A 4RKOB 1G30B 2W3IA 3TJUA 1CA0B 4X8TH 5FCKA 3S0NA 4OGYA 3GCTG 1K0HA 1DS2E 1GQ4A 1FX0B 2O2TA 3BTKE 4B76A 1W12U 4P2AB 1GBDA 5HEDA 3GY3A 1C1PA 4Q63A 2EXGA 5HFEA 2PGBB 2C93B 4NMSA 2QV1A 5GWZA 1UJDA 2QT5A 3UOPA 1C5WB 1BBRE 1O3MA 4YLQH 1BTHH 1B5GH 2VH6A 1HDTH 1C2EA 3ATIA 2OCVB 3TU7H 3RP2A 1O3EA 5EODA 2GCTB 1F7ZA 2J92A 3E90B 2J95A 5HEYA 1S85A 3ITIA 2VVVA 1CT2E 4K69A 1OSSA 6CHAB 6GCHF 2HNTC 1C1WH 3EA8A 2OQ5A 1A7SA 3M61U 4ZXXH 3ZV8A 4YOGA 3OTPA 1IHSH 3NXPA 1ETRH 4FUDA 1TRNA 2JETB 3U1IB 3GOVB 2C4FH 1WSSH 4CBNA 3T25A 1NESE 3TSVA 1BDAA 5HIZA 4CBOA 1HAIH 1O5BB 4MPUA 1Z86A 4I8KA 2GCHG 2KZ4A 3S7HB 4FU7A 1YWUA 1H8ED 2GT7A 1K1IA 1DICA 2IJOB 3TPIZ 2KL1A 3RXVA 2OQSA 4F8KA 3BTHE 4J1YA 2K1QA 3VB3A 3UIRA 2P3TB 1RJXB 4LXBH 4NMTA 4NIWA 4YESB 4FUHA 1DXWA 4ISNA 3BEFB 3IITA 1CE5A 2P16A 4XDEA 2Q6GA 4BTTB 2GJGA 2THFB 2QF4A 2OC1A 1MC7A 1MTVA 1C5MD 2PV9B 4XE4A 2FCFA 1GJAB 1SL3A 2EGOA 2ZFSA 1O2NA 1QBVH 1YPMH 3MMGA 4R0IA 1BB0B 2D92A 1GHBG 3H7TA 4ACAA 1ZOKA 2H3LA 2I0IA 3U8RH
chains in the Genus database with same CATH topology
2BY5X 1ANBA 1DANH 2JWEA 2UZCA 2W7RA 1O2XA 2W5EA 3P8FA 1VCQA 2UUFB 2Y5HA 4K8YA 1VA8A 1EPTB 1GMDG 4CRDA 1BRUP 1K32A 2ZGBH 1NT1A 1G37A 1U38A 2OSGA 5ETXA 1UF1A 3RMOH 3PS4A 4B2AA 1HJ8A 3SJIA 2FOBA 3ID3A 1TGNA 5GIBA 4DT7B 3BV9B 2M5TA 1IQKA 1C4Y2 2Z9IA 2EI7A 2OBQA 7LPRA 3E0PB 3ZVEA 4IS5A 1O5CB 1C9PA 2P3FH 2J34A 1AKSB 1HUTH 1WFGA 2LA8A 2PUQH 3F9HA 1YBOA 2R9PA 5DP6A 4Y79A 2VWLA 3KZEA 2ZECA 1T4UH 1OX1A 2O9QA 1NROH 5A0CA 1O3PB 1IQFA 1Y3XA 3NCLA 3MNSA 1O5AB 1O38A 2Z9JA 1GGDB 1GBFA 4NGAH 1LDTT 3UREA 4Q7ZA 5C1UA 2BY7X 1GJ9B 4KFVA 2LC6A 1YPHE 3BEUA 3A88A 1GI4A 1BZXE 2F0AA 3LNXA 4R8TB 2Y81A 1SOZA 1IQEA 2UUYA 1UEWA 4JK6A 3DFJA 3TVJB 3SQEE 4AG2A 1FDPA 2AIPA 2VH0A 3BEIB 1WAYB 1P1EA 4CRAA 2PUXB 1FC9A 1MCVA 5B6OA 1S5SA 3PV5A 2ZFPH 1BMNH 3IWMA 1BE9A 1UJUA 1VR1H 2W4FA 1TX6A 4DGJA 4ABDA 1LVYA 1YPLH 2KPKA 3BF6H 2TRMA 3NWUA 3K65B 1TBZH 3UNQA 1GBTA 1SQTA 1QURH 3RL7A 1SHHB 3RXEA 4A6LA 1O3AA 5BRRE 1B0FA 3FANA 1W9EA 1FV9A 3QJNA 1AN1E 5LPEA 3P6ZB 1W3CA 1GHYH 2ZKSA 4BAOB 3VFEA 4U2WA 3TMHA 5EQRA 4UDWH 2VIDA 3ZZ6A 1UTMA 4AORA 2E7KA 3Q3YA 1UMAH 4WXIA 2LC7A 2FP7B 3DJAA 4HOPB 3SO3A 3TJOA 1G3DA 1UO6A 2A32A 2KAWA 1V2TT 2Q3GA 1QRZA 2FE5A 4FGMA 1F92A 2JREA 3O8DA 1O3FA 1P9SA 1BJVA 1TA6A 1O2OA 1P2OA 2A7CA 2F9UA 2IWNA 4JJ3A 1CA0C 4LZ4B 1CT4E 1B7XB 4NXRA 4I8JA 2UUJB 3PROA 3SOEA 1YGCH 2ANWA 2FYRA 3OYPA 1ETSH 5JPMH 4XBCA 2TIOA 1AB9B 2XC4A 2AS9A 3SV2H 3VGCB 2AYWA 1C1NA 3KEEA 1FAXA 3SQHE 2FESH 1H9HE 3NPSA 2J2UA 1AD8H 2A2QH 1UEPA 2FDAA 2GCTC 2QGRA 2BQ7B 5GNDA 1P10A 3GY4A 1BTZA 1QA0A 3QX5H 3SU0A 1O3LA 2PW8H 2M0TA 5SGAE 1QRXA 4Q7XA 1P2MA 2R2MB 1OYQA 2FI3E 3PMAB 6CHAC 1IQLA 3P8NA 4ISHH 1UTNA 3A7XA 4BOHA 1OOKB 1GMHF 1JIRA 3RXGA 2OTVA 4H11A 1TNHA 3SNCA 1BHXB 4E34A 1C5LH 3MU0A 2AIQA 3M3VA 1V5QA 3A83A 1V2UT 1B0EA 1U39A 4NCYA 5EZ0A 1PPZA 2DB5A 1UHBB 2Z6BD 4AFSA 5GPIB 1TE0A 2FIRH 1ELGA 2EV8A 1DOJA 5CHAB 2EI6A 3I4WA 2O8MA 4OS4A 7ESTE 3RMLH 3KL6A 1DFPA 1C1OA 1BTXA 5L30H 2G5VA 1MKWH 5AVDA 1OBYA 1OWHA 3AW0A 1IQNA 2BXTH 5I7ZA 1ABJH 1C1RA 3OY5U 3R68A 3TGKE 2BD5A 4B73A 1ZPZA 2WPLS 3ZVDA 4N6XA 2BD7A 3ZZAA 2MX6A 1W7GH 2NU0E 4JZIA 2AH4X 3RM2H<