3GDVA

Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yqf peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
316
structure length
295
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords DegS protease
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 295
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gdvA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gdvA01
1LHFH 1SL3A 3GY4A 1S85A 1GJ6A 1K1IA 3MOCA 2O8LA 1O2ZA 4MPAA 1WAYB 1BIOA 3U69H 1DY9A 1ZPBA 1GBMA 1OBYA 3UNSA 1B8QA 4YM9A 1RY4A 2VIWA 4I8GA 3SOSA 1QBNA 3TJUA 4Q2QA 5K7RA 2W5EA 1HJAB 4HI3A 3PROA 3MMGA 1ABJH 3VFEA 1O2UA 5DP5A 1QB1A 1DFPA 3SV9A 2JWEA 4JOJA 1JIMA 1NFYA 3RXGA 4DOQA 2SNWA 3QGNB 6CHAC 3UQVA 2FYRA 4H6TA 1GI6A 2FLBH 4I8HA 2ZCLP 4AFUA 5C20A 4IC6A 1SB1H 1NU7B 1PYTC 1YGCH 1LMWB 2A2XH 2BD2A 1K1PA 3SHCH 3SORA 2ALPA 2EJYA 1P9SA 4NFFA 4DIHH 2XC5A 1X7AC 1S0QA 1WQSA 1EP5A 1O2MA 2MX6A 3CBXA 1TBQH 2H3MA 1MTWA 1I92A 2EHRA 3SJ9A 2Q3GA 1A46H 1HAOH 1NESE 3JZ2B 4I8JA 1HAPH 2M5TA 1VCPA 1YPLH 1W13U 4LXBH 3BG4C 2YOLA 4SGBE 2Z9KA 1AHTH 1GDQA 1SHYA 2LPRA 2PSXA 1M9UA 4I8LA 3I1EA 2HPPH 3VXFH 1AVWA 4MPVA 1GG6B 4Q7ZA 5GJ4B 1Z71A 4WYUA 1ELAA 3FVFB 3M5MA 2AS9A 1V2VT 1Z87A 2OBQA 2VB0A 1BTUA 1CE5A 3SUZA 1C2JA 2D90A 1J17T 1FLEE 1GI4A 1O3NA 3A81A 4E7RG 1BTZA 1GBLA 1RGQA 1T8OA 3SGBE 1LO6A 1NS3A 1LHGH 1MTNC 2C8ZB 1S5SA 4ZROA 1P2IA 3PYHA 2X7ZA 2BHGA 3BTDE 4HFPB 3RP2A 2RDLA 2QG1A 1BA8B 3SU1A 2DJTA 2ZF0H 1GCTC 1XZ9A 3HGPA 2WUBA 3A8AA 3M7QA 2ZU1A 3T25A 3VB3A 3QJMA 3EA7A 4AFZA 2OS6A 2F9UA 3K65B 4MNXA 5LPEA 3QLPH 3EAJA 4B73A 1UVUH 2CF8H 1OOKB 5F67A 2TGPZ 4IW4E 3SQHE 1GJ9B 1HBTH 1ID5H 2QCYA 1TIOA 2XW9A 2RG3A 1LVYA 2C8WB 3URDA 2EC9H 3UY9A 1SFQB 1JWTA 1A7SA 4YOJA 2HGAA 3BSQA 2VPHA 2Z7FE 3BV9B 3RM2H 4X8SH 4LMMA 1KXAA 2HPQH 4Q6HA 1O3EA 2R0KA 4OS2A 2Q6GA 1O3BA 3W95A 4XDEA 1TYNA 3BIUH 4A1XA 4J2YB 2Z9IA 3MU1A 4Y10E 3QE1A 4K5ZA 3CS0A 3BEFB 1O2RA 5DG6A 1FIZA 5F8TA 3Q77A 4UD9H 4RI0A 4K72A 1EAWA 2BQ6B 2B9LA 4K75A 4RKOB 1J16A 1HAVB 5I46H 1D3PB 4H6SB 3GDVA 2O8TA 4LZ1H 1WYKA 3R69A 2I04A 2PZDA 1HAZB 3ODDA 3MHWU 4GCHF 2RCZA 4TY6A 2OD3B 4JZ1A 4FUCA 1C4U2 1O2LA 1P10A 2ZDNA 4FUJA 4BTIB 5HFBA 1PPBH 1IQNA 2SFAA 4Y76A 3EA8A 1ZSKA 1DXPA 1UJVA 2ZHEH 1AD8H 4NMRA 2IOTA 3BG4B 2GZVA 3GDUA 1K32A 1V2PT 1ZPCA 1UMAH 4ZUHA 3ZVAA 4RN6A 2DM8A 2UWLA 1C5TA 2FE5A 3MH4A 1L0ZA 3L33A 1BBRK 3RU4E 2ZFFH 1P8VC 5TCAA 1DSTA 2VU8E 3I29A 1ELFA 9LPRA 5CHAB 2A0QB 2P3TB 1MMJN 1TBZH 4WH6A 4YLQH 1MZAA 1O0DH 1TNKA 1AWFH 3MO6A 1GHAG 3F9HA 1ZR0A 2C8XB 1H9LB 3I77A 1MTNB 2WPHS 3EGGC 5J4QA 5EU8A 3BEUA 1ZHMA 4ISIH 5ESBA 1Y5AT 2P59A 2XRCA 4NZQA 1MBQA 1GCTB 2Z9LA 1OBXA 2ANYA 3Q3KA 1V2TT 4NZLA 4JYVH 1FXYA 1LKBA 1O38A 3FFGA 3SOEA 3E91A 3UNQA 1AGJA 1NTEA 1K1NA 2ZPQA 4K3JA 2KA9A 1QBOA 3VGCC 2IWPA 1GHYH 5LPRA 3SV7A 4ZKSU 5GNDA 1XUKA 2O8WA 3RU4D 2BYAX 4OS4A 1O37A 1NRNH 2FI3E 2ALVA 5GCHF 5IDKA 1C5YB 3A8CA 3WKMA 1Q3XA 3GYMA 1GMHF 3TLOA 1YPJH 3UNRA 5DP4A 4KKDA 4HZHA 5CMXH 1GI2A 3QX5H 1QJ1B 1GJ5H 3NWUA 2BVRH 4Y11E 2DB5A 1FV9A 2Z9GA 2STBE 5GCHG 1SOZA 3WKLA 3MH7A 1O5EH 3SHWA 1FUJA 2B7DH 4K60A 2JOAA 1ANCA 2ZI2H 2A5KA 3NKKA 1TNIA 3IWMA 3BTFE 1GBDA 1Y5UT 3GY3A 1ZOMA 2BZAA 3PV2A 3GCHC 2P95A 3P17H 2AMDA 2JH5D 3LONA 1GL1A 3RXPA 3U9AH 2TPIZ 4CRCA 1BCUH 1WFVA 4CHAC 1LQDB 1SHHB 1D3QB 1IHJA 1EAUA 3S69A 3B23B 3FY5A 1NROH 1DPOA 3C1KA 2PGQB 4IN1A 1HNEE 1PJPA 1UEQA 3S9BA 3SU6A 3V3MA 1L1JA 2SGFE 1D5GA 2GGVB 3RMMH 3E8LA 2ZNKH 1LVOA 1AZ8A 4AN7A 2ZEBA 2KJDA 4JZIA 1P2NA 1WOFA 1O2QA 3M3VA 2KPKA 1UVOA 4Z6AH 1W8BH 1QAVA 2AERH 1GI8B 2G5VA 5FBIA 2GD4B 4NMOA 2L97A 3H7TA 2ZIQH 5L6NH 1LPKB 3VQGA 2FIRH 5FCKA 1U37A 1ETRH 3KHVA 1RFNA 3HPKA 4R2ZA 5A8YA 1EOJA 3LGTA 4WYTA 1E38B 1Y3XA 2ZTYA 2MHOA 1JOUB 1KXFA 1KLTA 1PPFE 2P93A 1WTGH 1KIGH 3VB4A 3SGQE 1EASA 4AG2A 2GP9B 5HF1A 2A7CA 5FPTA 2THFB 1LQEA 5EPNA 3SNEA 2ZPRA 1FI8A 3HGNA 2W4FA 4X6PA 5BRRE 3M61U 5E0JA 5EQRA 5EXMA 1QHRB 4KFVA 1IQIA 1SGYE 4FUGA 3RL8A 1V5QA 5A8XA 3UIRA 3TJOA 1KSNA 2R3UA 2ZU2A 1UJ1A 3UPEA 1MD8A 3SNDA 4NWLA 1BMNH 3TGIE 2A45B 3STIA 1BJUA 3ZV9A 2FLRH 1TRNA 3MU5A 5C67A 4FUDA 1TLDA 3NFLA 1P3CA 2V90A 1H8DH 1SLXB 1DXWA 1KLIH 3RXUA 4PQWA 2ANMH 2QAAA 5T6FA 3ZVGA 4Q7XA 1TQ3A 2ODYB 2LC7A 1QA0A 2A2QH 1HDTH 1O2NA 1AE8H 1UVSH 1K2I1 1MFLA 3GCTF 5JBCS 5FXLA 3EDXB 3FZDA 3L6PA 3PLKA 2A4RA 5G1EA 4AB9A 4DG4A 1GBTA 3KIDU 4JMYA 1YPGH 4OS1A 2RA0A 1V2UT 1GQ4A 2AIPA 1P2KA 1KTTB 1OP8A 4X8VH 2SGEE 1NC6A 1P11E 1SGIB 1EOLA 1UEZA 3LC3A 4KTCA 1BZXE 4UONA 7GCHG 3OU0A 1YYY1 3GCHB 2YUYA 4ESTE 1AKSB 3FP7E 1KXEA 2WINI 2XTTB 4ISOA 2V3OH 1C2DA 2VWLA 4NIVA 1WI4A 1C1WH 3VB6A 2EEGA 1GBHA 1TFXA 5E11A 1DY8A 2OBOA 1O3MA 2F0AA 1TX8A 3SJOA 3ZVFA 2PKSC 1HAHH 2OCSA 1W7GH 1SGQE 4ABIA 2FZZA 1WBGB 1O3CA 1EP6A 1BUIA 1V2JT 1ARCA 2A7HA 1MFGA 2M0UA 1NRQH 4BAOB 7ESTE 1UCYE 1C5LH 3P6ZB 4B74A 5E0HA 1YBWA 1FJSA 3F9FA 4B2AA 1C1PA 3ATWA 2ZHDA 1V2NT 2QYIA 1K21H 2PDZA 3QZRA 2EXGA 1SC8U 2ZQ2A 1A61H 3E0PB 3ZZCA 3R68A 1UTJA 1IOEA 1BTPA 1NU9A 1SGPE 1MC7A 4ZHLU 1AQ7A 3UWJH 1AB9B 1IAUA 5CE1A 4K1SA 3H5CB 1ESAA 3TH4H 2XC4A 3KL6A 2EI8A 4Y8YA 4WY3A 2PSYA 1QY6A 1MZDA 1XKBC 3TJNA 1B5GH 3SZNA 2A4QA 2BY7X 4JOFA 4NXPA 1P09A 4JZDH 1NRPH 3TGJE 1O3KA 1GI9B 2P8OB 4DJZB 5GPIB 1DE7H 1P0SH 1SGTA 2W7RA 3O8RA 2WPMS 4HGCA 2ZDKA 3ENSB 3ID4A 1QIXB 2FTLE 2O2TA 1Z8GA 2ULLA 3A89A 1C1OA 2KAIA 3Q3XA 1GPZA 1OWDA 5EPYA 1QCPA 1XUGA 2FS9A 1DX5M 4OEOA 1LHDH 1TNGA 2L4SA 1VJAU 2K1ZA 2ZCHP 1G3EA 1V2WT 3RMNH 2H3LA 5HDYA 2SGQE 1PPEE 2KQFA 1W2KH 2CMYA 1D6WA 2WYGA 1NT1A 1FIWA 5HEDA 4WWYA 1U3BA 3QJNA 2QXGA 1S81A 1ZHRA 1E0FD 1V6DA 3TGKE 3EE0B 5EYZA 4WMFA 2Z9JA 1UJUA 2OGPA 1C2LA 1AU8A 1GI7B 4XHVA 1EB2A 5G4BA 1PFXC 3CYYA 2KRGA 2CF9H 5FX6A 3ZZ9A 2J34A 4AOQA 2HE4A 2J94A 3CP7A 3MNCA 1CBWC 2I1NA 2H9EH 1UFXA 3VXEH 3MU4A 2GV6A 2PLXA 1O3FA 4ABFA 1GJCB 4YTAA 4L8NA 2PW8H 1GJ4H 1GWAA 1GBEA 2G81E 4D76A 4JOPA 2P16A 2ZFTA 1P12E 2BXUH 1JRSA 1GGDC 1TOCB 2L4TA 2QXHA 3RDZA 4D9QA 1W12U 2BDAA 5B6LA 5AF9H 1HXFH 1BRUP 3SUEA 1TBRH 5DGJA 2J9NA 1GHVH 1FY5A 4X8TH 5GIBA 1OXGA 1DVAH 5EZ0A 1SBWA 5ESTE 1BE9A 3RLWH 1HV7A 4RKJB 1BMAA 1MU8B 3QZQA 4R8TB 1EAIA 3ZZAA 1JXPA 5EXNA 2ANWA 4NA8A 3ZZ6A 4AYVB 1FY1A 1GHXH 3RMLH 2FNEA 4K1EA 5AFZH 3ZVCA 1MU6B 5DP9A 2UWPA 4X0WU 1CA0C 1FY3A 2TRMA 1Q3PA 4U01A 2EEKA 3QUMP 4AYYB 2A1DB 2Y6TA 1DWCH 2ODQA 3F68H 3PMJA 2W3KA 1NY22 3K82A 2KBSA 2J2UA 5F3XA 2BM2A 2Z6BD 1L2EA 3FP8E 2PA1A 1IHSH 1K22H 1PQ8A 2FX6A 4OS5A 5E1YA 4F4OC 4U32A 2FOFA 1QRWA 3VEQB 1W9OA 1C2FA 2QBWA 4FUEA 1Z1IA 2GCHG 3MFJA 1RS0A 1GJBB 1ETSH 5DTHA 4WVPE 3P8FA 2NU1E 1A3EH 1S82A 3TSVA 4X1QU 1ESBA 4WMEA 4O03A 2I6QA 2GVFA 3NCLA 3IG6B 1VGCC 5F8XA 4TPYA 5A09A 3F1SB 3T5FH 1IHTH 4BNRA 3A7WA 1BQYA 1T31A 3I78A 1V62A 1HJ8A 1VITG 1O33A 1S6HA 6GCHG 5HEBA 2GKVE 1CO7E 2BY9X 3SFJA 1ZLRA 1ZGVA 1QJ7B 2OC7A 4K76A 5K0HA 3GY2A 1PYTD 3ID2A 2XWBI 4U2WA 2ZECA 3HKIB 3R0FA 2QGRA 1EZXC 3ATIA 1QGFA 3TU7H 1CBWB 1P01A 2PKAA 1NFWA 3SV6A 4NNMA 3BIVH 1XUFA 1UTOA 1FC7A 1UVTH 1E34B 2O9QA 4JK5A 1BOQA 5B6OA 3A88A 5GLJA 4P2AB 1SLVB 2ILNA 2TIOA 1S6FA 2OXSA 2QF3A 4X1SU 1C2KA 2G52A 5HFDA 4JOKA 1QURH 1TWXB 1FY8E 1EUFA 2C90B 2FODA 2VIPA 3Q3YA 4INKA 1T7CA 1ANDA 3R0HA 2GMTC 3RUOA 2YTWA 3EGHC 1GBFA 1XXFA 4GVCA 1XMNB 2GT7A 1UITA 3E17A 3TJVA 5FPYA 3K1RA 1DWEH 1UK2A 3ATKA 1C2GA 2R2MB 3M36A 4Q2KA 4X6MA 2R3YA 1P04A 1CA0B 5DPAA 2IWOA 1KTSB 3SI4H 2REYA 2BD5A 1VJ9U 3LJJA 1YCPH 1EZUC 4B71A 4WJG2 1O3IA 1YF4A 1C1QA 3RXAA 2QXJA 1MKWK 2H2ZA 1AVXA 1QQ4A 3FZZA 1WV7H 2VWNA 1WH1A 1ANBA 1GDNA 2KOJA 1EB1H 1OYTH 1P05A 2FOBA 4ZH8A 1CT2E 1K1LA 2VH0A 9ESTA 4KP0A 1A0LA 2BDYA 1F0UA 2PTCE 1UHPA 4KFWA 2A32A 4NXRA 1MTSA 2V35A 2WPKS 3LGYA 3BN9A 5JPMH 2GCTC 3BF6H 2OTVA 1SGDE 2VIOA 2XCFA 5E22A 1G30B 1WIFA 3U8TH 3MH6A 2NU0E 1TPSA 3RXTA 1VGCB 1CHOF 3KGPA 2YNAA 5DJ7A 3FAOA 4FXGH 2OINA 4A5TS 1SGCA 1O2GH 1EATA 3O8BA 2M10A 1C5WB 2LA8A 2ZKSA 3GY7A 3U98H 2ZO3H 1GMDF 4AGJA 1S0RA 1P03A 4Q7YA 5HETA 5SGAE 1BTWA 3PB1E 1GBKA 4A6LA 3MI4A 1VAEA 1JMOH 1MTUA 2CS5A 2VWMA 4JL7A 5DKMA 1TGTA 1OYQA 1S83A 5HFEA 4ZAEA 3I4WA 1YLCA 1ZTKA 1C1NA 3W94A 2KPLA 1SQAA 3OY6U 3KF2A 1FC9A 1HXEH 3SU0A 1O3DA 2HNTC 2ZFQH 5BPEA 2C3SA 2Z94A 1H8IH 2OPGA 3PV5A 3BTTE 1FPHH 2WPJS 2FI5E 3MO9A 2LOBA 1ZSLA 1IQMA 5LPFA 3LGWA 1MAYA 5JYIA 1EKBB 3MWIU 1C5NH 1TB6H 1UTLM 3QK1A 5EXLA 3O8CA 3ATMA 1SMFE 3UR6A 2F9PA 4MVNA 2GZ8A 1DLKB 1LDTT 1F92A 1P1DA 2HGTH 6CHAB 3LT3A 2DAZA 2Z17A 1HFDA 2G2LA 2BOHB 2GMTB 1C5QA 1UVPA 1W9QA 1FMGA 3HPTB 2VIVA 4E7NA 4FUIA 2D92A 5EW2H 3GY6A 1QRZA 1Q31A 5FPSA 3KHFA 4Q3HA 1GHBF 1C1MA 3TMHA 3NXPA 2GT8A 4KTSA 1THRH 2CSSA 2ZHQH 3MU8A 1OSSA 3V12A 1O2VA 5C1XA 2WPIS 1ZJDA 1SGRE 3OTPA 3TK9A 2C8YB 4NMQA 6ESTA 1P2QA 4WMDA 4B76A 2TGAA 1G36A 1WG6A 1TMTH 1MKXH 1JBUH 1O2JA 4XE4A 4YT6H 4GCHG 1YC0A 1YKTA 1Z8IB 1ZTJA 2BDCA 3M5LA 4SGAE 1HPGA 1N6YA 1GM1A 1UJDA 4F8KA 1O5CB 4Y8ZA 2BDGA 1QTFA 1QBVH 2R9PA 2VSPA 3U1JB 3QDZB 3SNAA 3M7UA 4YO9A 2DE8A 1O5FH 4AZ2B 4NMVA 2RA3A 2ZHFH 3B9FH 1Z6EA 2OMJA 1LHCH 1W9EA 8KME2 3KQDA 3M7TA 1TX7A 2GCTB 1OPHB 3ZZDA 3DHKH 1O2PA 1SSXA 1ZRKA 1NTPA 5A0AE 1WUNH 1E37B 3RXLA 1ZUBA 2K1QA 2PV9B 2F83A 4X2XA 1F5LA 4I32A 1DWBH 5E8EH 1CVWH 2EGOA 1O3OA 3OY5U 3QIKA 1ELVA 5L2YH 5A0BA 1Y5BT 4BAHB 2KJPA 2PHBA 2SNVA 3V13A 1RTKA 3LH1A 2BVSH 3VB5A 3LGUA 1O3JA 1A2CH 1GVZA 2QIQA 4UFEH 5LGOA 1IQLA 4TY7A 4O9VA 1Y7NA 4BANB 1IU0A 1V2QT 4D7FA 1O3LA 2ZGJA 1G9OA 4CH8B 3HK3B 4OGXA 2H6MA 3KQBA 1CT0E 2CXVA 2FXRA 3D65E 1EPTC 2VIQA 1N6DA 2NWNA 1UHBB 1C2EA 1C5PA 4AG1A 4Y7BA 5GXPA 4LK4A 1RIWC 2QV1A 2PUXB 3RXVA 2GX4A 1THSH 1GMHG 3DUXH 1P57B 2KV8A 2GV7A 4NXQA 1TNJA 1T8NA 1QJ6B 2TGDA 2ZTZA 2BXTH 1BTYA 4UDWH 3DORA 2G51A 2UUYA 4MPXA 3AASA 3TH2H 1UO6A 2XYAA 1O30A 4E34A 2BB4A 3ID1A 1YPHC 2HLCA 4X6OA 1V5LA 1HJ9A 1CT4E 4DURA 1O5DH 4CRDA 1U38A 2GDEH 2EV8A 4NGAH 1C2MA 1O2SA 2KG2A 3PTNA 2A4OA 2R4HA 1GBJA 2EA3A 1F2SE 1HIAB 4JOEA 2ZFRH 4IBLH 2OQSA 1HGTH 3SUDA 4NG9H 2ZPMA 4XBBA 1CQQA 1H4WA 3K50A 3M37A 3O46A 1OWKA 1E35B 1AFEH 4Z33A 1TQ7B 3DIWA 1U6QA 3QTVH 1BMLA 3VPKA 4X8UH 2J4IA 4FUFA 2A4GA 4TWWA 1YPEH 2JETC 2F3CE 1AI8H 1MCVA 4NMTA 1TGCA 1C5UA 3MU0A 2G5NA 2VINA 4B75A 3A83A 2FPZA 2D8IA 1TA6A 2EEHA 5JB9S 4ABHA 1UEPA 1G3CA 5DP6A 1S84A 1SOTA 2BD9A 4Q2NA 1B0FA 2G5MB 1WHDA 2EEIA 1DWDH 4AGKA 1C5ZB 1TGSZ 1XUHA 2QN5T 3F6UH 1ANEA 1PQ7A 2EDVA 7LPRA 3L3TA 3SNCA 3VGCB 1BHXB 2BYGA 4JYTA 1GBAA 1SLUB 1QFKH 1MQ5A 1OWHA 3GYLB 1V2KT 4WH8A 4GLYA 1Z8RA 2I6SA 3O5NA 5HF4A 4I8KA 2LC6A 1UTQA 4YLUA 2FOGA 3SW2B 1PPCE 1TMUH 1EPTB 1GHWH 1QR3E 2STAE 2A7JA 3L4FD 1ABIH 3ZZ5A 1Z6JH 1RIWB 1C9PA 4YDPA 4ABAA 1UCYK 5A8ZA 1RZXA 1XXDA 3ZYDA 1ORFA 2VJ1A 2AYWA 3I18A 2VNTA 2AINA 1TPOA 3GCTG 4A1TA 5L30H 1NRRH 3OX7U 1F5RA 1G3DA 1ELTA 2I6VA 2F9BH 4NNLA 6LPRA 2BTCE 3EA9A 4KELA 4BTTB 3LDXH 8GCHF 2ZGXH 4CHAB 2RCEA 1KXCA 2BOKA 1BBRH 1ZJKA 1AUTC 4IS5A 4Z0KA 2P3UB 1IQFA 1BITA 5DP7A 5AFYH 2BY5X 1TPAE 2CHAC 1V2OT 3TPIZ 8ESTE 1AZZA 1HAVA 5JDUB 1ARBA 2ASUB 3KCGH 2OZFA 3MNSA 2IWQA 1O34A 2NU4E 2ODPA 1FQ3A 2B5TB 3ID3A 3NPSA 4WXVA 2YT7A 1ZMJA 4JYUH 3PDVA 2ZPSA 1M5ZA 2EGKA 5HXFA 1A0JA 1W0YH 3BTKE 5C3NA 3DJ1A 3N7OA 2H5CA 2FOCA 4NFEA 3P8NA 4K1TA 3T26A 3K6ZA 3GY5A 1O2IA 1V3XA 1L1GA 3CBZA 3O8DA 3M35A 3M5OA 3LIWA 5HJ1A 1EQ9A 3GSLA 1VCQA 1N6XA 4IGDA 1AO5A 4OS6A 3D62A 3QO6A 4H11A 1H9HE 2V6NA 1EZSC 1EZQA 2BD3A 2JH6D 2FOAA 5H4IB 2EDPA 3RXCA 1FC6A 5TCCA 2VVVA 1H9IE 1MUEB 1HYLA 2H5DA 3ZZ3A 4MQAA 3SQEE 3M5NA 1WI2A 1QL9A 2KL1A 3LNYA 2Y5FA 4PROA 4ABGA 1JIRA 3GGEA 4FU7A 5ABWA 5E2OA 2IPHA 3AW1A 1WF8A 3A82A 3JXTA 3KEEA 4BAMB 1Z7KA 3ZRTA 2AWUA 3T2NA 5I7ZA 1LTOA 3A87A 1G32B 4ABJA 3AXAA 2O8MA 2GTBA 1ZPZA 3SV8A 3SJKA 5C2ZA 4MDSA 2UWOA 3A7TA 3RC4A 3EYDA 2K20A 3B76A 1TMBH 2ZU4A 5EODA 2FESH 3SHAH 1O3AA 1L1NA 5HFFA 2Y7ZA 4GVUA 2FYQA 2HOBA 1HAGE 4A7IB 4B2BA 1FONA 1OWJA 2FOEA 2XBXA 3PO1C 2ENOA 2D26C 1O31A 1ELCA 1DT2A 3URCA 4D9RA 3UWIA 3S9AA 3MH5A 1K1OA 3RXBA 5C1YA 1TRMA 2WV4A 3F9GA 2VRFA 1RTFB 1P2OA 2C93B 3QN7A 4INHA 4QT8C 1EAXA 4KGAA 1GBIA 4LZ4B 2FMJA 1DLEA 2OC0A 3ZVBA 5A2MH 1TONA 1Y8TA 4X1NU 3RM0H 3A7XA 1QA7A 3SNBA 3ZZ7A 1LPGB 4NCYA 4TYDA 1DITH 4CRFA 1C2IA 1N8OC 2CV3A 2J38A 2PFEA 1AFQC 5EOKA 4WXIA 2J92A 1QAUA 1GMCF 2HVXA 2XNIA 1VZQH 1F7ZA 1VB7A 1X5NA 2YUBA 3A7VA 3JZ1B 4JK6A 4RSPA 1OWEA 1V2ST 2R0LA 2VVUA 4IMQA 2CSJA 2A5AA 1Y3VA 2PKSB 2QC2A 5I25A 5LH8A 2F5YA 3D23A 1RXPA 1ZZZA 3HK6B 1Y3UA 3EGKH 2AWWA 1HJAC 2DC2A 3RL7A 1GBBA 2Z3EA 5J4SA 5JBAS 3IITA 4ABBA 5HM9A 1ELGA 2IWNA 3BG8A 1PQAA 3A86A 3LJOA 4X2VA 2Q1JA 3VQFA 1O5AB 1LVBA 1PQ5A 2GDDA 2BY6X 2ZA5A 3TITA 2HNTF 1Q2WA 4GHNA 1LVMA 2EEJA 3CENA 1DUAA 3DD2H 3QWCH 1BDAA 1O35A 1N6FA 5L2ZH 1BT7A 3SO3A 1O5BB 1SLWB 4NIWA 3HPMA 4CR5A 4E3BA 4GUXA 1OS8A 4ISLA 1O5GH 2WV5A 4YYXA 3E1XB 2YNBA 4IN2A 3RMOH 2IJOB 2Y81A 1NN6A 1P2JA 4E05H 2KOMA 3QTOH 1YBOA 4B2CA 1YLDA 3BTWE 1G2MA 1P2MA 2ZZUH 5T3HA 2O8UA 2VVCA 1GCDA 1AE5A 2OC8A 3RC5A 4GHQA 1ZHPA 1QQUA 3P8GA 3PDZA 2BQ7B 2G4UA 4NIYA 1O2XA 1UM7A 3PM3A 5A0CA 2OUAA 1MH0A 3RXSA 1MQ6A 4AFQA 3U1IB 1Z86A 4X2YA 1SGNE 3MO3A 2H9HA 1MCTA 2JIKA 2AFQB 1TA2A 1KY9A 1KXDA 4NMSA 1O32A 2OCVB 1C1SA 3UOUA 2FOHA 3WY8A 1RRKA 4GHTA 1AIXH 3SI3H 3RXIA 1GQ5A 2CGAA 2XBVA 2H2CA 1IQHA 1BB0B 1A5IA 4X6NA 3T29A 2ZDLA 2UZCA 1V6BA 1SPJA 3ZVEA 5JBTA 2EI7A 2HRVA 1N8OB 1G3BA 1SQOA 1LPZB 5T6DA 1GGDB 1RGWA 1AFQB 2Y7XA 1AKSA 2ZWLH 1GJAB 4U30A 1AUJA 2M0ZA 1TALA 1FDPA 4O97A 1WHAA 5G1DA 1T4UH 1C1RA 2KOHA 3AAUA 2BDIA 1U39A 4ZKRU 3S7KB 2A5IA 2P94A 4K2YA 4MLFB 3SJIA 1WCZA 2AGIX 2WUCA 4EDJA 3T28A 3GDSA 2HNTE 4KTUA 3BTEE 5E2PA 2QT5A 2M3MA 1GI5A 2FTMA 2FOMB 5FAHA 2EGNA 1BHXF 1AY6H 3S0NA 1FZZA 3TSWA 4FU9A 3ESTA 5FB8C 2B8OH 2QKUA 3GY8A 1C1VH 4AORA 5FHTA 3BTGE 4ZKOU 2M0VA 4NSVA 4JZEH 2QY0B 3BEIB 5AHGH 1GHZA 1K1MA 2FS8A 4YT7H 1PPGE 4UEHH 3TVJB 1SFIA 2PKTA 4MPUA 2FO9A 4UE7H 4GSOA 5A2PA 1D4PB 5EQQA 3P8OA 4H4FA 4DT7B 3KNXA 5EGMA 1OZIA 1CGIE 1BJVA 5GDSH 1QAVB 1T32A 2ZDVH 1DOJA 1UK3A 1NZQH 1D9IA 2C4FH 1SR5C 1V2LT 2F9OA 3RXDA 2PTNA 3GCNA 3MTYA 4AB8A 4BXSA 1ZMNA 1J14A 3D49H 1SGFA 1HAXB 1I16A 2CJIA 2BLQA 2G55A 2AWXA 3T27A 1C1TA 1SVPA 3TNTA 3E90B 5CHAC 1P06A 3KZDA 3PTBA 5HM2A 1FAXA 3U8RH 1G2LA 1CHOG 4JOHA 2DE9A 3SJ8A 3DJAA 1K9OE 2G4TA 5HFCA 2WYJA 1J9CH 2BD8A 4CREA 4GAWA 2ZU5A 1BTHH 1O2KA 3UFAA 1KDQB 3QGJA 2W3IA 1B0EA 1KXBA 1GMDG 1EJMA 1OKXA 4XBCA 1EX3A 2EAQA 4K6YA 4VGCC 1L4ZA 4Y0ZE 2Y82A 2DLSA 1NFUA 2JH0D 1P02A 3KQEA 1CGJE 4NSYA 2ZQ1A 1N7TA 2H2BA 2BLOA 3LU9B 1NM6A 1KEFA 5F8ZA 1T4VH 4FUBA 1O2WA 1GDUA 2KYLA 2VIDA 2ZGHA 3ZZ8A 1EXFA 1PPHE 3KQCA 3B8JA 4I7YH 3RXRA 4HTCH 4E35A 1DUEA 2BDHA 1GVKB 1RTLA 2ZP0H 1HUTH 4JCNA 2BX4A 2BX3A 2FEQH 2BMGB 2B0FA 2FX4A 1G37A 1R6JA 1X5RA 3UREA 5JXBA 2PR3A 3UUZA 4ZHMU 5JBBS 1SGEE 2ZFPH 1GBCA 5FX5A 1LCYA 1IQEA 4YESB 4Y8XA 1CHGA 2DLUA 2A31A 1NPMA 1C5XB 2ZFSA 1SGFG 3BTHE 3U8OH 2F9VA 1CA8B 4P0CA 2W7UA 2ZPLA 1INCA 3PLPA 1GHBG 1YP9A 4NWKA 4TWYA 5HGGA 4YOIA 2JINA 4O3TA 1ZOKA 4J1YA 2UUFB 1F0TA 1YPHE 1O36A 2OC1A 2SGDE 2ZDAH 1MBMA 1IU2A 3E3TA 1QLCA 2OQ5A 4JOGA 4K8YA 1N7EA 2BLWA 2AMQA 3ZZ4A 1PPZA 3PWCA 4MPWA 4IC5A 4B1TA 3K6YA 4O3UA 2ESTE 4BTUB 3HATH 1GHAF 4FUHA 2WPLS 1YM0A 1UM1A 3SU4A 4OAJA 2AH4X 4CR9A 3P70B 1F0SA 4IMZA 4CBNA 1ZGIA 2FWWA 5FBEA 1UTPA 4BXWA 2F9NA 1O2YA 2ZGBH 4DVAU 2XXLA 2PKUA 2TGTA 1A5GH 1E36B 2UUJB 4BAQB 1MD7A 1VITH 1TQ0B 1QRXA 1ESTA 1BRBE 1OP2A 4OS7A 2DMZA 3A84A 2KAIB 3FP6E 4UFFH 2SGAA 2W26A 3LOXA 1A5HA 1KWAA 2Q6DA 4YOGA 2GZ9A 5DP8A 4VGCB 4ISHH 8LPRA 1DANH 1HRTH 1XUJA 3A7ZA 2TBSA 3RXFA 1BBRE 2JREA 3TK5A 1WFGA 4REYA 2ZU3A 3RXQA 1D6RA 1O2HA 1THPB 1TNHA 1C4V2 1KLJH 2ZCKP 1MAXA 2F91A 4INLA 3UOPA 2E7KA 3RLEA 3OSYA 3ZVDA 1C5VA 1YPKH 4Y0YE 1N7FA 1MKWH 2EDZA 3LPRA 5IYTA 2P3FH 1Q7XA 4CH2B 2XWAA 1ZYOA 1W0ZU 1CGHA 5F6MA 2JILA 3FANA 1DICA 1QL7A 4WF8A 1DM4B 2WL7A 3OTJE 1DDJA 1VJ6A 3ODFA 4O06A 1C5OH 1Y59T 3GICB 3M3SA 3TNSA 2FN5A 2SGPE 4K78A 2JXOA 3NUMA 2DUCA 1FNIA 3K9XB 2M0TA 5HMAA 2XC0A 3PMHB 2BQWB 4ZMAH 5E21A 3Q76A 1WQVH 2P3WA 4Z8JA 2VZ5A 1X5QA 1GI1A 3MNXA 1WSSH 4AX9H 4Y79A 2VWRA 4UU5A 4DY7B 4FVBA 4K8BA 3DFLA 1H1BA 5GWZA 1RGRA 1HB0B 1ZSJA 2J95A 3C27B 4HOPB 1DS2E 1Q3OA 4Q2PA 4JZFH 3QGLA 1O3GA 1RJXB 4DGJA 2AGGX 5F03A 1UF1A 2OSGA 4NMPA 3SV2H 4I31A 5PTPA 1LHEH 1IQKA 1YPMH 1NO9H 4CRGA 1X6DA 3VB7A 1FCFA 1AB9C 2I0LA 3SHUA 3P92A 4MNWA 1CSOE 2RRMA 3NGHA 4ZXXH 3G01A 1OP0A 1OBZA 3E16B 2NU2E 1BRAA 1D3DB 3TIUA 1P3EA 4A1VA 5HYOA 3LC5A 5DP3A 1WTHD 2P8OC 3ELAH 4Q80A 3NK8A 5C5OA 1J8AA 1V2RT 3ZZBA 4F49A 3SU2A 3LNXA 1UEWA 2BD4A 2NU3E 1IQGA 1A1RA 1W3CA 3DT0H 1KDQA 4ZXYH 3SU5A 1YCPM 3CBYA 1L6OA 3A80A 1XVOA 4CRBA 4Q6SA 4UU6A 3PV4A 1O3PB 1TNLA 2XBWA 2ZG0H 2GZ7A 3RXJA 2D2DA 1G9IE 2ZGCA 2ZHWH 1NRSH 2BZ6H 2AEIH 4E06H 3RXOA 1B7XB 3BTME 3CH8A 3RXHA 3LGVA 3RLYH 1ACBE 4N6XA 4THNH 1W7XH 2HE2A 1FN6A 3UTUH 2PGBB 3NFKA 4Y71A 2BDBA 1ZRBA 7GCHF 3NZIA 4DIIH 1IQJA 2ZDMA 2PNTA 1TX6A 2PKAB 2OP9A 3LH3A 4GVDA 4XSKU 3PWBA 5ETXA 3A85A 4NA9H 4MG3A 5TJXA 3PS4A 1TAWA 1TP3A 1UTNA 1BTXA 4D7GA 1O39A 1C1UH 8GCHG 4UFDH 1T8LA 2YT8A 2H9TH 1P1EA 3UR9A 1X45A 1Z8JB 2IN2A 1P9UA 2BLVA 4ASHA 3R3GB 1UTMA 1T8MA 1A0HB 5C1UA 1EJAA 1JRTA 3PMAB 4MTBA 2D1JA 1A4WH 4K69A 3BPUA 3V0XA 1AVGH 7KMEH 5AVDA 5DK1A 3CC0A 1F0RA 1QB6A 1T2MA 5E6PB 1TGNA 2V1WA 2EI6A 4G69A 2JETB 2Q6FA 3DA9B 3E0NB 4ABEA 2Z3CA 4AFSA 1XUIA 1HLTH 5EW1H 3ZYEA 4Y7AA 2FI4E 3KZEA 1FPCH 1O3HA 2FCFA 4R0IA 4ZKNU 2LUIA 1X8SA 3DJ3A 3MNBA 5DO4H 5C5NA 1XX9A 4X1PU 1AMHA 2G8TA 3SU3A 2BD7A 1NF3C 4FU8A 1AWHB 1ELDE 3PLBA 3RXKA 2Y5HA 4ISNA 2W7SA 1GI3A 4TPIZ 1L4DA 4YZUA 1N1LA 1Y3WA 2PWXA 2XCNA 3LKWA 1QL8A 2FDAA 1SG8B 3S7HB 1N6EA 1BFEA 3GCOA 3GISB 5EQSA 4XFQA 2Z3DA 3S9CA 2QA9E 2Y80A 4OGYA 1SI5H 2VGCC 3RXMA 5H3JA 2V3HH 3F9EA 3MYWA 2VSVA 2G00A 1QB9A 2CN0H 2BVXH 2DKRA 1W14U 4FGMA 4AMHA 1YCPK 1UHBA 4ABDA 2KAWA 1C5MD 2PUQH 2AGEX 1ETTH 2HALA 1TPPA 2D8WA 2ZC9H 3PMBB 4NA7A 1XVMA 3E6PH 3CS7A 3HKJB 3AW0A 1GJ7B 2AMPA 2VWOA 1TRYA 1SQTA 1A3BH 2XBYA 1PDRA 4MNVA 4OEPA 1Z1JA 3RU4T 1TOMH 3A7YA 1VA8A 2LNCA 4JORA 1EJNA 2CHAB 3EQ0H 1UK4A 4UFGH 4FVDA 1WF7A 1C9TA 1BMMH 1O2TA 4DW2U 1GMCG 2BY8X 2QKVA 1QNJA 3KN2A 2HWLB 1HIAA 2AIQA 1OWIA 4BAKB 2QXIA 3SN8A 1C5RA 5T6GA 2OLGA 2JKHA 4ZHAA 1BRCE 1WJLA 4XOJA 1ZTLA 2H1UA 1V2MT 4GPGA 1K1JA 1HAIH 5FCRA 4A92A 3GJ9A 2OQUA 2I4SA 2Q9VA 5E0GA 3A8BA 4LOYH 3UQOA 1OX1A 1LKAA 1CU1A 3TH3H 2I0IA 3H7OA 3RC6A 3ZV8A 2FM2A 4M7GA 4D8NA 4HOPA 5HEYA 1GJ8B 3M3TA 3A8DA 5JB8S 2ZTXA 4MNYA 1VCWA 1O2OA 4X2WA 1DSUA 1W10U 1V1TA 2QF0A 3AAVA 2FP7B 4NIXA 3BTQE 1XM1A 3SBKA 2GCHF 3P95A 1TP5A 1UCYH 2VH6A 3DFJA 3HVQC 4BOHA 1HCGA 3TK6A 1J15A 4CRAA 3GOVB 1ELEE 4Q2OA 1GL0E 3SGAE 1NFXA 3QDOA 1GG6C 3LGIA 4XBDA 2Y5GA 1GJDB 3ATLA 1GI0A 3PO1B 5EG4A 3SUFA 1RD3B 1K28D 1TGBA 1AN1E 1W11U 2VGCB 4I33A 4DCDA 1VITF 2R2WU 6GCHF 1FY4A 3AVZA 3OYPA 1VR1H 3STJA 1C5SA 2QKTA 5D13A 3K2UA 1F5KU 1D3TB 4X1RU 1FAKH 1MTVA 1GVLA 1EPTA 2KJKA 1Y3YA 1XKAC 3V7TA 1KYNA 1MKXK 1TE0A 1UTKA 4Y6DA 1HAYB 1C4Y2 2V0BA 3T62A 1WU1A 1FN8A 1N99A 2ANKH 3RXEA 3TSZA 1ZMLA 4CBOA 1C2HA 3Q00A 1TABE 3ITIA 3SUGA 1ELBA 4H42U 2UUKB
chains in the Genus database with same CATH superfamily
1LHFH 1SL3A 3GY4A 1S85A 1GJ6A 1K1IA 3KDKA 3MOCA 2O8LA 1O2ZA 4MPAA 1WAYB 1BIOA 3N7EA 3U69H 1DY9A 1ZPBA 1GBMA 1OBYA 3UNSA 1B8QA 4YM9A 1RY4A 2VIWA 4I8GA 3SOSA 1QBNA 3TJUA 4Q2QA 5K7RA 2W5EA 1HJAB 4HI3A 3PROA 3MMGA 1ABJH 3VFEA 1O2UA 5DP5A 1QB1A 1DFPA 3SV9A 2JWEA 4JOJA 1JIMA 1NFYA 3RXGA 4DOQA 2SNWA 3QGNB 6CHAC 2VBCA 3UQVA 2FYRA 4H6TA 1GI6A 2FLBH 4I8HA 2ZCLP 4AFUA 5C20A 4IC6A 1SB1H 1NU7B 1PYTC 1YGCH 1LMWB 2A2XH 3NRLA 2BD2A 1H8ED 1K1PA 3SHCH 4JJ3A 3SORA 2ALPA 2EJYA 1P9SA 4NFFA 4DIHH 2XC5A 1X7AC 1S0QA 1WQSA 1EP5A 1O2MA 2MX6A 3CBXA 1TBQH 2H3MA 1MTWA 1I92A 2EHRA 3SJ9A 2Q3GA 1A46H 1HAOH 1NESE 3JZ2B 4I8JA 1HAPH 2M5TA 1VCPA 1YPLH 1W13U 4LXBH 3BG4C 2YOLA 4SGBE 2Z9KA 1AHTH 1GDQA 1SHYA 2LPRA 2PSXA 1M9UA 4I8LA 3I1EA 2HPPH 3VXFH 1AVWA 4MPVA 1GG6B 4Q7ZA 5GJ4B 1Z71A 4WYUA 1ELAA 3FVFB 3M5MA 2AS9A 1V2VT 3SZEA 1Z87A 2OBQA 2VB0A 1BTUA 1CE5A 3SUZA 1C2JA 2D90A 1J17T 1FLEE 1GI4A 1O3NA 3A81A 4E7RG 1BTZA 1GBLA 1RGQA 1T8OA 3SGBE 1LO6A 1NS3A 1LHGH 1MTNC 2V3MA 3DSPA 2C8ZB 1S5SA 4ZROA 1P2IA 3PYHA 2X7ZA 2BHGA 3BTDE 4HFPB 3RP2A 2RDLA 2QG1A 1BA8B 3SU1A 2DJTA 4Z1MD 2ZF0H 1GCTC 1XZ9A 3HGPA 2WUBA 3A8AA 3M7QA 2ZU1A 3T25A 3VB3A 3QJMA 3EA7A 4AFZA 2OS6A 2F9UA 3K65B 4MNXA 5LPEA 3QLPH 2CK3D 3EAJA 4B73A 1UVUH 2CF8H 1OOKB 5F67A 2TGPZ 4IW4E 3SQHE 1GJ9B 1HBTH 1ID5H 2QCYA 1COWD 1TIOA 2XW9A 2RG3A 1LVYA 2C8WB 4M9FA 2EC9H 3URDA 3UY9A 1SFQB 1JWTA 1A7SA 4YOJA 2HGAA 3BSQA 2VPHA 2Z7FE 3BV9B 3RM2H 4X8SH 4LMMA 1KXAA 2IPQX 2HPQH 4Q6HA 1O3EA 2R0KA 4OS2A 2Q6GA 4JJ0A 1O3BA 3W95A 4XDEA 1TYNA 3BIUH 4A1XA 4J2YB 2Z9IA 3MU1A 4Y10E 3QE1A 4K5ZA 3CS0A 3BEFB 1O2RA 5DG6A 1FIZA 5F8TA 3Q77A 4UD9H 4RI0A 4K72A 1EAWA 2BQ6B 2B9LA 4K75A 4RKOB 1J16A 1HAVB 5I46H 1D3PB 4H6SB 3GDVA 2O8TA 4LZ1H 1WYKA 3R69A 2I04A 2PZDA 1HAZB 3ODDA 3MHWU 4GCHF 2RCZA 4TY6A 2OD3B 4JZ1A 4FUCA 1C4U2 1O2LA 1P10A 2ZDNA 4FUJA 4BTIB 5HFBA 1PPBH 1IQNA 2SFAA 4Y76A 3EA8A 1ZSKA 1DXPA 1UJVA 2ZHEH 1AD8H 4NMRA 2IOTA 3BG4B 2GZVA 3GDUA 1K32A 1V2PT 1ZPCA 1UMAH 4ZUHA 3F3BA 4RN6A 2DM8A 2UWLA 3ZVAA 1C5TA 2FE5A 3MH4A 1L0ZA 3L33A 1BBRK 3RU4E 2ZFFH 1P8VC 5TCAA 1DSTA 2VU8E 3I29A 1ELFA 9LPRA 5CHAB 2A0QB 2P3TB 1MMJN 1TBZH 4WH6A 4YLQH 1MZAA 1O0DH 1TNKA 1AWFH 3MO6A 1GHAG 3DCLA 3F9HA 1ZR0A 2C8XB 1H9LB 3I77A 1MTNB 2WPHS 3EGGC 5J4QA 5EU8A 3BEUA 2QE7D 1ZHMA 4ISIH 5ESBA 1Y5AT 2P59A 2XRCA 5IK2D 4NZQA 1MBQA 1GCTB 2Z9LA 1OBXA 2ANYA 3Q3KA 1V2TT 4NZLA 4JYVH 1FXYA 5DN6D 1LKBA 1O38A 3FFGA 3SOEA 3E91A 3UNQA 1AGJA 1NTEA 1K1NA 2WV9A 2ZPQA 2KA9A 1QBOA 4K3JA 2IWPA 3VGCC 1GHYH 5LPRA 3SV7A 4ZKSU 5GNDA 1XUKA 2O8WA 3RU4D 2BYAX 2KR7A 4OS4A 1O37A 1NRNH 1W0JD 2FI3E 2ALVA 5GCHF 5IDKA 1C5YB 3A8CA 3WKMA 1Q3XA 3GYMA 1GMHF 5EJZA 3TLOA 1YPJH 3UNRA 5DP4A 4KKDA 4HZHA 5CMXH 1GI2A 3QX5H 1QJ1B 1GJ5H 3NWUA 2BVRH 4Y11E 2DB5A 1FV9A 2Z9GA 2STBE 5GCHG 1SOZA 3WKLA 3MH7A 1O5EH 3SHWA 1FUJA 2B7DH 4K60A 2JOAA 1ANCA 2ZI2H 3N7DA 2A5KA 3NKKA 1TNIA 3IWMA 3BTFE 1GBDA 1Y5UT 3GY3A 1ZOMA 2BZAA 3PV2A 3GCHC 2P95A 3P17H 2AMDA 2JH5D 3LONA 1GL1A 3RXPA 3U9AH 2TPIZ 4CRCA 1BCUH 1WFVA 4CHAC 1LQDB 1SHHB 1D3QB 1IHJA 1EAUA 3S69A 3B23B 3FY5A 1NROH 1DPOA 3C1KA 2PGQB 4IN1A 2L74A 1HNEE 1PJPA 1UEQA 3S9BA 3SU6A 3V3MA 5CDFE 1L1JA 2SGFE 1D5GA 2GGVB 3RMMH 3E8LA 2ZNKH 1LVOA 1AZ8A 4AN7A 2ZEBA 2KJDA 3OAAD 4JZIA 1P2NA 1WOFA 1O2QA 3M3VA 2KPKA 1UVOA 4Z6AH 1W8BH 1QAVA 2AERH 1GI8B 2G5VA 5FBIA 2GD4B 4NMOA 2L97A 3H7TA 2ZIQH 5L6NH 1LPKB 3VQGA 2FIRH 2HLDD 5FCKA 1U37A 1ETRH 3KHVA 1RFNA 3HPKA 4R2ZA 5A8YA 1EOJA 3LGTA 4WYTA 1E38B 1Y3XA 2ZTYA 2MHOA 1JOUB 4Q63A 1KXFA 1KLTA 1PPFE 2P93A 1WTGH 1KIGH 3VB4A 3SGQE 1EASA 4AG2A 2GP9B 5HF1A 2A7CA 5FPTA 2THFB 1LQEA 5EPNA 3SNEA 2ZPRA 1FI8A 3HGNA 2W4FA 1UW7A 4X6PA 5BRRE 2JSNA 3M61U 5E0JA 5EQRA 5EXMA 2J98B 1QHRB 4KFVA 1IQIA 1SGYE 4FUGA 3RL8A 1V5QA 5A8XA 2AHME 1MABB 3UIRA 3TJOA 1KSNA 2R3UA 2ZU2A 1UJ1A 3UPEA 1MD8A 3SNDA 4NWLA 1BMNH 3TGIE 2A45B 3STIA 1BJUA 3ZV9A 2FLRH 1TRNA 3MU5A 5C67A 4FUDA 1TLDA 3NFLA 1P3CA 2V90A 1H8DH 1SLXB 1DXWA 1KLIH 3RXUA 4PQWA 2ANMH 2QAAA 5T6FA 3ZVGA 4Q7XA 1TQ3A 2ODYB 2LC7A 1QA0A 2A2QH 1HDTH 1O2NA 3VG8A 1AE8H 1UVSH 1K2I1 1MFLA 3GCTF 5JBCS 5FXLA 3EDXB 3FZDA 3L6PA 3PLKA 2A4RA 1E1QD 5G1EA 4AB9A 4DG4A 1GBTA 3KIDU 4JMYA 1YPGH 4OS1A 2RA0A 1V2UT 1GQ4A 2AIPA 1P2KA 2JIZD 1KTTB 1OP8A 4X8VH 2SGEE 1NC6A 1P11E 1SGIB 1EOLA 1UEZA 3LC3A 4KTCA 1BZXE 4UONA 7GCHG 3OU0A 1YYY1 3GCHB 2YUYA 4ESTE 1AKSB 3FP7E 1KXEA 2WINI 2XTTB 4ISOA 2V3OH 1C2DA 2VWLA 4NIVA 1WI4A 1C1WH 3VB6A 2EEGA 1GBHA 1TFXA 5E11A 1DY8A 2OBOA 1O3MA 2F0AA 1TX8A 3SJOA 3ZVFA 2PKSC 1HAHH 2OCSA 1W7GH 3AK5A 1SGQE 4ABIA 2FZZA 1WBGB 1O3CA 1EP6A 1BUIA 1V2JT 2WSSD 1ARCA 2A7HA 1MFGA 2M0UA 1NRQH 4BAOB 7ESTE 1UCYE 1C5LH 3P6ZB 4B74A 5E0HA 1YBWA 1FJSA 3F9FA 4B2AA 1C1PA 3ATWA 2ZHDA 1V2NT 2QYIA 1K21H 2PDZA 3QZRA 2EXGA 1SC8U 2ZQ2A 1A61H 3E0PB 3ZZCA 3R68A 1UTJA 1IOEA 1BTPA 1SGPE 1NU9A 1MC7A 4ZHLU 1AQ7A 3UWJH 3N99A 1AB9B 1IAUA 5CE1A 4K1SA 3H5CB 1ESAA 3TH4H 2XC4A 3KL6A 2EI8A 4Y8YA 4WY3A 2PSYA 1QY6A 1MZDA 1XKBC 3TJNA 1B5GH 1QZ8A 3SZNA 2A4QA 2BY7X 4JOFA 4NXPA 1P09A 2XOKD 1NRPH 4JZDH 3TGJE 1O3KA 1GI9B 2P8OB 4DJZB 5GPIB 1DE7H 1P0SH 1SGTA 2W7RA 3O8RA 2WPMS 4HGCA 4P00A 2ZDKA 3ENSB 3ID4A 1QIXB 2FTLE 2O2TA 1Z8GA 2ULLA 3A89A 1C1OA 2KAIA 3Q3XA 1GPZA 1OWDA 5EPYA 1QCPA 1XUGA 2FS9A 1DX5M 4OEOA 1LHDH 1TNGA 2L4SA 1VJAU 2K1ZA 2ZCHP 1G3EA 1V2WT 3RMNH 3F0PA 2H3LA 5HDYA 2SGQE 1PPEE 2KQFA 1W2KH 2CMYA 1D6WA 2WYGA 1NT1A 1SKYE 1FIWA 5HEDA 4WWYA 1U3BA 3QJNA 2QXGA 4FLNA 1S81A 1ZHRA 1E0FD 1V6DA 3TGKE 3EE0B 5EYZA 4WMFA 2Z9JA 1UJUA 2OGPA 1C2LA 1AU8A 1GI7B 4XHVA 1EB2A 5G4BA 1PFXC 3CYYA 2KRGA 2CF9H 5FX6A 3ZZ9A 2J34A 4AOQA 2HE4A 2J94A 3CP7A 3MNCA 1CBWC 2I1NA 2H9EH 1UFXA 3VXEH 3MU4A 2GV6A 2PLXA 1O3FA 4ABFA 1GJCB 1KMHB 4YTAA 2KM0A 4L8NA 2PW8H 1GJ4H 1GWAA 1GBEA 2G81E 4D76A 4JOPA 2P16A 2ZFTA 1P12E 2BXUH 1JRSA 1GGDC 1TOCB 2L4TA 2QXHA 3RDZA 4D9QA 1W12U 2BDAA 5B6LA 2GEFA 5AF9H 1HXFH 1BRUP 3SUEA 1TBRH 5DGJA 2J9NA 1GHVH 1FY5A 4X8TH 5GIBA 1OXGA 1DVAH 5EZ0A 4Q4LA 1SBWA 5ESTE 1BE9A 3RLWH 1HV7A 4RKJB 3OEED 1BMAA 1MU8B 3QZQA 4R8TB 1EAIA 3ZZAA 1JXPA 5EXNA 2ANWA 4NA8A 3ZZ6A 4AYVB 1FY1A 1GHXH 3RMLH 2FNEA 4K1EA 5AFZH 3ZVCA 1MU6B 5DP9A 2UWPA 4X0WU 1CA0C 1FY3A 5DSFA 2TRMA 1Q3PA 4U01A 2EEKA 3QUMP 4AYYB 2A1DB 2Y6TA 1DWCH 2ODQA 3F68H 3PMJA 2W3KA 3SYJA 1NY22 3K82A 2KBSA 2J2UA 5F3XA 2BM2A 2Z6BD 1L2EA 3FP8E 2PA1A 5KECA 1IHSH 1K22H 1PQ8A 2FX6A 4OS5A 5E1YA 4F4OC 4U32A 2FOFA 1QRWA 3VEQB 1W9OA 1C2FA 2QBWA 4FUEA 1Z1IA 2GCHG 3MFJA 1RS0A 1GJBB 1ETSH 5DTHA 1OHHD 4WVPE 4ZCNA 3P8FA 2NU1E 1A3EH 1S82A 3TSVA 4X1QU 1ESBA 4WMEA 4O03A 2I6QA 2GVFA 3NCLA 3IG6B 1VGCC 5F8XA 4TPYA 5A09A 3F1SB 3T5FH 1IHTH 4BNRA 3A7WA 1BQYA 1T31A 3I78A 1V62A 1HJ8A 1VITG 1O33A 1S6HA 6GCHG 5HEBA 2GKVE 1CO7E 2BY9X 3SFJA 1ZLRA 1ZGVA 3U28C 1QJ7B 2OC7A 4K76A 5K0HA 3GY2A 1PYTD 3ID2A 2XWBI 4U2WA 2ZECA 3HKIB 3R0FA 2QGRA 1EZXC 3ATIA 1QGFA 3TU7H 2XNDD 1CBWB 1P01A 2PKAA 1NFWA 3SV6A 4NNMA 3BIVH 1XUFA 1UTOA 1FC7A 1UVTH 1H8HD 1E34B 2O9QA 4JK5A 1BOQA 5B6OA 3A88A 5GLJA 4P2AB 1SLVB 2ILNA 2TIOA 1S6FA 2OXSA 2QF3A 4X1SU 1C2KA 2G52A 1E79D 5HFDA 5JPMH 4JOKA 1QURH 1TWXB 3CNRA 1FY8E 1EUFA 2C90B 2FODA 2VIPA 3Q3YA 4INKA 1T7CA 1ANDA 3R0HA 2GMTC 3RUOA 2YTWA 3EGHC 1GBFA 1XXFA 4GVCA 1XMNB 2GT7A 1UITA 3E17A 3TJVA 5FPYA 3K1RA 1DWEH 1UK2A 3ATKA 1C2GA 2R2MB 3M36A 4Q2KA 4X6MA 2R3YA 1P04A 1CA0B 5DPAA 2IWOA 1KTSB 3SI4H 2REYA 2BD5A 1VJ9U 3LJJA 1YCPH 1EZUC 4B71A 1WDIA 3GS9A 4WJG2 1O3IA 1YF4A 1C1QA 3RXAA 4OM9A 2QXJA 1MKWK 2H2ZA 1AVXA 1QQ4A 3FZZA 1WV7H 2VWNA 1WH1A 1ANBA 1GDNA 2KOJA 1EB1H 1OYTH 1P05A 2FOBA 4ZH8A 1CT2E 1K1LA 2VH0A 9ESTA 4KP0A 1A0LA 2BDYA 1F0UA 2PTCE 1UHPA 4KFWA 2A32A 4NXRA 1MTSA 1YY3A 2V35A 2WPKS 3BN9A 3LGYA 2GCTC 3BF6H 2OTVA 3PRDA 1SGDE 2QF5A 2VIOA 2XCFA 5E22A 1G30B 1WIFA 3U8TH 3MH6A 2NU0E 1TPSA 3RXTA 1VGCB 1CHOF 3KGPA 2YNAA 5DJ7A 3FAOA 4FXGH 2K0QA 2OINA 5T1VA 4A5TS 1SGCA 1O2GH 1EATA 3O8BA 4RT0A 2M10A 1C5WB 2LA8A 2ZKSA 3GY7A 3U98H 2ZO3H 1GMDF 4AGJA 1S0RA 1P03A 4Q7YA 5HETA 5SGAE 1BTWA 3PB1E 1GBKA 4A6LA 3MI4A 1VAEA 1JMOH 1MTUA 2CS5A 2VWMA 4JL7A 5DKMA 1TGTA 1OYQA 1S83A 5HFEA 4ZAEA 3I4WA 1YLCA 1ZTKA 3WWBA 1C1NA 3W94A 2KPLA 1SQAA 3OY6U 3KF2A 1FC9A 1HXEH 3SU0A 1O3DA 2HNTC 2ZFQH 5HIZA 5BPEA 4F55A 2C3SA 2Z94A 1H8IH 2OPGA 3PV5A 3BTTE 1FPHH 2WPJS 2FI5E 3MO9A 2LOBA 1ZSLA 1IQMA 5LPFA 3LGWA 1MAYA 5JYIA 1EKBB 3MWIU 1C5NH 1TB6H 1UTLM 3QK1A 5EXLA 3O8CA 3ATMA 1SMFE 3UR6A 2F9PA 4MVNA 2GZ8A 1DLKB 1LDTT 1F92A 1P1DA 2HGTH 6CHAB 3LT3A 2DAZA 2Z17A 1HFDA 2G2LA 2BOHB 2GMTB 1C5QA 1UVPA 1W9QA 1FMGA 2F43B 3HPTB 2VIVA 5C0TA 4E7NA 4FUIA 2D92A 5EW2H 3GY6A 1QRZA 1Q31A 5FPSA 3KHFA 4Q3HA 1GHBF 1C1MA 3TMHA 3NXPA 2GT8A 4KTSA 1THRH 2CSSA 2ZHQH 3MU8A 1OSSA 3V12A 1O2VA 3DSGA 2WPIS 5C1XA 1ZJDA 1SGRE 3OTPA 3TK9A 2C8YB 4NMQA 4ACAA 5KEDA 6ESTA 1P2QA 4WMDA 4B76A 2TGAA 1G36A 1WG6A 1TMTH 1MKXH 1JBUH 1O2JA 4FOUC 4XE4A 4YT6H 4GCHG 1YC0A 1YKTA 1Z8IB 1ZTJA 2BDCA 3M5LA 4SGAE 2KCAA 1HPGA 1N6YA 2EQNA 1GM1A 1UJDA 4F8KA 1O5CB 4Y8ZA 2BDGA 1QTFA 1QBVH 2R9PA 2VSPA 3U1JB 3QDZB 3SNAA 3M7UA 4YO9A 2DE8A 1O5FH 4AZ2B 4NMVA 2RA3A 2ZHFH 3B9FH 1Z6EA 2OMJA 1LHCH 1YWUA 1W9EA 8KME2 3KQDA 3M7TA 1TX7A 2GCTB 1OPHB 3ZZDA 2M2AA 3DHKH 1O2PA 1SSXA 1ZRKA 1NTPA 5A0AE 1WUNH 1E37B 2J97A 3RXLA 1ZUBA 2K1QA 2PV9B 2F83A 4X2XA 1F5LA 4I32A 1DWBH 5E8EH 1CVWH 2EGOA 1O3OA 3OY5U 3QIKA 1ELVA 5L2YH 4B6EA 5A0BA 1Y5BT 4BAHB 2KJPA 2PHBA 2SNVA 3V13A 1RTKA 3LH1A 2BVSH 3VB5A 3LGUA 1O3JA 1A2CH 1GVZA 2QIQA 4UFEH 5LGOA 1IQLA 4TY7A 4O9VA 1Y7NA 4BANB 1IU0A 1V2QT 2KCYA 1O3LA 4D7FA 2ZGJA 1G9OA 4CH8B 3HK3B 4OGXA 2H6MA 3KQBA 1CT0E 2CXVA 2FXRA 3D65E 3OFND 1EFRD 1EPTC 2VIQA 1N6DA 2NWNA 1UHBB 1C2EA 2QF4A 1C5PA 4AG1A 4Y7BA 5GXPA 4LK4A 1RIWC 2QV1A 2PUXB 3RXVA 2GX4A 1THSH 1GMHG 3DUXH 1P57B 2KV8A 2GV7A 2KZ4A 4NXQA 4B6FA 1TNJA 1T8NA 1QJ6B 2TGDA 2J5UA 2ZTZA 2BXTH 1BTYA 4UDWH 3DORA 2G51A 2UUYA 4MPXA 3AASA 5EJLA 1UO6A 2XYAA 1O30A 3TH2H 4E34A 2BB4A 3ID1A 1YPHC 2HLCA 1E1RD 4X6OA 1V5LA 1HJ9A 1CT4E 4DURA 2KCPA 1O5DH 4CRDA 1U38A 2GDEH 2EV8A 4NGAH 1C2MA 1O2SA 2KG2A 3PTNA 2A4OA 2JJ1D 2R4HA 1GBJA 2EA3A 1F2SE 1HIAB 4JOEA 2ZFRH 4IBLH 2OQSA 1HGTH 3SUDA 4NG9H 2ZPMA 4XBBA 1CQQA 1H4WA 3K50A 3M37A 3O46A 1OWKA 1E35B 1AFEH 4Z33A 1TQ7B 3DIWA 1U6QA 3QTVH 1BMLA 3VPKA 4X8UH 2J4IA 4FUFA 2A4GA 4TWWA 1YPEH 2JETC 2F3CE 1AI8H 1MCVA 4NMTA 1TGCA 1C5UA 3MU0A 2G5NA 2VINA 4B75A 3A83A 2FPZA 2D8IA 1TA6A 2EEHA 5JB9S 4ABHA 1UEPA 1G3CA 5DP6A 1S84A 1SOTA 2BD9A 4Q2NA 1B0FA 2G5MB 5F53A 1WHDA 2HVYB 2EEIA 1DWDH 2KX4A 4AGKA 1C5ZB 1TGSZ 1XUHA 2QN5T 3F6UH 1ANEA 1PQ7A 2EDVA 7LPRA 3L3TA 3SNCA 3VGCB 1BHXB 2BYGA 4JYTA 1GBAA 1SLUB 1QFKH 1MQ5A 1OWHA 3GYLB 1V2KT 4WH8A 4GLYA 1Z8RA 2I6SA 3O5NA 1VKYA 5HF4A 4I8KA 2LC6A 1UTQA 4YLUA 2FOGA 3SW2B 1PPCE 1TMUH 1EPTB 1GHWH 1QR3E 2STAE 2A7JA 3L4FD 1ABIH 3ZZ5A 1Z6JH 1RIWB 1C9PA 4YDPA 4ABAA 1UCYK 5A8ZA 1RZXA 1XXDA 3ZYDA 1ORFA 2VJ1A 2AYWA 3I18A 2VNTA 2AINA 1TPOA 3GCTG 4A1TA 5L30H 1NRRH 3OX7U 1F5RA 1G3DA 1ELTA 2I6VA 2F9BH 4NNLA 6LPRA 2BTCE 3EA9A 4KELA 4BTTB 3LDXH 8GCHF 2ZGXH 4CHAB 2RCEA 1KXCA 2BOKA 1BBRH 1ZJKA 1AUTC 4IS5A 4Z0KA 2P3UB 1IQFA 1BITA 5DP7A 5AFYH 2BY5X 1TPAE 2CHAC 1V2OT 3TPIZ 8ESTE 1AZZA 1HAVA 5JDUB 1ARBA 2ASUB 2JJ2D 3KCGH 2OZFA 3OE7D 3MNSA 2IWQA 1O34A 2NU4E 2ODPA 1FQ3A 2B5TB 3GABA 3ID3A 3NPSA 4WXVA 2YT7A 1ZMJA 4JYUH 3PDVA 2ZPSA 1M5ZA 2EGKA 5HXFA 1A0JA 1W0YH 3BTKE 5C3NA 3DJ1A 3N7OA 2H5CA 2FOCA 4NFEA 3P8NA 4K1TA 3T26A 3K6ZA 3GY5A 1O2IA 1V3XA 1L1GA 3CBZA 3O8DA 3M35A 3M5OA 3LIWA 3EE7A 5HJ1A 1EQ9A 3GSLA 1VCQA 1N6XA 4IGDA 1AO5A 4OS6A 3D62A 3QO6A 4H11A 1H9HE 2V6NA 1EZSC 1EZQA 2BD3A 2JH6D 2FOAA 3FKSD 2EDPA 3KQ5A 5H4IB 3RXCA 1FC6A 5TCCA 2VVVA 3H09A 1H9IE 1MUEB 1HYLA 2H5DA 3ZZ3A 4MQAA 3SQEE 3M5NA 1WI2A 1QL9A 2KL1A 3LNYA 2Y5FA 4PROA 4ABGA 1JIRA 3GGEA 4FU7A 5ABWA 5E2OA 5C94A 2IPHA 3AW1A 1WF8A 3A82A 3JXTA 3KEEA 4BAMB 1Z7KA 3ZRTA 2AWUA 3T2NA 5I7ZA 1LTOA 3A87A 1G32B 4ABJA 3AXAA 2O8MA 2GTBA 1ZPZA 3SV8A 3SJKA 5C2ZA 4MDSA 2UWOA 3A7TA 3RC4A 3EYDA 2K20A 3B76A 1TMBH 5CHBA 2ZU4A 5EODA 2FESH 3SHAH 1O3AA 1L1NA 5HFFA 1NBME 2Y7ZA 4GVUA 2FYQA 3KYFA 2HOBA 1HAGE 4A7IB 2V7QD 4B2BA 1FONA 1OWJA 2FOEA 2XBXA 3PO1C 2ENOA 2D26C 1O31A 1ELCA 3MQKC 1DT2A 3URCA 4D9RA 3UWIA 3S9AA 3MH5A 1K1OA 3RXBA 5C1YA 1TRMA 2WV4A 3F9GA 2VRFA 1RTFB 1P2OA 2C93B 3QN7A 4INHA 4QT8C 1EAXA 4DT4A 2YMSC 4KGAA 1GBIA 4LZ4B 2FMJA 1DLEA 2OC0A 3ZVBA 5A2MH 1TONA 1Y8TA 4X1NU 3RM0H 4ASUD 3A7XA 1QA7A 3SNBA 3ZZ7A 1LPGB 4NCYA 4TYDA 1DITH 1NBMD 1C2IA 2IJD1 4CRFA 1N8OC 2CV3A 2J38A 2PFEA 1AFQC 5EOKA 4WXIA 2J92A 1QAUA 1GMCF 3F2HA 2HVXA 2XNIA 1VZQH 1F7ZA 1VB7A 1X5NA 2YUBA 3A7VA 3JZ1B 4JK6A 4RSPA 1OWEA 1V2ST 2R0LA 2VVUA 4IMQA 2CSJA 2A5AA 1Y3VA 2PKSB 2QC2A 5I25A 5LH8A 2F5YA 3D23A 1RXPA 1ZZZA 3HK6B 1Y3UA 3EGKH 3F0OA 4TSFD 2AWWA 1HJAC 2DC2A 3RL7A 1GBBA 2Z3EA 5J4SA 5JBAS 3IITA 4ABBA 5HM9A 3FN8A 1ELGA 2IWNA 3PRBA 3BG8A 1PQAA 3A86A 3LJOA 4X2VA 2Q1JA 3VQFA 1O5AB 1LVBA 1PQ5A 2GDDA 2BY6X 2ZA5A 3TITA 2HNTF 1Q2WA 4GHNA 1LVMA 2EEJA 3CENA 1DUAA 3DD2H 3QWCH 1BDAA 1O35A 1N6FA 5L2ZH 1BT7A 3SO3A 1O5BB 1SLWB 4NIWA 3HPMA 4CR5A 4E3BA 4GUXA 2RFKC 1OS8A 4ISLA 1O5GH 2WV5A 4YYXA 3E1XB 2YNBA 4IN2A 2J98A 3RMOH 2IJOB 2Y81A 1NN6A 1P2JA 4E05H 2KOMA 3UB0A 3QTOH 1WXRA 1YBOA 1K0HA 4B2CA 1YLDA 3BTWE 1G2MA 1P2MA 2ZZUH 3FOAA 5T3HA 2O8UA 2VVCA 1GCDA 1AE5A 2OC8A 3RC5A 4GHQA 1ZHPA 1QQUA 3P8GA 3PDZA 2BQ7B 2G4UA 4NIYA 1O2XA 1UM7A 3PM3A 5A0CA 2OUAA 1MH0A 3RXSA 1MQ6A 4I86A 4AFQA 3U1IB 1Z86A 4X2YA 1SGNE 3MO3A 2H9HA 1MCTA 2JIKA 2AFQB 3KDGA 1TA2A 1KY9A 1KXDA 4NMSA 1O32A 2OCVB 1C1SA 3UOUA 2FOHA 3WY8A 1RRKA 4GHTA 1AIXH 3SI3H 3RXIA 1GQ5A 2CGAA 2XBVA 2H2CA 1IQHA 1BB0B 1A5IA 4X6NA 3T29A 2ZDLA 2UZCA 1V6BA 1SPJA 3ZVEA 5JBTA 2EI7A 4XRNA 2HRVA 1N8OB 1G3BA 1SQOA 1LPZB 5T6DA 1GGDB 1RGWA 1AFQB 2Y7XA 1AKSA 2ZWLH 1GJAB 4U30A 1AUJA 2M0ZA 1TALA 1FDPA 4O97A 1WHAA 5G1DA 1T4UH 1C1RA 2KOHA 3AAUA 2BDIA 1U39A 4ZKRU 3S7KB 2A5IA 2P94A 4K2YA 4MLFB 3SJIA 1WCZA 2AGIX 2WUCA 4EDJA 4P02A 3T28A 3GDSA 2HNTE 4KTUA 3BTEE 5E2PA 2QT5A 2M3MA 1GI5A 2FTMA 2FOMB 5FAHA 2EGNA 1BHXF 1AY6H 2WZQA 3S0NA 1FZZA 3TSWA 4FU9A 5HIYA 3ESTA 5FB8C 2B8OH 3ZIAD 2QKUA 3GY8A 1C1VH 4AORA 5FHTA 3BTGE 4ZKOU 2M0VA 4NSVA 4JZEH 2QY0B 3BEIB 5AHGH 1GHZA 1K1MA 2FS8A 4YT7H 1PPGE 4UEHH 3TVJB 1SFIA 2PKTA 4MPUA 2FO9A 4UE7H 4GSOA 5A2PA 1D4PB 2KFWA 5EQQA 3KYGA 2W6JD 3P8OA 4H4FA 4DT7B 3KNXA 5EGMA 1OZIA 1CGIE 1BJVA 5GDSH 1QAVB 1T32A 2ZDVH 1DOJA 1UK3A 1NZQH 1D9IA 2C4FH 1SR5C 1V2LT 2F9OA 3RXDA 2PTNA 2WHXA 3GCNA 3MTYA 4AB8A 4BXSA 1ZMNA 1J14A 3D49H 1SGFA 1HAXB 1I16A 2CJIA 2BLQA 2G55A 2AWXA 3T27A 1C1TA 1SVPA 3TNTA 3E90B 5CHAC 1P06A 3KZDA 3PTBA 5HM2A 1FAXA 3U8RH 2EY4C 1G2LA 1CHOG 4JOHA 2DE9A 3SJ8A 3DJAA 1K9OE 2G4TA 5HFCA 2WYJA 1J9CH 2BD8A 4CREA 4GAWA 2ZU5A 1BTHH 1O2KA 3UFAA 1KDQB 3QGJA 5C0UA 2W3IA 1B0EA 1KXBA 1GMDG 1EJMA 1OKXA 4XBCA 1EX3A 2EAQA 4K6YA 4VGCC 1L4ZA 4Y0ZE 2Y82A 2DLSA 1NFUA 2JH0D 1P02A 3KQEA 1CGJE 4NSYA 4XD7D 2GJGA 2ZQ1A 1N7TA 2H2BA 2BLOA 5ILBA 3LU9B 1NM6A 1KEFA 5F8ZA 1T4VH 4FUBA 1O2WA 1GDUA 2KYLA 2VIDA 2ZGHA 3ZZ8A 1EXFA 1PPHE 3KQCA 3B8JA 4I7YH 3RXRA 4HTCH 4E35A 1DUEA 4AC9A 2BDHA 1GVKB 3WWFA 1RTLA 2ZP0H 1HUTH 4JCNA 2BX4A 2BX3A 2FEQH 2BMGB 2B0FA 2FX4A 1G37A 3FO8D 1R6JA 1X5RA 3UREA 5JXBA 2PR3A 3UUZA 4ZHMU 5JBBS 1SGEE 2ZFPH 1GBCA 5FX5A 1LCYA 1IQEA 4YESB 4Y8XA 1CHGA 2DLUA 2A31A 1NPMA 1C5XB 2ZFSA 1SGFG 3BTHE 3U8OH 2F9VA 1CA8B 4P0CA 1W0KD 2W7UA 2ZPLA 1INCA 3PLPA 1GHBG 1YP9A 4NWKA 4TWYA 5HGGA 4YOIA 2JINA 4O3TA 1ZOKA 4J1YA 2UUFB 1F0TA 1YPHE 1O36A 2OC1A 2SGDE 2ZDAH 1MBMA 1IU2A 3E3TA 1QLCA 2OQ5A 4JOGA 4K8YA 1N7EA 2BLWA 2AMQA 3ZZ4A 1PPZA 3PWCA 4MPWA 4IC5A 4B1TA 3K6YA 4O3UA 2ESTE 4BTUB 3HATH 1GHAF 4FUHA 2WPLS 1YM0A 1UM1A 3SU4A 4OAJA 2AH4X 4CR9A 3P70B 5FL7D 1F0SA 4IMZA 4CBNA 1ZGIA 2FWWA 5FBEA 1UTPA 4BXWA 2F9NA 1O2YA 2ZGBH 4DVAU 2XXLA 2PKUA 2TGTA 1A5GH 1E36B 2UUJB 3F2FA 4BAQB 1MD7A 1VITH 1TQ0B 1QRXA 1ESTA 1BRBE 1OP2A 4OS7A 2DMZA 3A84A 2KAIB 3FP6E 4UFFH 2SGAA 2W26A 3LOXA 1A5HA 1KWAA 2Q6DA 4YOGA 2GZ9A 5DP8A 4VGCB 4ISHH 3WW7A 8LPRA 1DANH 1HRTH 1XUJA 3A7ZA 2TBSA 3RXFA 1BBRE 2JREA 3TK5A 1WFGA 3F2GA 4REYA 2ZU3A 3RXQA 1D6RA 1O2HA 1THPB 1TNHA 1C4V2 1KLJH 2ZCKP 1MAXA 2F91A 4INLA 3UOPA 2E7KA 3RLEA 3OSYA 3ZVDA 1C5VA 1YPKH 4Y0YE 1N7FA 1MKWH 2EDZA 3LPRA 5IYTA 2P3FH 1Q7XA 2LELA 4CH2B 2XWAA 1ZYOA 4YXWD 1W0ZU 1CGHA 5F6MA 2JILA 2L6OA 3FANA 1DICA 1QL7A 4WF8A 1DM4B 2WL7A 3OTJE 1DDJA 1VJ6A 3ODFA 4HG6A 4O06A 1C5OH 1Y59T 3GICB 3M3SA 3TNSA 2FN5A 2SGPE 4K78A 5KGOA 2JXOA 3NUMA 2DUCA 1FNIA 3K9XB 2M0TA 5HMAA 2XC0A 3PMHB 2BQWB 4ZMAH 5E21A 2LP6A 3Q76A 1WQVH 2P3WA 4Z8JA 2VZ5A 1X5QA 1GI1A 3MNXA 1WSSH 4F48B 4AX9H 4Y79A 2VWRA 4UU5A 4DY7B 4FVBA 3DSOA 4K8BA 3DFLA 1H1BA 5GWZA 1RGRA 1HB0B 1ZSJA 2W6ID 2J95A 5HKKD 3C27B 4HOPB 1YLNA 1DS2E 1Q3OA 4Q2PA 4JZFH 3QGLA 1O3GA 1RJXB 4DGJA 2AGGX 5F03A 1UF1A 2OSGA 4NMPA 3SV2H 4I31A 5PTPA 1LHEH 1IQKA 1YPMH 1NO9H 4CRGA 1X6DA 3VB7A 1FCFA 1AB9C 2I0LA 3SHUA 3P92A 4MNWA 1CSOE 2RRMA 3NGHA 4ZXXH 3G01A 1OP0A 1OBZA 3E16B 2NU2E 1BRAA 1D3DB 3TIUA 1P3EA 5C17A 4A1VA 5HYOA 3LC5A 5DP3A 1WTHD 2P8OC 3ELAH 4Q80A 3NK8A 5C5OA 1J8AA 1V2RT 3ZZBA 4F49A 3SU2A 3LNXA 1UEWA 2BD4A 2NU3E 1IQGA 1A1RA 1W3CA 3DT0H 1KDQA 4ZXYH 3SU5A 1YCPM 3CBYA 1L6OA 3A80A 1XVOA 4CRBA 4Q6SA 4UU6A 3PV4A 1O3PB 1TNLA 2JDID 2XBWA 2GZ7A 2ZG0H 3RXJA 2D2DA 1G9IE 2ZGCA 2ZHWH 1NRSH 5IL9A 2AEIH 2BZ6H 4E06H 3RXOA 1B7XB 3BTME 4TT3D 3CH8A 3RXHA 3LGVA 3RLYH 1ACBE 3NCVA 4N6XA 4THNH 1W7XH 2HE2A 1FN6A 3UTUH 2PGBB 3NFKA 4Y71A 1S6LA 2BDBA 1ZRBA 2WPDD 7GCHF 3NZIA 4DIIH 1IQJA 2ZDMA 2PNTA 1TX6A 2PKAB 2OP9A 2RDEA 3LH3A 4GVDA 4XSKU 3PWBA 5ETXA 3A85A 4NA9H 4MG3A 5TJXA 3PS4A 1TAWA 1TP3A 1UTNA 1BTXA 4D7GA 1O39A 1C1UH 8GCHG 4UFDH 1X9ZA 2YT8A 1T8LA 2H9TH 1P1EA 3UR9A 1X45A 1Z8JB 2IN2A 1P9UA 2BLVA 4ASHA 3R3GB 1UTMA 1T8MA 5EJ1A 1A0HB 5C1UA 1EJAA 1JRTA 3PMAB 4MTBA 2D1JA 1A4WH 4K69A 3BPUA 3V0XA 1AVGH 7KMEH 5AVDA 5DK1A 3CC0A 1F0RA 1QB6A 1T2MA 5E6PB 1TGNA 2V1WA 2EI6A 4G69A 2JETB 2Q6FA 3DA9B 3E0NB 4ABEA 2Z3CA 4AFSA 5B42A 1XUIA 1HLTH 5EW1H 3ZYEA 4Y7AA 2FI4E 3KZEA 1FPCH 1O3HA 2FCFA 4R0IA 4ZKNU 2LUIA 1X8SA 3DJ3A 3MNBA 5DO4H 5C5NA 1XX9A 4X1PU 2YMSD 1AMHA 2G8TA 3SU3A 2BD7A 1NF3C 4FU8A 4ACBA 1AWHB 1ELDE 3PLBA 3RXKA 2Y5HA 1FX0B 4ISNA 2W7SA 1GI3A 4TPIZ 1L4DA 4YZUA 1N1LA 1Y3WA 2PWXA 2XCNA 3LKWA 3UAIC 4RT1A 1QL8A 2FDAA 1SG8B 3S7HB 2PP6A 1N6EA 1BFEA 3GCOA 3GISB 2K8IA 5EQSA 4XFQA 2Z3DA 3S9CA 2QA9E 2Y80A 4OGYA 1SI5H 2VGCC 3RXMA 5H3JA 2V3HH 3F9EA 2OK5A 3MYWA 2VSVA 2G00A 1QB9A 2CN0H 2BVXH 2DKRA 1W14U 4FGMA 2F4LA 4AMHA 1YCPK 1UHBA 4ABDA 2KAWA 1C5MD 2PUQH 2AGEX 1BMFD 1ETTH 2HALA 1TPPA 2D8WA 2ZC9H 3PMBB 4NA7A 1XVMA 1SQRA 3E6PH 3CS7A 3HKJB 3AW0A 1GJ7B 2AMPA 2VWOA 3OEHD 1TRYA 1SQTA 1A3BH 2XBYA 1PDRA 4MNVA 4OEPA 1Z1JA 3RU4T 1TOMH 3A7YA 1VA8A 2LNCA 4JORA 1EJNA 2CHAB 3EQ0H 1UK4A 4UFGH 4FVDA 1WF7A 1C9TA 1BMMH 1O2TA 4DW2U 1GMCG 2BY8X 2QKVA 1QNJA 3KN2A 2HWLB 1HIAA 2AIQA 1OWIA 4BAKB 2QXIA 3SN8A 4FETA 1C5RA 5T6GA 2OLGA 2JKHA 4ZHAA 1BRCE 1WJLA 4XOJA 1ZTLA 2H1UA 1V2MT 4GPGA 1K1JA 1HAIH 5FCRA 4A92A 3GJ9A 2OQUA 2I4SA 2Q9VA 5E0GA 3A8BA 4LOYH 3UQOA 1OX1A 1LKAA 1CU1A 3TH3H 2I0IA 3H7OA 3RC6A 3ZV8A 2FM2A 4M7GA 4D8NA 4HOPA 5HEYA 1GJ8B 3M3TA 3A8DA 5JB8S 2ZTXA 4MNYA 1VCWA 1O2OA 4X2WA 1DSUA 1W10U 1V1TA 2QF0A 3AAVA 2FP7B 4NIXA 3BTQE 1XM1A 3SBKA 2GCHF 3P95A 3W1EA 1TP5A 1UCYH 2VH6A 3DFJA 3HVQC 4BOHA 1HCGA 3TK6A 1J15A 4CRAA 3GOVB 1ELEE 4Q2OA 1GL0E 3SGAE 1NFXA 3QDOA 1GG6C 3LGIA 4XBDA 2Y5GA 1GJDB 3ATLA 1GI0A 3PO1B 5EG4A 3SUFA 1RD3B 1K28D 1TGBA 1AN1E 1W11U 2VGCB 4I33A 4DCDA 1VITF 2R2WU 6GCHF 1FY4A 3AVZA 3OYPA 1VR1H 3STJA 1C5SA 5EIYA 2QKTA 5D13A 3K2UA 1F5KU 1D3TB 4X1RU 1FAKH 1MTVA 1GVLA 1EPTA 2KJKA 2YMSB 1Y3YA 1XKAC 3V7TA 1KYNA 1MKXK 1TE0A 1UTKA 4Y6DA 1HAYB 1C4Y2 2V0BA 3T62A 1WU1A 1FN8A 1N99A 2KCOA 2ANKH 3RXEA 3TSZA 1ZMLA 4CBOA 1C2HA 3Q00A 1TABE 3ITIA 3SUGA 1ELBA 4H42U 2UUKB
chains in the Genus database with same CATH topology
1LHFH 1SL3A 3GY4A 1S85A 1GJ6A 1K1IA 3KDKA 3MOCA 2O8LA 1O2ZA 4MPAA 1WAYB 1BIOA 3U69H 1DY9A 1ZPBA 1GBMA 1OBYA 3UNSA 1B8QA 4YM9A 1RY4A 2VIWA 4I8GA 3SOSA 1QBNA 3TJUA 4Q2QA 5K7RA 2W5EA 1HJAB 4HI3A 3PROA 3MMGA 1ABJH 3VFEA 1O2UA 5DP5A 1QB1A 1DFPA 3SV9A 2JWEA 4JOJA 1JIMA 1NFYA 3RXGA 4DOQA 2SNWA 3QGNB 6CHAC 3UQVA 2FYRA 4H6TA 1GI6A 2FLBH 4I8HA 2ZCLP 4AFUA 5C20A 4IC6A 1SB1H 1NU7B 1PYTC 1YGCH 1LMWB 2A2XH 2BD2A 1K1PA 3SHCH 4JJ3A 3SORA 2ALPA 2EJYA 1P9SA 4NFFA 4DIHH 2XC5A 1X7AC 1S0QA 1WQSA 1EP5A 1O2MA 2MX6A 3CBXA 1TBQH 2H3MA 1MTWA 1I92A 2EHRA 3SJ9A 2Q3GA 1A46H 1HAOH 1NESE 3JZ2B 4I8JA 1HAPH 2M5TA 1VCPA 1YPLH 1W13U 4LXBH 3BG4C 2YOLA 4SGBE 2Z9KA 1AHTH 1GDQA 1SHYA 2LPRA 2PSXA 1M9UA 4I8LA 3I1EA 2HPPH 3VXFH 1AVWA 4MPVA 1GG6B 4Q7ZA 5GJ4B 1Z71A 4WYUA 1ELAA 3FVFB 3M5MA 2AS9A 1V2VT 1Z87A 2OBQA 2VB0A 1BTUA 1CE5A 3SUZA 1C2JA 2D90A 1J17T 1FLEE 1GI4A 1O3NA 3A81A 4E7RG 1BTZA 1GBLA 1RGQA 1T8OA 3SGBE 1LO6A 1NS3A 1LHGH 1MTNC 2C8ZB 1S5SA 4ZROA 1P2IA 3PYHA 2X7ZA 2BHGA 3BTDE 4HFPB 3RP2A 2RDLA 2QG1A 1BA8B 3SU1A 2DJTA 2ZF0H 1GCTC 1XZ9A 3HGPA 2WUBA 3A8AA 3M7QA 2ZU1A 3T25A 3VB3A 3QJMA 3EA7A 4AFZA 2OS6A 2F9UA 3K65B 4MNXA 5LPEA 3QLPH 3EAJA 4B73A 1UVUH 2CF8H 1OOKB 5F67A 2TGPZ 4IW4E 3SQHE 1GJ9B 1HBTH 1ID5H 2QCYA 1TIOA 2XW9A 2RG3A 1LVYA 2C8WB 3URDA 2EC9H 3UY9A 1SFQB 1JWTA 1A7SA 4YOJA 2HGAA 3BSQA 2VPHA 2Z7FE 3BV9B 3RM2H 4X8SH 4LMMA 1KXAA 2HPQH 4Q6HA 1O3EA 2R0KA 4OS2A 2Q6GA 4JJ0A 1O3BA 3W95A 4XDEA 1TYNA 3BIUH 4A1XA 4J2YB 2Z9IA 3MU1A 4Y10E 3QE1A 4K5ZA 3CS0A 3BEFB 1O2RA 5DG6A 1FIZA 5F8TA 3Q77A 4UD9H 4RI0A 4K72A 1EAWA 2BQ6B 2B9LA 4K75A 4RKOB 1J16A 1HAVB 5I46H 1D3PB 4H6SB 3GDVA 2O8TA 4LZ1H 1WYKA 3R69A 2I04A 2PZDA 1HAZB 3ODDA 3MHWU 4GCHF 2RCZA 4TY6A 2OD3B 4JZ1A 4FUCA 1C4U2 1O2LA 1P10A 2ZDNA 4FUJA 4BTIB 5HFBA 1PPBH 1IQNA 2SFAA 4Y76A 3EA8A 1ZSKA 1DXPA 1UJVA 2ZHEH 1AD8H 4NMRA 2IOTA 3BG4B 2GZVA 3GDUA 1K32A 1V2PT 1ZPCA 1UMAH 4ZUHA 3ZVAA 4RN6A 2DM8A 2UWLA 1C5TA 2FE5A 3MH4A 1L0ZA 3L33A 1BBRK 3RU4E 2ZFFH 1P8VC 5TCAA 1DSTA 2VU8E 3I29A 1ELFA 9LPRA 5CHAB 2A0QB 2P3TB 1MMJN 1TBZH 4WH6A 4YLQH 1MZAA 1O0DH 1TNKA 1AWFH 3MO6A 1GHAG 3F9HA 1ZR