1UJUA

Solution structure of the fourth pdz domain of human scribble (kiaa0147 protein)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords scribble
publication title Solution structure of the fourth PDZ domain of human scribble (KIAA0147 protein)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ujuA00
5HDYA 1UJVA 2YTWA 4JOEA 3QIKA 3CH8A 2KBSA 1P1DA 4UU6A 2UZCA 1N7FA 1WF7A 2DM8A 4K76A 1V62A 4O06A 1B8QA 1PDRA 1V5QA 1FC7A 2K20A 4WYTA 1UM1A 3LNYA 1W9QA 1L6OA 5B6LA 3DJ1A 1TQ3A 2LA8A 5HFCA 2AWUA 4L8NA 2EDZA 5HFFA 4KFWA 1NTEA 2EEGA 4KFVA 4REYA 2EV8A 3PS4A 4N6XA 4GHNA 1X45A 1FC6A 2KRGA 5HETA 5HEYA 2MX6A 1OBXA 2QT5A 3QO6A 5F67A 4EDJA 3HVQC 4R2ZA 1WHAA 2HE4A 2OPGA 2LUIA 2M0TA 1V6BA 3DIWA 1WFVA 3EGGC 2QG1A 3O5NA 4NMTA 3NFKA 4NXRA 5G1EA 1Z86A 1M5ZA 2YT7A 1WG6A 3CBZA 3GGEA 1OBYA 1Q3OA 3HPMA 2KV8A 2ZPLA 4K72A 3ID3A 5FB8C 3TSZA 3TSWA 1WFGA 5I7ZA 1N7TA 2OZFA 3ID2A 2YUYA 2PKTA 3GDSA 2Z17A 4HOPB 2KJDA 2JXOA 1WH1A 4HOPA 2EAQA 2L4SA 2I0IA 1WIFA 1I16A 4Q2NA 4JOJA 4Z33A 2IWOA 1KY9A 1RGWA 4XHVA 1V1TA 2EXGA 4H11A 4JOGA 3SHUA 1WJLA 4Q6HA 4E35A 1TE0A 3QJNA 2CSSA 2KPKA 2CS5A 1Y8TA 2M10A 2L4TA 2PKUA 2JOAA 3OTPA 1Y7NA 2KA9A 2M3MA 4RI0A 2RRMA 3I4WA 3KZDA 1D5GA 2KOHA 4P0CA 3PV4A 3VQGA 2QKUA 2V90A 3WKMA 1KWAA 3K50A 2I04A 3OU0A 2FNEA 3RLEA 4K6YA 1UJUA 3MH6A 1VCWA 1UJDA 3CC0A 3MH4A 4Z8JA 1X8SA 1Z87A 3LNXA 2EEHA 2H2BA 2KJPA 2VPHA 2FE5A 4NMOA 2Q3GA 3PV2A 2LOBA 2OQSA 3SOEA 1TP3A 3CBXA 1X5RA 3AXAA 5EZ0A 1Q7XA 1KEFA 2CSJA 2DB5A 2HGAA 3DJ3A 4IC6A 5EYZA 5E21A 2AINA 2OCSA 2R3YA 2EDPA 2OMJA 4JOKA 5HFBA 1U38A 1WI4A 3ID1A 4F8KA 1VJ6A 2KOMA 1SOTA 2I4SA 3CS0A 2G5MB 2OSGA 1UFXA 4UU5A 2KL1A 1R6JA 3DORA 3R0HA 3EGHC 2KAWA 2AWWA 4AMHA 3DJAA 4NMSA 3GCNA 1U39A 2F5YA 2RCZA 1WHDA 3QJMA 2IWNA 3GDUA 4LMMA 3K1RA 4OAJA 2DKRA 2DLSA 2GZVA 5E22A 1W9OA 2EGKA 5HEBA 3PV5A 4JL7A 1QAVB 1QAVA 4G69A 1N6DA 1FC9A 2D90A 1N7EA 2EGNA 1MFGA 1UEZA 4NNMA 5HF1A 2H3LA 1K32A 2PA1A 2EHRA 2PZDA 1GQ5A 1U3BA 1XZ9A 1N99A 3K82A 4NMVA 2PDZA 4Q6SA 2KPLA 2JREA 2VRFA 3R68A 2OS6A 1Q3PA 1BFEA 2P3WA 5H3JA 5G1DA 2JIKA 2EEJA 2LC6A 3BPUA 2W7RA 5E6PB 2D8IA 3MH7A 3O46A 1N6FA 1GQ4A 2REYA 5A2PA 3FY5A 3GJ9A 1X5NA 1UITA 4JOFA 4NMRA 3PDZA 1BE9A 3RL7A 4NNLA 4YYXA 5F3XA 2QKVA 1IHJA 3RL8A 2VWRA 2IWQA 2KJKA 3VQFA 2E7KA 2G2LA 2IWPA 2ZPMA 3ID4A 2EGOA 4P2AB 2I1NA 1VAEA 5D13A 3TMHA 5HFDA 2D92A 1SOZA 2HE2A 2EDVA 3NFLA 4OEPA 3NGHA 2H2CA 2PNTA 3KZEA 5GLJA 3GDVA 2QKTA 5E11A 5DTHA 2OGPA 2QBWA 1VB7A 2M0VA 4NMPA 2I6VA 2KG2A 4Q2PA 1UF1A 3GSLA 1U37A 4NMQA 1UHPA 1WI2A 3SUZA 3GCOA 1N6EA 1T2MA 5FHTA 2MHOA 3SHWA 2YT8A 1TP5A 2V1WA 3I18A 5E1YA 2Z9IA 3KHFA 4NXQA 2LC7A 2KOJA 1ZUBA 3JXTA 4GVCA 1ZOKA 1LCYA 5HEDA 3ZRTA 2M0UA 3QDOA 4MPAA 2JWEA 1FCFA 1UEWA 2O2TA 1VA8A 4FGMA 2ENOA 3CYYA 1X6DA 2X7ZA 4Q2OA 2EJYA 1MFLA 1RY4A 2DMZA 1UEPA 4YDPA 4JOHA 1RZXA 4OEOA 1YBOA 2YUBA 2I0LA 4PQWA 2JINA 4GVDA 2DC2A 2WL7A 4JORA 2H3MA 5HJ1A 1MC7A 3PDVA 3HPKA 2F0AA 1GM1A 3QE1A 2VSVA 1V5LA 1OBZA 2BYGA 2DAZA 4K75A 2K1ZA 2FCFA 2VSPA 4E3BA 2DLUA 1I92A 4E34A 1QLCA 2JILA 1IU0A 3L4FD 2KYLA 2R4HA 1P1EA 3I1EA 4K78A 2W4FA 2AWXA 1OZIA 1UEQA 3WKLA 2VZ5A 4Q3HA 1W9EA 2M0ZA 2EEIA 3QGLA 5HF4A 1G9OA 3STJA 3SFJA 5JXBA 1RGRA 2Q9VA 3R69A 1IU2A 2FN5A 1WF8A 3E17A 1NF3C 3CBYA 3TSVA 4NXPA 4Q2QA 1QAUA 4WYUA 5GNDA 2KQFA 2DJTA 4JOPA 5HFEA 1X5QA 3B76A 2L97A 1UM7A
chains in the Genus database with same CATH superfamily
5HDYA 1UJVA 2YTWA 4JOEA 3QIKA 3CH8A 2KBSA 1P1DA 4UU6A 2UZCA 1N7FA 1WF7A 2DM8A 4K76A 1V62A 4O06A 1B8QA 1PDRA 1V5QA 1FC7A 2K20A 4WYTA 1UM1A 3LNYA 1W9QA 1L6OA 5B6LA 3DJ1A 1TQ3A 2LA8A 5HFCA 2AWUA 4L8NA 2EDZA 5HFFA 4KFWA 1NTEA 2EEGA 4KFVA 4REYA 2EV8A 3PS4A 4N6XA 4GHNA 1X45A 1FC6A 2KRGA 5HETA 5HEYA 2MX6A 1OBXA 2QT5A 3QO6A 5F67A 4EDJA 3HVQC 4R2ZA 1WHAA 2HE4A 2OPGA 2LUIA 2M0TA 1V6BA 3DIWA 1WFVA 3EGGC 2QG1A 3O5NA 4NMTA 3NFKA 4NXRA 5G1EA 1Z86A 1M5ZA 2YT7A 1WG6A 3CBZA 3GGEA 1OBYA 1Q3OA 3HPMA 2KV8A 2ZPLA 4K72A 3ID3A 5FB8C 3TSZA 3TSWA 1WFGA 5I7ZA 1N7TA 2OZFA 3ID2A 2YUYA 2PKTA 3GDSA 2Z17A 4HOPB 2KJDA 2JXOA 1WH1A 4HOPA 2EAQA 2L4SA 2I0IA 1WIFA 1I16A 4Q2NA 4JOJA 4Z33A 2IWOA 1KY9A 1RGWA 4XHVA 1V1TA 2EXGA 4H11A 4JOGA 3SHUA 1WJLA 4Q6HA 4E35A 1TE0A 3QJNA 2CSSA 2KPKA 2CS5A 1Y8TA 2M10A 2L4TA 2PKUA 2JOAA 3OTPA 1Y7NA 2KA9A 2M3MA 4RI0A 2RRMA 3KDKA 3I4WA 3KZDA 1D5GA 2KOHA 4P0CA 3PV4A 3VQGA 2QKUA 2V90A 3WKMA 1KWAA 3K50A 2I04A 3OU0A 2FNEA 3RLEA 4K6YA 1UJUA 3MH6A 1VCWA 1UJDA 3CC0A 3MH4A 4Z8JA 1X8SA 1Z87A 3LNXA 2EEHA 2H2BA 2KJPA 2VPHA 2FE5A 4NMOA 2JSNA 2Q3GA 3PV2A 2LOBA 5IL9A 2OQSA 3SOEA 1TP3A 3CBXA 1X5RA 3AXAA 5EZ0A 1Q7XA 1KEFA 2CSJA 2DB5A 2HGAA 3DJ3A 4IC6A 5EYZA 5E21A 2AINA 2OCSA 4JJ0A 2R3YA 3GABA 2EDPA 2OMJA 4JOKA 5HFBA 1U38A 1WI4A 3ID1A 4F8KA 1VJ6A 2KOMA 1SOTA 2I4SA 3CS0A 2G5MB 2OSGA 1UFXA 4UU5A 3KDGA 2KL1A 1R6JA 3DORA 3R0HA 3EGHC 2KAWA 2AWWA 4AMHA 3DJAA 5B42A 4NMSA 3GCNA 1U39A 2F5YA 5ILBA 2RCZA 1WHDA 3QJMA 2IWNA 3GDUA 4LMMA 3K1RA 4OAJA 2DKRA 2DLSA 2GZVA 5E22A 1W9OA 2EGKA 5HEBA 3PV5A 4JL7A 1QAVB 1QAVA 4G69A 1N6DA 1X9ZA 1FC9A 2D90A 1N7EA 2EGNA 1MFGA 1UEZA 4NNMA 5HF1A 2H3LA 1K32A 2PA1A 2EHRA 2PZDA 1GQ5A 1U3BA 1XZ9A 1N99A 3K82A 4NMVA 2PDZA 4Q6SA 2KPLA 2JREA 2VRFA 3R68A 2OS6A 1Q3PA 1BFEA 2P3WA 5H3JA 5G1DA 2JIKA 2EEJA 2LC6A 3BPUA 2W7RA 5E6PB 2D8IA 3MH7A 3O46A 1N6FA 1GQ4A 2REYA 5A2PA 3FY5A 3GJ9A 1X5NA 1UITA 4JOFA 4NMRA 3PDZA 1BE9A 3RL7A 4NNLA 4YYXA 5F3XA 2QKVA 1IHJA 3RL8A 2VWRA 2IWQA 2KJKA 3VQFA 2E7KA 2G2LA 2IWPA 2ZPMA 3ID4A 2EGOA 4P2AB 2I1NA 1VAEA 5D13A 3TMHA 5HFDA 2D92A 1SOZA 2HE2A 2EDVA 4FLNA 3NFLA 4OEPA 3NGHA 2H2CA 2PNTA 3KZEA 5GLJA 3GDVA 4JJ3A 2QKTA 5E11A 5DTHA 2OGPA 2QBWA 1VB7A 2M0VA 4NMPA 2I6VA 2KG2A 4Q2PA 1UF1A 3GSLA 1U37A 4NMQA 1UHPA 1WI2A 3SUZA 3GCOA 1N6EA 1T2MA 5FHTA 2MHOA 3SHWA 2YT8A 1TP5A 2V1WA 3I18A 5E1YA 2Z9IA 3KHFA 4NXQA 2LC7A 2KOJA 1ZUBA 3JXTA 4GVCA 1ZOKA 1LCYA 5HEDA 3ZRTA 2M0UA 3QDOA 4MPAA 2JWEA 1FCFA 1UEWA 2O2TA 1VA8A 4FGMA 2ENOA 3CYYA 3NCVA 1X6DA 2X7ZA 4Q2OA 2EJYA 1MFLA 1RY4A 2DMZA 1UEPA 4YDPA 4JOHA 1RZXA 4OEOA 1YBOA 2YUBA 2I0LA 4PQWA 2JINA 4GVDA 2DC2A 2WL7A 4JORA 2H3MA 5HJ1A 1MC7A 3PDVA 3HPKA 2F0AA 1GM1A 3QE1A 2VSVA 1V5LA 1OBZA 2BYGA 2DAZA 4K75A 2K1ZA 2FCFA 2VSPA 4E3BA 2DLUA 1I92A 4E34A 1QLCA 2JILA 2GEFA 1IU0A 3L4FD 2KYLA 2R4HA 1P1EA 3I1EA 4K78A 2W4FA 2AWXA 1OZIA 1UEQA 3WKLA 2VZ5A 4Q3HA 1W9EA 2M0ZA 2EEIA 3QGLA 5HF4A 1G9OA 3STJA 3SFJA 5JXBA 1RGRA 2Q9VA 3R69A 1IU2A 2FN5A 1WF8A 3E17A 1NF3C 3CBYA 3TSVA 4NXPA 4Q2QA 1QAUA 4WYUA 5GNDA 2KQFA 2DJTA 4JOPA 5HFEA 1X5QA 3B76A 2L97A 1UM7A
chains in the Genus database with same CATH topology
5HDYA 1UJVA 2YTWA 4JOEA 3QIKA 3CH8A 2KBSA 1P1DA 4UU6A 2UZCA 1N7FA 1WF7A 2DM8A 4K76A 1V62A 4O06A 1B8QA 1PDRA 1V5QA 1FC7A 2K20A 4WYTA 1UM1A 3LNYA 1W9QA 1L6OA 5B6LA 3DJ1A 1TQ3A 2LA8A 5HFCA 2AWUA 4L8NA 2EDZA 5HFFA 4KFWA 1NTEA 2EEGA 4KFVA 4REYA 2EV8A 3PS4A 4N6XA 4GHNA 1X45A 1FC6A 2KRGA 5HETA 5HEYA 2MX6A 1OBXA 2QT5A 3QO6A 5F67A 4EDJA 3HVQC 4R2ZA 1WHAA 2HE4A 2OPGA 2LUIA 2M0TA 1V6BA 3DIWA 1WFVA 3EGGC 2QG1A 3O5NA 4NMTA 3NFKA 4NXRA 5G1EA 1Z86A 1M5ZA 2YT7A 1WG6A 3CBZA 3GGEA 1OBYA 1Q3OA 3HPMA 2KV8A 2ZPLA 4K72A 3ID3A 5FB8C 3TSZA 3TSWA 1WFGA 5I7ZA 1N7TA 2OZFA 3ID2A 2YUYA 2PKTA 3GDSA 2Z17A 4HOPB 2KJDA 2JXOA 1WH1A 4HOPA 2EAQA 2L4SA 2I0IA 1WIFA 1I16A 4Q2NA 4JOJA 4Z33A 2IWOA 1KY9A 1RGWA 4XHVA 1V1TA 2EXGA 4H11A 4JOGA 3SHUA 1WJLA 4Q6HA 4E35A 1TE0A 3QJNA 2CSSA 2KPKA 2CS5A 1Y8TA 2M10A 2L4TA 2PKUA 2JOAA 3OTPA 1Y7NA 2KA9A 2M3MA 4RI0A 2RRMA 3KDKA 3I4WA 3KZDA 1D5GA 2KOHA 4P0CA 3PV4A 3VQGA 2QKUA 2V90A 3WKMA 1KWAA 3K50A 2I04A 3OU0A 2FNEA 3RLEA 4K6YA 1UJUA 3MH6A 1VCWA 1UJDA 3CC0A 3MH4A 4Z8JA 1X8SA 1Z87A 3LNXA 2EEHA 2H2BA 2KJPA 2VPHA 2FE5A 4NMOA 2JSNA 2Q3GA 3PV2A 2LOBA 5IL9A 2OQSA 3SOEA 1TP3A 3CBXA 1X5RA 3AXAA 5EZ0A 1Q7XA 1KEFA 2CSJA 2DB5A 2HGAA 3DJ3A 4IC6A 5EYZA 5E21A 2AINA 2OCSA 4JJ0A 2R3YA 3GABA 2EDPA 2OMJA 4JOKA 5HFBA 1U38A 1WI4A 3ID1A 4F8KA 1VJ6A 2KOMA 1SOTA 2I4SA 3CS0A 2G5MB 2OSGA 1UFXA 4UU5A 3KDGA 2KL1A 1R6JA 3DORA 3R0HA 3EGHC 2KAWA 2AWWA 4AMHA 3DJAA 5B42A 4NMSA 3GCNA 1U39A 2F5YA 5ILBA 2RCZA 1WHDA 3QJMA 2IWNA 3GDUA 4LMMA 3K1RA 4OAJA 2DKRA 2DLSA 2GZVA 5E22A 1W9OA 2EGKA 5HEBA 3PV5A 4JL7A 1QAVB 1QAVA 4G69A 1N6DA 1X9ZA 1FC9A 2D90A 1N7EA 2EGNA 1MFGA 1UEZA 4NNMA 5HF1A 2H3LA 1K32A 2PA1A 2EHRA 2PZDA 1GQ5A 1U3BA 1XZ9A 1N99A 3K82A 4NMVA 2PDZA 4Q6SA 2KPLA 2JREA 2VRFA 3R68A 2OS6A 1Q3PA 1BFEA 2P3WA 5H3JA 5G1DA 2JIKA 2EEJA 2LC6A 3BPUA 2W7RA 5E6PB 2D8IA 3MH7A 3O46A 1N6FA 1GQ4A 2REYA 5A2PA 3FY5A 3GJ9A 1X5NA 1UITA 4JOFA 4NMRA 3PDZA 1BE9A 3RL7A 4NNLA 4YYXA 5F3XA 2QKVA 1IHJA 3RL8A 2VWRA 2IWQA 2KJKA 3VQFA 2E7KA 2G2LA 2IWPA 2ZPMA 3ID4A 2EGOA 4P2AB 2I1NA 1VAEA 5D13A 3TMHA 5HFDA 2D92A 1SOZA 2HE2A 2EDVA 4FLNA 3NFLA 4OEPA 3NGHA 2H2CA 2PNTA 3KZEA 5GLJA 3GDVA 4JJ3A 2QKTA 5E11A 5DTHA 2OGPA 2QBWA 1VB7A 2M0VA 4NMPA 2I6VA 2KG2A 4Q2PA 1UF1A 3GSLA 1U37A 4NMQA 1UHPA 1WI2A 3SUZA 3GCOA 1N6EA 1T2MA 5FHTA 2MHOA 3SHWA 2YT8A 1TP5A 2V1WA 3I18A 5E1YA 2Z9IA 3KHFA 4NXQA 2LC7A 2KOJA 1ZUBA 3JXTA 4GVCA 1ZOKA 1LCYA 5HEDA 3ZRTA 2M0UA 3QDOA 4MPAA 2JWEA 1FCFA 1UEWA 2O2TA 1VA8A 4FGMA 2ENOA 3CYYA 3NCVA 1X6DA 2X7ZA 4Q2OA 2EJYA 1MFLA 1RY4A 2DMZA 1UEPA 4YDPA 4JOHA 1RZXA 4OEOA 1YBOA 2YUBA 2I0LA 4PQWA 2JINA 4GVDA 2DC2A 2WL7A 4JORA 2H3MA 5HJ1A 1MC7A 3PDVA 3HPKA 2F0AA 1GM1A 3QE1A 2VSVA 1V5LA 1OBZA 2BYGA 2DAZA 4K75A 2K1ZA 2FCFA 2VSPA 4E3BA 2DLUA 1I92A 4E34A 1QLCA 2JILA 2GEFA 1IU0A 3L4FD 2KYLA 2R4HA 1P1EA 3I1EA 4K78A 2W4FA 2AWXA 1OZIA 1UEQA 3WKLA 2VZ5A 4Q3HA 1W9EA 2M0ZA 2EEIA 3QGLA 5HF4A 1G9OA 3STJA 3SFJA 5JXBA 1RGRA 2Q9VA 3R69A 1IU2A 2FN5A 1WF8A 3E17A 1NF3C 3CBYA 3TSVA 4NXPA 4Q2QA 1QAUA 4WYUA 5GNDA 2KQFA 2DJTA 4JOPA 5HFEA 1X5QA 3B76A 2L97A 1UM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDY A;  1UJV A;  2YTW A;  4JOE A;  3QIK A;  3CH8 A;  2KBS A;  1P1D A;  4UU6 A;  2UZC A;  1N7F A;  1WF7 A;  2DM8 A;  4K76 A;  1V62 A;  4O06 A;  1B8Q A;  1PDR A;  1V5Q A;  1FC7 A;  2K20 A;  4WYT A;  1UM1 A;  3LNY A;  1W9Q A;  1L6O A;  5B6L A;  3DJ1 A;  1TQ3 A;  2LA8 A;  5HFC A;  2AWU A;  4L8N A;  2EDZ A;  5HFF A;  4KFW A;  1NTE A;  2EEG A;  4KFV A;  4REY A;  2EV8 A;  3PS4 A;  4N6X A;  4GHN A;  1X45 A;  1FC6 A;  2KRG A;  5HET A;  5HEY A;  2MX6 A;  1OBX A;  2QT5 A;  3QO6 A;  5F67 A;  4EDJ A;  3HVQ C;  4R2Z A;  1WHA A;  2HE4 A;  2OPG A;  2LUI A;  2M0T A;  1V6B A;  3DIW A;  1WFV A;  3EGG C;  2QG1 A;  3O5N A;  4NMT A;  3NFK A;  4NXR A;  5G1E A;  1Z86 A;  1M5Z A;  2YT7 A;  1WG6 A;  3CBZ A;  3GGE A;  1OBY A;  1Q3O A;  3HPM A;  2KV8 A;  2ZPL A;  4K72 A;  3ID3 A;  5FB8 C;  3TSZ A;  3TSW A;  1WFG A;  5I7Z A;  1N7T A;  2OZF A;  3ID2 A;  2YUY A;  2PKT A;  3GDS A;  2Z17 A;  4HOP B;  2KJD A;  2JXO A;  1WH1 A;  4HOP A;  2EAQ A;  2L4S A;  2I0I A;  1WIF A;  1I16 A;  4Q2N A;  4JOJ A;  4Z33 A;  2IWO A;  1KY9 A;  1RGW A;  4XHV A;  1V1T A;  2EXG A;  4H11 A;  4JOG A;  3SHU A;  1WJL A;  4Q6H A;  4E35 A;  1TE0 A;  3QJN A;  2CSS A;  2KPK A;  2CS5 A;  1Y8T A;  2M10 A;  2L4T A;  2PKU A;  2JOA A;  3OTP A;  1Y7N A;  2KA9 A;  2M3M A;  4RI0 A;  2RRM A;  3I4W A;  3KZD A;  1D5G A;  2KOH A;  4P0C A;  3PV4 A;  3VQG A;  2QKU A;  2V90 A;  3WKM A;  1KWA A;  3K50 A;  2I04 A;  3OU0 A;  2FNE A;  3RLE A;  4K6Y A;  1UJU A;  3MH6 A;  1VCW A;  1UJD A;  3CC0 A;  3MH4 A;  4Z8J A;  1X8S A;  1Z87 A;  3LNX A;  2EEH A;  2H2B A;  2KJP A;  2VPH A;  2FE5 A;  4NMO A;  2Q3G A;  3PV2 A;  2LOB A;  2OQS A;  3SOE A;  1TP3 A;  3CBX A;  1X5R A;  3AXA A;  5EZ0 A;  1Q7X A;  1KEF A;  2CSJ A;  2DB5 A;  2HGA A;  3DJ3 A;  4IC6 A;  5EYZ A;  5E21 A;  2AIN A;  2OCS A;  2R3Y A;  2EDP A;  2OMJ A;  4JOK A;  5HFB A;  1U38 A;  1WI4 A;  3ID1 A;  4F8K A;  1VJ6 A;  2KOM A;  1SOT A;  2I4S A;  3CS0 A;  2G5M B;  2OSG A;  1UFX A;  4UU5 A;  2KL1 A;  1R6J A;  3DOR A;  3R0H A;  3EGH C;  2KAW A;  2AWW A;  4AMH A;  3DJA A;  4NMS A;  3GCN A;  1U39 A;  2F5Y A;  2RCZ A;  1WHD A;  3QJM A;  2IWN A;  3GDU A;  4LMM A;  3K1R A;  4OAJ A;  2DKR A;  2DLS A;  2GZV A;  5E22 A;  1W9O A;  2EGK A;  5HEB A;  3PV5 A;  4JL7 A;  1QAV B;  1QAV A;  4G69 A;  1N6D A;  1FC9 A;  2D90 A;  1N7E A;  2EGN A;  1MFG A;  1UEZ A;  4NNM A;  5HF1 A;  2H3L A;  1K32 A;  2PA1 A;  2EHR A;  2PZD A;  1GQ5 A;  1U3B A;  1XZ9 A;  1N99 A;  3K82 A;  4NMV A;  2PDZ A;  4Q6S A;  2KPL A;  2JRE A;  2VRF A;  3R68 A;  2OS6 A;  1Q3P A;  1BFE A;  2P3W A;  5H3J A;  5G1D A;  2JIK A;  2EEJ A;  2LC6 A;  3BPU A;  2W7R A;  5E6P B;  2D8I A;  3MH7 A;  3O46 A;  1N6F A;  1GQ4 A;  2REY A;  5A2P A;  3FY5 A;  3GJ9 A;  1X5N A;  1UIT A;  4JOF A;  4NMR A;  3PDZ A;  1BE9 A;  3RL7 A;  4NNL A;  4YYX A;  5F3X A;  2QKV A;  1IHJ A;  3RL8 A;  2VWR A;  2IWQ A;  2KJK A;  3VQF A;  2E7K A;  2G2L A;  2IWP A;  2ZPM A;  3ID4 A;  2EGO A;  4P2A B;  2I1N A;  1VAE A;  5D13 A;  3TMH A;  5HFD A;  2D92 A;  1SOZ A;  2HE2 A;  2EDV A;  3NFL A;  4OEP A;  3NGH A;  2H2C A;  2PNT A;  3KZE A;  5GLJ A;  3GDV A;  2QKT A;  5E11 A;  5DTH A;  2OGP A;  2QBW A;  1VB7 A;  2M0V A;  4NMP A;  2I6V A;  2KG2 A;  4Q2P A;  1UF1 A;  3GSL A;  1U37 A;  4NMQ A;  1UHP A;  1WI2 A;  3SUZ A;  3GCO A;  1N6E A;  1T2M A;  5FHT A;  2MHO A;  3SHW A;  2YT8 A;  1TP5 A;  2V1W A;  3I18 A;  5E1Y A;  2Z9I A;  3KHF A;  4NXQ A;  2LC7 A;  2KOJ A;  1ZUB A;  3JXT A;  4GVC A;  1ZOK A;  1LCY A;  5HED A;  3ZRT A;  2M0U A;  3QDO A;  4MPA A;  2JWE A;  1FCF A;  1UEW A;  2O2T A;  1VA8 A;  4FGM A;  2ENO A;  3CYY A;  1X6D A;  2X7Z A;  4Q2O A;  2EJY A;  1MFL A;  1RY4 A;  2DMZ A;  1UEP A;  4YDP A;  4JOH A;  1RZX A;  4OEO A;  1YBO A;  2YUB A;  2I0L A;  4PQW A;  2JIN A;  4GVD A;  2DC2 A;  2WL7 A;  4JOR A;  2H3M A;  5HJ1 A;  1MC7 A;  3PDV A;  3HPK A;  2F0A A;  1GM1 A;  3QE1 A;  2VSV A;  1V5L A;  1OBZ A;  2BYG A;  2DAZ A;  4K75 A;  2K1Z A;  2FCF A;  2VSP A;  4E3B A;  2DLU A;  1I92 A;  4E34 A;  1QLC A;  2JIL A;  1IU0 A;  3L4F D;  2KYL A;  2R4H A;  1P1E A;  3I1E A;  4K78 A;  2W4F A;  2AWX A;  1OZI A;  1UEQ A;  3WKL A;  2VZ5 A;  4Q3H A;  1W9E A;  2M0Z A;  2EEI A;  3QGL A;  5HF4 A;  1G9O A;  3STJ A;  3SFJ A;  5JXB A;  1RGR A;  2Q9V A;  3R69 A;  1IU2 A;  2FN5 A;  1WF8 A;  3E17 A;  1NF3 C;  3CBY A;  3TSV A;  4NXP A;  4Q2Q A;  1QAU A;  4WYU A;  5GND A;  2KQF A;  2DJT A;  4JOP A;  5HFE A;  1X5Q A;  3B76 A;  2L97 A;  1UM7 A; 
#chains in the Genus database with same CATH topology
 5HDY A;  1UJV A;  2YTW A;  4JOE A;  3QIK A;  3CH8 A;  2KBS A;  1P1D A;  4UU6 A;  2UZC A;  1N7F A;  1WF7 A;  2DM8 A;  4K76 A;  1V62 A;  4O06 A;  1B8Q A;  1PDR A;  1V5Q A;  1FC7 A;  2K20 A;  4WYT A;  1UM1 A;  3LNY A;  1W9Q A;  1L6O A;  5B6L A;  3DJ1 A;  1TQ3 A;  2LA8 A;  5HFC A;  2AWU A;  4L8N A;  2EDZ A;  5HFF A;  4KFW A;  1NTE A;  2EEG A;  4KFV A;  4REY A;  2EV8 A;  3PS4 A;  4N6X A;  4GHN A;  1X45 A;  1FC6 A;  2KRG A;  5HET A;  5HEY A;  2MX6 A;  1OBX A;  2QT5 A;  3QO6 A;  5F67 A;  4EDJ A;  3HVQ C;  4R2Z A;  1WHA A;  2HE4 A;  2OPG A;  2LUI A;  2M0T A;  1V6B A;  3DIW A;  1WFV A;  3EGG C;  2QG1 A;  3O5N A;  4NMT A;  3NFK A;  4NXR A;  5G1E A;  1Z86 A;  1M5Z A;  2YT7 A;  1WG6 A;  3CBZ A;  3GGE A;  1OBY A;  1Q3O A;  3HPM A;  2KV8 A;  2ZPL A;  4K72 A;  3ID3 A;  5FB8 C;  3TSZ A;  3TSW A;  1WFG A;  5I7Z A;  1N7T A;  2OZF A;  3ID2 A;  2YUY A;  2PKT A;  3GDS A;  2Z17 A;  4HOP B;  2KJD A;  2JXO A;  1WH1 A;  4HOP A;  2EAQ A;  2L4S A;  2I0I A;  1WIF A;  1I16 A;  4Q2N A;  4JOJ A;  4Z33 A;  2IWO A;  1KY9 A;  1RGW A;  4XHV A;  1V1T A;  2EXG A;  4H11 A;  4JOG A;  3SHU A;  1WJL A;  4Q6H A;  4E35 A;  1TE0 A;  3QJN A;  2CSS A;  2KPK A;  2CS5 A;  1Y8T A;  2M10 A;  2L4T A;  2PKU A;  2JOA A;  3OTP A;  1Y7N A;  2KA9 A;  2M3M A;  4RI0 A;  2RRM A;  3KDK A;  3I4W A;  3KZD A;  1D5G A;  2KOH A;  4P0C A;  3PV4 A;  3VQG A;  2QKU A;  2V90 A;  3WKM A;  1KWA A;  3K50 A;  2I04 A;  3OU0 A;  2FNE A;  3RLE A;  4K6Y A;  1UJU A;  3MH6 A;  1VCW A;  1UJD A;  3CC0 A;  3MH4 A;  4Z8J A;  1X8S A;  1Z87 A;  3LNX A;  2EEH A;  2H2B A;  2KJP A;  2VPH A;  2FE5 A;  4NMO A;  2JSN A;  2Q3G A;  3PV2 A;  2LOB A;  5IL9 A;  2OQS A;  3SOE A;  1TP3 A;  3CBX A;  1X5R A;  3AXA A;  5EZ0 A;  1Q7X A;  1KEF A;  2CSJ A;  2DB5 A;  2HGA A;  3DJ3 A;  4IC6 A;  5EYZ A;  5E21 A;  2AIN A;  2OCS A;  4JJ0 A;  2R3Y A;  3GAB A;  2EDP A;  2OMJ A;  4JOK A;  5HFB A;  1U38 A;  1WI4 A;  3ID1 A;  4F8K A;  1VJ6 A;  2KOM A;  1SOT A;  2I4S A;  3CS0 A;  2G5M B;  2OSG A;  1UFX A;  4UU5 A;  3KDG A;  2KL1 A;  1R6J A;  3DOR A;  3R0H A;  3EGH C;  2KAW A;  2AWW A;  4AMH A;  3DJA A;  5B42 A;  4NMS A;  3GCN A;  1U39 A;  2F5Y A;  5ILB A;  2RCZ A;  1WHD A;  3QJM A;  2IWN A;  3GDU A;  4LMM A;  3K1R A;  4OAJ A;  2DKR A;  2DLS A;  2GZV A;  5E22 A;  1W9O A;  2EGK A;  5HEB A;  3PV5 A;  4JL7 A;  1QAV B;  1QAV A;  4G69 A;  1N6D A;  1X9Z A;  1FC9 A;  2D90 A;  1N7E A;  2EGN A;  1MFG A;  1UEZ A;  4NNM A;  5HF1 A;  2H3L A;  1K32 A;  2PA1 A;  2EHR A;  2PZD A;  1GQ5 A;  1U3B A;  1XZ9 A;  1N99 A;  3K82 A;  4NMV A;  2PDZ A;  4Q6S A;  2KPL A;  2JRE A;  2VRF A;  3R68 A;  2OS6 A;  1Q3P A;  1BFE A;  2P3W A;  5H3J A;  5G1D A;  2JIK A;  2EEJ A;  2LC6 A;  3BPU A;  2W7R A;  5E6P B;  2D8I A;  3MH7 A;  3O46 A;  1N6F A;  1GQ4 A;  2REY A;  5A2P A;  3FY5 A;  3GJ9 A;  1X5N A;  1UIT A;  4JOF A;  4NMR A;  3PDZ A;  1BE9 A;  3RL7 A;  4NNL A;  4YYX A;  5F3X A;  2QKV A;  1IHJ A;  3RL8 A;  2VWR A;  2IWQ A;  2KJK A;  3VQF A;  2E7K A;  2G2L A;  2IWP A;  2ZPM A;  3ID4 A;  2EGO A;  4P2A B;  2I1N A;  1VAE A;  5D13 A;  3TMH A;  5HFD A;  2D92 A;  1SOZ A;  2HE2 A;  2EDV A;  4FLN A;  3NFL A;  4OEP A;  3NGH A;  2H2C A;  2PNT A;  3KZE A;  5GLJ A;  3GDV A;  4JJ3 A;  2QKT A;  5E11 A;  5DTH A;  2OGP A;  2QBW A;  1VB7 A;  2M0V A;  4NMP A;  2I6V A;  2KG2 A;  4Q2P A;  1UF1 A;  3GSL A;  1U37 A;  4NMQ A;  1UHP A;  1WI2 A;  3SUZ A;  3GCO A;  1N6E A;  1T2M A;  5FHT A;  2MHO A;  3SHW A;  2YT8 A;  1TP5 A;  2V1W A;  3I18 A;  5E1Y A;  2Z9I A;  3KHF A;  4NXQ A;  2LC7 A;  2KOJ A;  1ZUB A;  3JXT A;  4GVC A;  1ZOK A;  1LCY A;  5HED A;  3ZRT A;  2M0U A;  3QDO A;  4MPA A;  2JWE A;  1FCF A;  1UEW A;  2O2T A;  1VA8 A;  4FGM A;  2ENO A;  3CYY A;  3NCV A;  1X6D A;  2X7Z A;  4Q2O A;  2EJY A;  1MFL A;  1RY4 A;  2DMZ A;  1UEP A;  4YDP A;  4JOH A;  1RZX A;  4OEO A;  1YBO A;  2YUB A;  2I0L A;  4PQW A;  2JIN A;  4GVD A;  2DC2 A;  2WL7 A;  4JOR A;  2H3M A;  5HJ1 A;  1MC7 A;  3PDV A;  3HPK A;  2F0A A;  1GM1 A;  3QE1 A;  2VSV A;  1V5L A;  1OBZ A;  2BYG A;  2DAZ A;  4K75 A;  2K1Z A;  2FCF A;  2VSP A;  4E3B A;  2DLU A;  1I92 A;  4E34 A;  1QLC A;  2JIL A;  2GEF A;  1IU0 A;  3L4F D;  2KYL A;  2R4H A;  1P1E A;  3I1E A;  4K78 A;  2W4F A;  2AWX A;  1OZI A;  1UEQ A;  3WKL A;  2VZ5 A;  4Q3H A;  1W9E A;  2M0Z A;  2EEI A;  3QGL A;  5HF4 A;  1G9O A;  3STJ A;  3SFJ A;  5JXB A;  1RGR A;  2Q9V A;  3R69 A;  1IU2 A;  2FN5 A;  1WF8 A;  3E17 A;  1NF3 C;  3CBY A;  3TSV A;  4NXP A;  4Q2Q A;  1QAU A;  4WYU A;  5GND A;  2KQF A;  2DJT A;  4JOP A;  5HFE A;  1X5Q A;  3B76 A;  2L97 A;  1UM7 A; 
#chains in the Genus database with same CATH homology
 5HDY A;  1UJV A;  2YTW A;  4JOE A;  3QIK A;  3CH8 A;  2KBS A;  1P1D A;  4UU6 A;  2UZC A;  1N7F A;  1WF7 A;  2DM8 A;  4K76 A;  1V62 A;  4O06 A;  1B8Q A;  1PDR A;  1V5Q A;  1FC7 A;  2K20 A;  4WYT A;  1UM1 A;  3LNY A;  1W9Q A;  1L6O A;  5B6L A;  3DJ1 A;  1TQ3 A;  2LA8 A;  5HFC A;  2AWU A;  4L8N A;  2EDZ A;  5HFF A;  4KFW A;  1NTE A;  2EEG A;  4KFV A;  4REY A;  2EV8 A;  3PS4 A;  4N6X A;  4GHN A;  1X45 A;  1FC6 A;  2KRG A;  5HET A;  5HEY A;  2MX6 A;  1OBX A;  2QT5 A;  3QO6 A;  5F67 A;  4EDJ A;  3HVQ C;  4R2Z A;  1WHA A;  2HE4 A;  2OPG A;  2LUI A;  2M0T A;  1V6B A;  3DIW A;  1WFV A;  3EGG C;  2QG1 A;  3O5N A;  4NMT A;  3NFK A;  4NXR A;  5G1E A;  1Z86 A;  1M5Z A;  2YT7 A;  1WG6 A;  3CBZ A;  3GGE A;  1OBY A;  1Q3O A;  3HPM A;  2KV8 A;  2ZPL A;  4K72 A;  3ID3 A;  5FB8 C;  3TSZ A;  3TSW A;  1WFG A;  5I7Z A;  1N7T A;  2OZF A;  3ID2 A;  2YUY A;  2PKT A;  3GDS A;  2Z17 A;  4HOP B;  2KJD A;  2JXO A;  1WH1 A;  4HOP A;  2EAQ A;  2L4S A;  2I0I A;  1WIF A;  1I16 A;  4Q2N A;  4JOJ A;  4Z33 A;  2IWO A;  1KY9 A;  1RGW A;  4XHV A;  1V1T A;  2EXG A;  4H11 A;  4JOG A;  3SHU A;  1WJL A;  4Q6H A;  4E35 A;  1TE0 A;  3QJN A;  2CSS A;  2KPK A;  2CS5 A;  1Y8T A;  2M10 A;  2L4T A;  2PKU A;  2JOA A;  3OTP A;  1Y7N A;  2KA9 A;  2M3M A;  4RI0 A;  2RRM A;  3KDK A;  3I4W A;  3KZD A;  1D5G A;  2KOH A;  4P0C A;  3PV4 A;  3VQG A;  2QKU A;  2V90 A;  3WKM A;  1KWA A;  3K50 A;  2I04 A;  3OU0 A;  2FNE A;  3RLE A;  4K6Y A;  1UJU A;  3MH6 A;  1VCW A;  1UJD A;  3CC0 A;  3MH4 A;  4Z8J A;  1X8S A;  1Z87 A;  3LNX A;  2EEH A;  2H2B A;  2KJP A;  2VPH A;  2FE5 A;  4NMO A;  2JSN A;  2Q3G A;  3PV2 A;  2LOB A;  5IL9 A;  2OQS A;  3SOE A;  1TP3 A;  3CBX A;  1X5R A;  3AXA A;  5EZ0 A;  1Q7X A;  1KEF A;  2CSJ A;  2DB5 A;  2HGA A;  3DJ3 A;  4IC6 A;  5EYZ A;  5E21 A;  2AIN A;  2OCS A;  4JJ0 A;  2R3Y A;  3GAB A;  2EDP A;  2OMJ A;  4JOK A;  5HFB A;  1U38 A;  1WI4 A;  3ID1 A;  4F8K A;  1VJ6 A;  2KOM A;  1SOT A;  2I4S A;  3CS0 A;  2G5M B;  2OSG A;  1UFX A;  4UU5 A;  3KDG A;  2KL1 A;  1R6J A;  3DOR A;  3R0H A;  3EGH C;  2KAW A;  2AWW A;  4AMH A;  3DJA A;  5B42 A;  4NMS A;  3GCN A;  1U39 A;  2F5Y A;  5ILB A;  2RCZ A;  1WHD A;  3QJM A;  2IWN A;  3GDU A;  4LMM A;  3K1R A;  4OAJ A;  2DKR A;  2DLS A;  2GZV A;  5E22 A;  1W9O A;  2EGK A;  5HEB A;  3PV5 A;  4JL7 A;  1QAV B;  1QAV A;  4G69 A;  1N6D A;  1X9Z A;  1FC9 A;  2D90 A;  1N7E A;  2EGN A;  1MFG A;  1UEZ A;  4NNM A;  5HF1 A;  2H3L A;  1K32 A;  2PA1 A;  2EHR A;  2PZD A;  1GQ5 A;  1U3B A;  1XZ9 A;  1N99 A;  3K82 A;  4NMV A;  2PDZ A;  4Q6S A;  2KPL A;  2JRE A;  2VRF A;  3R68 A;  2OS6 A;  1Q3P A;  1BFE A;  2P3W A;  5H3J A;  5G1D A;  2JIK A;  2EEJ A;  2LC6 A;  3BPU A;  2W7R A;  5E6P B;  2D8I A;  3MH7 A;  3O46 A;  1N6F A;  1GQ4 A;  2REY A;  5A2P A;  3FY5 A;  3GJ9 A;  1X5N A;  1UIT A;  4JOF A;  4NMR A;  3PDZ A;  1BE9 A;  3RL7 A;  4NNL A;  4YYX A;  5F3X A;  2QKV A;  1IHJ A;  3RL8 A;  2VWR A;  2IWQ A;  2KJK A;  3VQF A;  2E7K A;  2G2L A;  2IWP A;  2ZPM A;  3ID4 A;  2EGO A;  4P2A B;  2I1N A;  1VAE A;  5D13 A;  3TMH A;  5HFD A;  2D92 A;  1SOZ A;  2HE2 A;  2EDV A;  4FLN A;  3NFL A;  4OEP A;  3NGH A;  2H2C A;  2PNT A;  3KZE A;  5GLJ A;  3GDV A;  4JJ3 A;  2QKT A;  5E11 A;  5DTH A;  2OGP A;  2QBW A;  1VB7 A;  2M0V A;  4NMP A;  2I6V A;  2KG2 A;  4Q2P A;  1UF1 A;  3GSL A;  1U37 A;  4NMQ A;  1UHP A;  1WI2 A;  3SUZ A;  3GCO A;  1N6E A;  1T2M A;  5FHT A;  2MHO A;  3SHW A;  2YT8 A;  1TP5 A;  2V1W A;  3I18 A;  5E1Y A;  2Z9I A;  3KHF A;  4NXQ A;  2LC7 A;  2KOJ A;  1ZUB A;  3JXT A;  4GVC A;  1ZOK A;  1LCY A;  5HED A;  3ZRT A;  2M0U A;  3QDO A;  4MPA A;  2JWE A;  1FCF A;  1UEW A;  2O2T A;  1VA8 A;  4FGM A;  2ENO A;  3CYY A;  3NCV A;  1X6D A;  2X7Z A;  4Q2O A;  2EJY A;  1MFL A;  1RY4 A;  2DMZ A;  1UEP A;  4YDP A;  4JOH A;  1RZX A;  4OEO A;  1YBO A;  2YUB A;  2I0L A;  4PQW A;  2JIN A;  4GVD A;  2DC2 A;  2WL7 A;  4JOR A;  2H3M A;  5HJ1 A;  1MC7 A;  3PDV A;  3HPK A;  2F0A A;  1GM1 A;  3QE1 A;  2VSV A;  1V5L A;  1OBZ A;  2BYG A;  2DAZ A;  4K75 A;  2K1Z A;  2FCF A;  2VSP A;  4E3B A;  2DLU A;  1I92 A;  4E34 A;  1QLC A;  2JIL A;  2GEF A;  1IU0 A;  3L4F D;  2KYL A;  2R4H A;  1P1E A;  3I1E A;  4K78 A;  2W4F A;  2AWX A;  1OZI A;  1UEQ A;  3WKL A;  2VZ5 A;  4Q3H A;  1W9E A;  2M0Z A;  2EEI A;  3QGL A;  5HF4 A;  1G9O A;  3STJ A;  3SFJ A;  5JXB A;  1RGR A;  2Q9V A;  3R69 A;  1IU2 A;  2FN5 A;  1WF8 A;  3E17 A;  1NF3 C;  3CBY A;  3TSV A;  4NXP A;  4Q2Q A;  1QAU A;  4WYU A;  5GND A;  2KQF A;  2DJT A;  4JOP A;  5HFE A;  1X5Q A;  3B76 A;  2L97 A;  1UM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...