4E35A

Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36-l (ansrwptsil) peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Determinants of C-terminal Specificity in PDZ Peptide-binding Domains: A NOVEL CONTRIBUTION OF THE CARBOXYLATE-BINDING LOOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4e35A00
4OAJA 2DLSA 2KJPA 4K76A 3I4WA 2PZDA 1VAEA 3EGGC 1IU0A 3ID2A 4K6YA 2KG2A 2QKUA 5HFEA 2M10A 5F67A 1VJ6A 1U39A 1QAVA 4N6XA 1RZXA 4MPAA 1UEZA 5HETA 3MH7A 1RGWA 2FN5A 4JL7A 4Q2NA 3CS0A 2REYA 5G1EA 2LOBA 1KEFA 2VZ5A 4NMRA 4Z33A 1I16A 3DIWA 5FHTA 2ZPMA 4NNMA 5D13A 3STJA 2I0LA 2JREA 2MHOA 2JIKA 2YUBA 2KOHA 2OMJA 1UHPA 4YYXA 2EGNA 3E17A 5EZ0A 1N6FA 1LCYA 2JWEA 4GVDA 2L4SA 5G1DA 1W9EA 2H2CA 1MC7A 2QKTA 4JOJA 4JORA 2KPLA 1UJUA 2H3MA 1UM7A 3CBZA 4G69A 2EV8A 3ID4A 1XZ9A 2HE4A 5HF1A 3BPUA 2M0VA 1GQ5A 3VQFA 3SOEA 2JOAA 1D5GA 3PV4A 2RCZA 3GDUA 4H11A 2KV8A 2HE2A 2IWQA 2YT7A 1X8SA 1VCWA 2PNTA 2EEIA 1WIFA 1U38A 1FC9A 1W9OA 3RL8A 2EEGA 3R0HA 3RLEA 3PDZA 2DC2A 2I0IA 2CS5A 4Q2PA 4K75A 1VB7A 4PQWA 5HEDA 3PS4A 3B76A 1WHDA 3DJ3A 3SHWA 2OSGA 3K50A 1OZIA 1M5ZA 3GJ9A 4JOGA 1ZUBA 1N6DA 5E11A 1WH1A 2DM8A 2I04A 2QKVA 2VPHA 3HPKA 2PDZA 2EGOA 5HFCA 1UJDA 1TQ3A 1IU2A 4NMPA 2YTWA 4UU5A 3NFKA 3MH4A 1NTEA 3QE1A 4NMOA 3WKMA 2KJDA 4XHVA 2ENOA 5E21A 3LNYA 4JOHA 3QJMA 4UU6A 2OGPA 4GVCA 2KQFA 1FC7A 3KHFA 2KRGA 2IWNA 1N7EA 2W4FA 1WFVA 2VWRA 3VQGA 4E34A 2AINA 1P1EA 3GGEA 3R68A 4NMQA 4R2ZA 2M3MA 3SUZA 2YUYA 2W7RA 4NMVA 2EHRA 1N7TA 2OZFA 1Q7XA 3RL7A 5B6LA 2DJTA 5I7ZA 3K82A 1X5NA 4EDJA 2OS6A 4NXRA 4HOPB 4Z8JA 2R3YA 3TSWA 3CYYA 4K72A 3PDVA 2UZCA 5HDYA 3OTPA 2M0UA 2F0AA 4YDPA 4KFVA 1V6BA 3SHUA 2VSVA 4Q6SA 2AWWA 4OEPA 4K78A 5HEBA 2H3LA 1T2MA 1L6OA 3QGLA 1X45A 1V62A 1K32A 3TSZA 1QAVB 2PKUA 1I92A 1W9QA 3QJNA 1UM1A 3I18A 2FNEA 2KPKA 1YBOA 2QG1A 1QAUA 5HEYA 2WL7A 3GCNA 5GLJA 4E3BA 4L8NA 4NXQA 1Q3PA 1RY4A 4LMMA 2CSJA 1X6DA 2EDVA 3QIKA 1U3BA 2LC7A 1P1DA 2JINA 3KZEA 5HJ1A 3PV5A 5JXBA 1ZOKA 1GQ4A 1WI4A 2MX6A 2BYGA 3AXAA 1Y8TA 2G2LA 1KY9A 1R6JA 3GSLA 3CBYA 4JOFA 3K1RA 1V1TA 2FE5A 2DKRA 4NNLA 2KOJA 2Z17A 3HPMA 1MFGA 1UEPA 1V5QA 3ZRTA 2PA1A 3R69A 4WYUA 4E35A 1OBYA 3ID1A 4O06A 1N6EA 1UEQA 2IWOA 4NXPA 1N7FA 2KL1A 4Q2OA 3HVQC 3FY5A 2I1NA 4Q6HA 2EDZA 1FCFA 3WKLA 5A2PA 1V5LA 1Z86A 2KJKA 4JOPA 4KFWA 2PKTA 5HF4A 4REYA 2LUIA 2KOMA 2DLUA 1U37A 3O46A 3TSVA 3OU0A 1TP3A 4JOKA 2GZVA 1WJLA 4NMSA 2G5MB 1FC6A 3EGHC 1B8QA 3QDOA 2EGKA 5E6PB 5H3JA 2Z9IA 5HFBA 2K20A 2EDPA 1UEWA 2YT8A 2M0ZA 4P0CA 2QT5A 2Q9VA 1WG6A 2LC6A 2IWPA 2Q3GA 2KYLA 1PDRA 2D8IA 2V90A 4WYTA 2E7KA 2LA8A 4RI0A 3GDVA 5E1YA 1UF1A 2D92A 1GM1A 3DJ1A 4GHNA 2EEJA 2F5YA 1G9OA 3QO6A 1WI2A 2I6VA 1KWAA 1UJVA 3I1EA 3CH8A 3GCOA 4FGMA 2EXGA 2X7ZA 2RRMA 1UITA 3SFJA 4NMTA 2I4SA 5F3XA 1SOTA 2VRFA 3L4FD 2KAWA 5HFDA 3TMHA 1OBXA 2L4TA 1NF3C 2P3WA 1BE9A 2EAQA 2KBSA 2L97A 2EEHA 5HFFA 1IHJA 5FB8C 1MFLA 3NGHA 2R4HA 2HGAA 2M0TA 2V1WA 4F8KA 3DORA 1SOZA 1Q3OA 1WF7A 2VSPA 1TP5A 1WF8A 5EYZA 3MH6A 4Q2QA 4Q3HA 1RGRA 1VA8A 2H2BA 4IC6A 3KZDA 2DAZA 4P2AB 2ZPLA 1Z87A 1X5QA 1WFGA 3LNXA 3GDSA 2JXOA 2DMZA 2CSSA 2DB5A 3JXTA 1N99A 3CC0A 5GNDA 3NFLA 2AWUA 5E22A 3CBXA 1WHAA 1BFEA 3PV2A 4HOPA 2D90A 2FCFA 1X5RA 1UFXA 2EJYA 1TE0A 2AWXA 2O2TA 5DTHA 2OPGA 2OQSA 3DJAA 4OEOA 2JILA 2OCSA 2K1ZA 3O5NA 4JOEA 1QLCA 2KA9A 4AMHA 3ID3A 2QBWA 1OBZA 1Y7NA
chains in the Genus database with same CATH superfamily
4OAJA 2DLSA 2KJPA 4K76A 3I4WA 2PZDA 1VAEA 3EGGC 1IU0A 3ID2A 4K6YA 2KG2A 2QKUA 5HFEA 2M10A 5F67A 1VJ6A 1U39A 1QAVA 4N6XA 1RZXA 4MPAA 1UEZA 5HETA 3MH7A 1RGWA 2FN5A 4JL7A 4Q2NA 3CS0A 2REYA 5G1EA 2LOBA 1KEFA 2VZ5A 4NMRA 4Z33A 1I16A 2GEFA 3DIWA 5FHTA 2ZPMA 4NNMA 4JJ3A 5D13A 3STJA 2I0LA 2JREA 2MHOA 2JIKA 2YUBA 2KOHA 1X9ZA 2OMJA 1UHPA 4YYXA 2EGNA 3E17A 5EZ0A 1N6FA 1LCYA 2JWEA 4GVDA 2L4SA 5IL9A 5G1DA 1W9EA 2H2CA 1MC7A 2QKTA 4JOJA 4JORA 2KPLA 1UJUA 2H3MA 1UM7A 3CBZA 4G69A 2EV8A 3ID4A 1XZ9A 2HE4A 5HF1A 3BPUA 2M0VA 1GQ5A 3VQFA 3SOEA 2JOAA 1D5GA 3PV4A 2RCZA 3GDUA 4H11A 2KV8A 2HE2A 2IWQA 2YT7A 1X8SA 1VCWA 2PNTA 2EEIA 1WIFA 1U38A 1FC9A 1W9OA 3RL8A 2EEGA 3R0HA 3RLEA 3PDZA 2DC2A 2I0IA 2CS5A 4Q2PA 4K75A 1VB7A 4PQWA 5HEDA 3PS4A 3B76A 1WHDA 3DJ3A 3SHWA 2OSGA 3K50A 1OZIA 1M5ZA 3GJ9A 4JOGA 1ZUBA 1N6DA 5E11A 1WH1A 2DM8A 2I04A 2QKVA 2VPHA 3HPKA 2PDZA 2EGOA 5HFCA 1UJDA 1TQ3A 1IU2A 4NMPA 2YTWA 4UU5A 3NFKA 3MH4A 1NTEA 3QE1A 4NMOA 3WKMA 2KJDA 4XHVA 2ENOA 5E21A 3LNYA 4JOHA 3QJMA 4UU6A 2OGPA 4GVCA 2KQFA 1FC7A 3KHFA 2KRGA 2IWNA 1N7EA 2W4FA 1WFVA 2VWRA 3VQGA 4E34A 2AINA 1P1EA 3GGEA 3R68A 4NMQA 4R2ZA 2M3MA 3SUZA 2YUYA 2W7RA 4NMVA 2EHRA 1N7TA 2OZFA 1Q7XA 3RL7A 5B6LA 2DJTA 5I7ZA 3K82A 5ILBA 1X5NA 4EDJA 2OS6A 4NXRA 4HOPB 4Z8JA 2R3YA 3TSWA 3CYYA 4K72A 3PDVA 2UZCA 5HDYA 3OTPA 2M0UA 2F0AA 4YDPA 4KFVA 1V6BA 3SHUA 2VSVA 4Q6SA 2AWWA 4OEPA 4K78A 5HEBA 2H3LA 1T2MA 1L6OA 3QGLA 1X45A 1V62A 1K32A 3TSZA 1QAVB 2PKUA 1I92A 1W9QA 3QJNA 1UM1A 3I18A 2FNEA 2KPKA 1YBOA 2QG1A 1QAUA 5HEYA 2WL7A 3GCNA 5GLJA 4E3BA 2JSNA 4L8NA 4NXQA 1Q3PA 1RY4A 4LMMA 2CSJA 1X6DA 2EDVA 3QIKA 1U3BA 2LC7A 1P1DA 2JINA 3KZEA 5HJ1A 3PV5A 5JXBA 1ZOKA 1GQ4A 1WI4A 2MX6A 2BYGA 3AXAA 1Y8TA 2G2LA 1KY9A 1R6JA 3GSLA 3CBYA 4JOFA 3K1RA 1V1TA 2FE5A 2DKRA 4NNLA 2KOJA 2Z17A 3HPMA 4FLNA 1MFGA 1UEPA 1V5QA 3ZRTA 2PA1A 3R69A 4WYUA 4E35A 1OBYA 3ID1A 4O06A 1N6EA 1UEQA 2IWOA 3GABA 4NXPA 1N7FA 2KL1A 4Q2OA 3HVQC 3FY5A 2I1NA 4Q6HA 3NCVA 2EDZA 1FCFA 3WKLA 5A2PA 1V5LA 1Z86A 2KJKA 4JOPA 4KFWA 2PKTA 5HF4A 4REYA 2LUIA 2KOMA 2DLUA 1U37A 3O46A 3TSVA 3OU0A 1TP3A 3KDGA 4JOKA 2GZVA 1WJLA 4NMSA 2G5MB 1FC6A 3EGHC 1B8QA 3QDOA 2EGKA 5E6PB 5H3JA 2Z9IA 5HFBA 2K20A 2EDPA 1UEWA 2YT8A 2M0ZA 4P0CA 2QT5A 2Q9VA 1WG6A 2LC6A 2IWPA 2Q3GA 2KYLA 1PDRA 2D8IA 2V90A 4WYTA 2E7KA 2LA8A 4RI0A 3GDVA 5E1YA 1UF1A 2D92A 1GM1A 3DJ1A 4GHNA 2EEJA 2F5YA 1G9OA 3QO6A 1WI2A 2I6VA 1KWAA 1UJVA 3I1EA 3CH8A 3GCOA 4FGMA 2EXGA 2X7ZA 2RRMA 1UITA 3SFJA 4NMTA 2I4SA 5F3XA 1SOTA 2VRFA 3L4FD 2KAWA 5HFDA 3TMHA 1OBXA 2L4TA 1NF3C 2P3WA 1BE9A 2EAQA 2KBSA 2L97A 2EEHA 5HFFA 1IHJA 5FB8C 1MFLA 3NGHA 2R4HA 2HGAA 2M0TA 2V1WA 4F8KA 3DORA 1SOZA 1Q3OA 1WF7A 2VSPA 1TP5A 5B42A 1WF8A 5EYZA 3MH6A 4Q2QA 4Q3HA 1RGRA 1VA8A 2H2BA 4IC6A 3KZDA 2DAZA 4P2AB 2ZPLA 3KDKA 1Z87A 1X5QA 1WFGA 3LNXA 3GDSA 2JXOA 2DMZA 2CSSA 2DB5A 3JXTA 1N99A 3CC0A 5GNDA 3NFLA 2AWUA 5E22A 3CBXA 1WHAA 1BFEA 3PV2A 4HOPA 2D90A 2FCFA 1X5RA 1UFXA 2EJYA 1TE0A 2AWXA 2O2TA 5DTHA 2OPGA 2OQSA 3DJAA 4OEOA 2JILA 2OCSA 2K1ZA 3O5NA 4JOEA 1QLCA 2KA9A 4JJ0A 4AMHA 3ID3A 2QBWA 1OBZA 1Y7NA
chains in the Genus database with same CATH topology
4OAJA 2DLSA 2KJPA 4K76A 3I4WA 2PZDA 1VAEA 3EGGC 1IU0A 3ID2A 4K6YA 2KG2A 2QKUA 5HFEA 2M10A 5F67A 1VJ6A 1U39A 1QAVA 4N6XA 1RZXA 4MPAA 1UEZA 5HETA 3MH7A 1RGWA 2FN5A 4JL7A 4Q2NA 3CS0A 2REYA 5G1EA 2LOBA 1KEFA 2VZ5A 4NMRA 4Z33A 1I16A 2GEFA 3DIWA 5FHTA 2ZPMA 4NNMA 4JJ3A 5D13A 3STJA 2I0LA 2JREA 2MHOA 2JIKA 2YUBA 2KOHA 1X9ZA 2OMJA 1UHPA 4YYXA 2EGNA 3E17A 5EZ0A 1N6FA 1LCYA 2JWEA 4GVDA 2L4SA 5IL9A 5G1DA 1W9EA 2H2CA 1MC7A 2QKTA 4JOJA 4JORA 2KPLA 1UJUA 2H3MA 1UM7A 3CBZA 4G69A 2EV8A 3ID4A 1XZ9A 2HE4A 5HF1A 3BPUA 2M0VA 1GQ5A 3VQFA 3SOEA 2JOAA 1D5GA 3PV4A 2RCZA 3GDUA 4H11A 2KV8A 2HE2A 2IWQA 2YT7A 1X8SA 1VCWA 2PNTA 2EEIA 1WIFA 1U38A 1FC9A 1W9OA 3RL8A 2EEGA 3R0HA 3RLEA 3PDZA 2DC2A 2I0IA 2CS5A 4Q2PA 4K75A 1VB7A 4PQWA 5HEDA 3PS4A 3B76A 1WHDA 3DJ3A 3SHWA 2OSGA 3K50A 1OZIA 1M5ZA 3GJ9A 4JOGA 1ZUBA 1N6DA 5E11A 1WH1A 2DM8A 2I04A 2QKVA 2VPHA 3HPKA 2PDZA 2EGOA 5HFCA 1UJDA 1TQ3A 1IU2A 4NMPA 2YTWA 4UU5A 3NFKA 3MH4A 1NTEA 3QE1A 4NMOA 3WKMA 2KJDA 4XHVA 2ENOA 5E21A 3LNYA 4JOHA 3QJMA 4UU6A 2OGPA 4GVCA 2KQFA 1FC7A 3KHFA 2KRGA 2IWNA 1N7EA 2W4FA 1WFVA 2VWRA 3VQGA 4E34A 2AINA 1P1EA 3GGEA 3R68A 4NMQA 4R2ZA 2M3MA 3SUZA 2YUYA 2W7RA 4NMVA 2EHRA 1N7TA 2OZFA 1Q7XA 3RL7A 5B6LA 2DJTA 5I7ZA 3K82A 5ILBA 1X5NA 4EDJA 2OS6A 4NXRA 4HOPB 4Z8JA 2R3YA 3TSWA 3CYYA 4K72A 3PDVA 2UZCA 5HDYA 3OTPA 2M0UA 2F0AA 4YDPA 4KFVA 1V6BA 3SHUA 2VSVA 4Q6SA 2AWWA 4OEPA 4K78A 5HEBA 2H3LA 1T2MA 1L6OA 3QGLA 1X45A 1V62A 1K32A 3TSZA 1QAVB 2PKUA 1I92A 1W9QA 3QJNA 1UM1A 3I18A 2FNEA 2KPKA 1YBOA 2QG1A 1QAUA 5HEYA 2WL7A 3GCNA 5GLJA 4E3BA 2JSNA 4L8NA 4NXQA 1Q3PA 1RY4A 4LMMA 2CSJA 1X6DA 2EDVA 3QIKA 1U3BA 2LC7A 1P1DA 2JINA 3KZEA 5HJ1A 3PV5A 5JXBA 1ZOKA 1GQ4A 1WI4A 2MX6A 2BYGA 3AXAA 1Y8TA 2G2LA 1KY9A 1R6JA 3GSLA 3CBYA 4JOFA 3K1RA 1V1TA 2FE5A 2DKRA 4NNLA 2KOJA 2Z17A 3HPMA 4FLNA 1MFGA 1UEPA 1V5QA 3ZRTA 2PA1A 3R69A 4WYUA 4E35A 1OBYA 3ID1A 4O06A 1N6EA 1UEQA 2IWOA 3GABA 4NXPA 1N7FA 2KL1A 4Q2OA 3HVQC 3FY5A 2I1NA 4Q6HA 3NCVA 2EDZA 1FCFA 3WKLA 5A2PA 1V5LA 1Z86A 2KJKA 4JOPA 4KFWA 2PKTA 5HF4A 4REYA 2LUIA 2KOMA 2DLUA 1U37A 3O46A 3TSVA 3OU0A 1TP3A 3KDGA 4JOKA 2GZVA 1WJLA 4NMSA 2G5MB 1FC6A 3EGHC 1B8QA 3QDOA 2EGKA 5E6PB 5H3JA 2Z9IA 5HFBA 2K20A 2EDPA 1UEWA 2YT8A 2M0ZA 4P0CA 2QT5A 2Q9VA 1WG6A 2LC6A 2IWPA 2Q3GA 2KYLA 1PDRA 2D8IA 2V90A 4WYTA 2E7KA 2LA8A 4RI0A 3GDVA 5E1YA 1UF1A 2D92A 1GM1A 3DJ1A 4GHNA 2EEJA 2F5YA 1G9OA 3QO6A 1WI2A 2I6VA 1KWAA 1UJVA 3I1EA 3CH8A 3GCOA 4FGMA 2EXGA 2X7ZA 2RRMA 1UITA 3SFJA 4NMTA 2I4SA 5F3XA 1SOTA 2VRFA 3L4FD 2KAWA 5HFDA 3TMHA 1OBXA 2L4TA 1NF3C 2P3WA 1BE9A 2EAQA 2KBSA 2L97A 2EEHA 5HFFA 1IHJA 5FB8C 1MFLA 3NGHA 2R4HA 2HGAA 2M0TA 2V1WA 4F8KA 3DORA 1SOZA 1Q3OA 1WF7A 2VSPA 1TP5A 5B42A 1WF8A 5EYZA 3MH6A 4Q2QA 4Q3HA 1RGRA 1VA8A 2H2BA 4IC6A 3KZDA 2DAZA 4P2AB 2ZPLA 3KDKA 1Z87A 1X5QA 1WFGA 3LNXA 3GDSA 2JXOA 2DMZA 2CSSA 2DB5A 3JXTA 1N99A 3CC0A 5GNDA 3NFLA 2AWUA 5E22A 3CBXA 1WHAA 1BFEA 3PV2A 4HOPA 2D90A 2FCFA 1X5RA 1UFXA 2EJYA 1TE0A 2AWXA 2O2TA 5DTHA 2OPGA 2OQSA 3DJAA 4OEOA 2JILA 2OCSA 2K1ZA 3O5NA 4JOEA 1QLCA 2KA9A 4JJ0A 4AMHA 3ID3A 2QBWA 1OBZA 1Y7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAJ A;  2DLS A;  2KJP A;  4K76 A;  3I4W A;  2PZD A;  1VAE A;  3EGG C;  1IU0 A;  3ID2 A;  4K6Y A;  2KG2 A;  2QKU A;  5HFE A;  2M10 A;  5F67 A;  1VJ6 A;  1U39 A;  1QAV A;  4N6X A;  1RZX A;  4MPA A;  1UEZ A;  5HET A;  3MH7 A;  1RGW A;  2FN5 A;  4JL7 A;  4Q2N A;  3CS0 A;  2REY A;  5G1E A;  2LOB A;  1KEF A;  2VZ5 A;  4NMR A;  4Z33 A;  1I16 A;  3DIW A;  5FHT A;  2ZPM A;  4NNM A;  5D13 A;  3STJ A;  2I0L A;  2JRE A;  2MHO A;  2JIK A;  2YUB A;  2KOH A;  2OMJ A;  1UHP A;  4YYX A;  2EGN A;  3E17 A;  5EZ0 A;  1N6F A;  1LCY A;  2JWE A;  4GVD A;  2L4S A;  5G1D A;  1W9E A;  2H2C A;  1MC7 A;  2QKT A;  4JOJ A;  4JOR A;  2KPL A;  1UJU A;  2H3M A;  1UM7 A;  3CBZ A;  4G69 A;  2EV8 A;  3ID4 A;  1XZ9 A;  2HE4 A;  5HF1 A;  3BPU A;  2M0V A;  1GQ5 A;  3VQF A;  3SOE A;  2JOA A;  1D5G A;  3PV4 A;  2RCZ A;  3GDU A;  4H11 A;  2KV8 A;  2HE2 A;  2IWQ A;  2YT7 A;  1X8S A;  1VCW A;  2PNT A;  2EEI A;  1WIF A;  1U38 A;  1FC9 A;  1W9O A;  3RL8 A;  2EEG A;  3R0H A;  3RLE A;  3PDZ A;  2DC2 A;  2I0I A;  2CS5 A;  4Q2P A;  4K75 A;  1VB7 A;  4PQW A;  5HED A;  3PS4 A;  3B76 A;  1WHD A;  3DJ3 A;  3SHW A;  2OSG A;  3K50 A;  1OZI A;  1M5Z A;  3GJ9 A;  4JOG A;  1ZUB A;  1N6D A;  5E11 A;  1WH1 A;  2DM8 A;  2I04 A;  2QKV A;  2VPH A;  3HPK A;  2PDZ A;  2EGO A;  5HFC A;  1UJD A;  1TQ3 A;  1IU2 A;  4NMP A;  2YTW A;  4UU5 A;  3NFK A;  3MH4 A;  1NTE A;  3QE1 A;  4NMO A;  3WKM A;  2KJD A;  4XHV A;  2ENO A;  5E21 A;  3LNY A;  4JOH A;  3QJM A;  4UU6 A;  2OGP A;  4GVC A;  2KQF A;  1FC7 A;  3KHF A;  2KRG A;  2IWN A;  1N7E A;  2W4F A;  1WFV A;  2VWR A;  3VQG A;  4E34 A;  2AIN A;  1P1E A;  3GGE A;  3R68 A;  4NMQ A;  4R2Z A;  2M3M A;  3SUZ A;  2YUY A;  2W7R A;  4NMV A;  2EHR A;  1N7T A;  2OZF A;  1Q7X A;  3RL7 A;  5B6L A;  2DJT A;  5I7Z A;  3K82 A;  1X5N A;  4EDJ A;  2OS6 A;  4NXR A;  4HOP B;  4Z8J A;  2R3Y A;  3TSW A;  3CYY A;  4K72 A;  3PDV A;  2UZC A;  5HDY A;  3OTP A;  2M0U A;  2F0A A;  4YDP A;  4KFV A;  1V6B A;  3SHU A;  2VSV A;  4Q6S A;  2AWW A;  4OEP A;  4K78 A;  5HEB A;  2H3L A;  1T2M A;  1L6O A;  3QGL A;  1X45 A;  1V62 A;  1K32 A;  3TSZ A;  1QAV B;  2PKU A;  1I92 A;  1W9Q A;  3QJN A;  1UM1 A;  3I18 A;  2FNE A;  2KPK A;  1YBO A;  2QG1 A;  1QAU A;  5HEY A;  2WL7 A;  3GCN A;  5GLJ A;  4E3B A;  4L8N A;  4NXQ A;  1Q3P A;  1RY4 A;  4LMM A;  2CSJ A;  1X6D A;  2EDV A;  3QIK A;  1U3B A;  2LC7 A;  1P1D A;  2JIN A;  3KZE A;  5HJ1 A;  3PV5 A;  5JXB A;  1ZOK A;  1GQ4 A;  1WI4 A;  2MX6 A;  2BYG A;  3AXA A;  1Y8T A;  2G2L A;  1KY9 A;  1R6J A;  3GSL A;  3CBY A;  4JOF A;  3K1R A;  1V1T A;  2FE5 A;  2DKR A;  4NNL A;  2KOJ A;  2Z17 A;  3HPM A;  1MFG A;  1UEP A;  1V5Q A;  3ZRT A;  2PA1 A;  3R69 A;  4WYU A;  4E35 A;  1OBY A;  3ID1 A;  4O06 A;  1N6E A;  1UEQ A;  2IWO A;  4NXP A;  1N7F A;  2KL1 A;  4Q2O A;  3HVQ C;  3FY5 A;  2I1N A;  4Q6H A;  2EDZ A;  1FCF A;  3WKL A;  5A2P A;  1V5L A;  1Z86 A;  2KJK A;  4JOP A;  4KFW A;  2PKT A;  5HF4 A;  4REY A;  2LUI A;  2KOM A;  2DLU A;  1U37 A;  3O46 A;  3TSV A;  3OU0 A;  1TP3 A;  4JOK A;  2GZV A;  1WJL A;  4NMS A;  2G5M B;  1FC6 A;  3EGH C;  1B8Q A;  3QDO A;  2EGK A;  5E6P B;  5H3J A;  2Z9I A;  5HFB A;  2K20 A;  2EDP A;  1UEW A;  2YT8 A;  2M0Z A;  4P0C A;  2QT5 A;  2Q9V A;  1WG6 A;  2LC6 A;  2IWP A;  2Q3G A;  2KYL A;  1PDR A;  2D8I A;  2V90 A;  4WYT A;  2E7K A;  2LA8 A;  4RI0 A;  3GDV A;  5E1Y A;  1UF1 A;  2D92 A;  1GM1 A;  3DJ1 A;  4GHN A;  2EEJ A;  2F5Y A;  1G9O A;  3QO6 A;  1WI2 A;  2I6V A;  1KWA A;  1UJV A;  3I1E A;  3CH8 A;  3GCO A;  4FGM A;  2EXG A;  2X7Z A;  2RRM A;  1UIT A;  3SFJ A;  4NMT A;  2I4S A;  5F3X A;  1SOT A;  2VRF A;  3L4F D;  2KAW A;  5HFD A;  3TMH A;  1OBX A;  2L4T A;  1NF3 C;  2P3W A;  1BE9 A;  2EAQ A;  2KBS A;  2L97 A;  2EEH A;  5HFF A;  1IHJ A;  5FB8 C;  1MFL A;  3NGH A;  2R4H A;  2HGA A;  2M0T A;  2V1W A;  4F8K A;  3DOR A;  1SOZ A;  1Q3O A;  1WF7 A;  2VSP A;  1TP5 A;  1WF8 A;  5EYZ A;  3MH6 A;  4Q2Q A;  4Q3H A;  1RGR A;  1VA8 A;  2H2B A;  4IC6 A;  3KZD A;  2DAZ A;  4P2A B;  2ZPL A;  1Z87 A;  1X5Q A;  1WFG A;  3LNX A;  3GDS A;  2JXO A;  2DMZ A;  2CSS A;  2DB5 A;  3JXT A;  1N99 A;  3CC0 A;  5GND A;  3NFL A;  2AWU A;  5E22 A;  3CBX A;  1WHA A;  1BFE A;  3PV2 A;  4HOP A;  2D90 A;  2FCF A;  1X5R A;  1UFX A;  2EJY A;  1TE0 A;  2AWX A;  2O2T A;  5DTH A;  2OPG A;  2OQS A;  3DJA A;  4OEO A;  2JIL A;  2OCS A;  2K1Z A;  3O5N A;  4JOE A;  1QLC A;  2KA9 A;  4AMH A;  3ID3 A;  2QBW A;  1OBZ A;  1Y7N A; 
#chains in the Genus database with same CATH topology
 4OAJ A;  2DLS A;  2KJP A;  4K76 A;  3I4W A;  2PZD A;  1VAE A;  3EGG C;  1IU0 A;  3ID2 A;  4K6Y A;  2KG2 A;  2QKU A;  5HFE A;  2M10 A;  5F67 A;  1VJ6 A;  1U39 A;  1QAV A;  4N6X A;  1RZX A;  4MPA A;  1UEZ A;  5HET A;  3MH7 A;  1RGW A;  2FN5 A;  4JL7 A;  4Q2N A;  3CS0 A;  2REY A;  5G1E A;  2LOB A;  1KEF A;  2VZ5 A;  4NMR A;  4Z33 A;  1I16 A;  2GEF A;  3DIW A;  5FHT A;  2ZPM A;  4NNM A;  4JJ3 A;  5D13 A;  3STJ A;  2I0L A;  2JRE A;  2MHO A;  2JIK A;  2YUB A;  2KOH A;  1X9Z A;  2OMJ A;  1UHP A;  4YYX A;  2EGN A;  3E17 A;  5EZ0 A;  1N6F A;  1LCY A;  2JWE A;  4GVD A;  2L4S A;  5IL9 A;  5G1D A;  1W9E A;  2H2C A;  1MC7 A;  2QKT A;  4JOJ A;  4JOR A;  2KPL A;  1UJU A;  2H3M A;  1UM7 A;  3CBZ A;  4G69 A;  2EV8 A;  3ID4 A;  1XZ9 A;  2HE4 A;  5HF1 A;  3BPU A;  2M0V A;  1GQ5 A;  3VQF A;  3SOE A;  2JOA A;  1D5G A;  3PV4 A;  2RCZ A;  3GDU A;  4H11 A;  2KV8 A;  2HE2 A;  2IWQ A;  2YT7 A;  1X8S A;  1VCW A;  2PNT A;  2EEI A;  1WIF A;  1U38 A;  1FC9 A;  1W9O A;  3RL8 A;  2EEG A;  3R0H A;  3RLE A;  3PDZ A;  2DC2 A;  2I0I A;  2CS5 A;  4Q2P A;  4K75 A;  1VB7 A;  4PQW A;  5HED A;  3PS4 A;  3B76 A;  1WHD A;  3DJ3 A;  3SHW A;  2OSG A;  3K50 A;  1OZI A;  1M5Z A;  3GJ9 A;  4JOG A;  1ZUB A;  1N6D A;  5E11 A;  1WH1 A;  2DM8 A;  2I04 A;  2QKV A;  2VPH A;  3HPK A;  2PDZ A;  2EGO A;  5HFC A;  1UJD A;  1TQ3 A;  1IU2 A;  4NMP A;  2YTW A;  4UU5 A;  3NFK A;  3MH4 A;  1NTE A;  3QE1 A;  4NMO A;  3WKM A;  2KJD A;  4XHV A;  2ENO A;  5E21 A;  3LNY A;  4JOH A;  3QJM A;  4UU6 A;  2OGP A;  4GVC A;  2KQF A;  1FC7 A;  3KHF A;  2KRG A;  2IWN A;  1N7E A;  2W4F A;  1WFV A;  2VWR A;  3VQG A;  4E34 A;  2AIN A;  1P1E A;  3GGE A;  3R68 A;  4NMQ A;  4R2Z A;  2M3M A;  3SUZ A;  2YUY A;  2W7R A;  4NMV A;  2EHR A;  1N7T A;  2OZF A;  1Q7X A;  3RL7 A;  5B6L A;  2DJT A;  5I7Z A;  3K82 A;  5ILB A;  1X5N A;  4EDJ A;  2OS6 A;  4NXR A;  4HOP B;  4Z8J A;  2R3Y A;  3TSW A;  3CYY A;  4K72 A;  3PDV A;  2UZC A;  5HDY A;  3OTP A;  2M0U A;  2F0A A;  4YDP A;  4KFV A;  1V6B A;  3SHU A;  2VSV A;  4Q6S A;  2AWW A;  4OEP A;  4K78 A;  5HEB A;  2H3L A;  1T2M A;  1L6O A;  3QGL A;  1X45 A;  1V62 A;  1K32 A;  3TSZ A;  1QAV B;  2PKU A;  1I92 A;  1W9Q A;  3QJN A;  1UM1 A;  3I18 A;  2FNE A;  2KPK A;  1YBO A;  2QG1 A;  1QAU A;  5HEY A;  2WL7 A;  3GCN A;  5GLJ A;  4E3B A;  2JSN A;  4L8N A;  4NXQ A;  1Q3P A;  1RY4 A;  4LMM A;  2CSJ A;  1X6D A;  2EDV A;  3QIK A;  1U3B A;  2LC7 A;  1P1D A;  2JIN A;  3KZE A;  5HJ1 A;  3PV5 A;  5JXB A;  1ZOK A;  1GQ4 A;  1WI4 A;  2MX6 A;  2BYG A;  3AXA A;  1Y8T A;  2G2L A;  1KY9 A;  1R6J A;  3GSL A;  3CBY A;  4JOF A;  3K1R A;  1V1T A;  2FE5 A;  2DKR A;  4NNL A;  2KOJ A;  2Z17 A;  3HPM A;  4FLN A;  1MFG A;  1UEP A;  1V5Q A;  3ZRT A;  2PA1 A;  3R69 A;  4WYU A;  4E35 A;  1OBY A;  3ID1 A;  4O06 A;  1N6E A;  1UEQ A;  2IWO A;  3GAB A;  4NXP A;  1N7F A;  2KL1 A;  4Q2O A;  3HVQ C;  3FY5 A;  2I1N A;  4Q6H A;  3NCV A;  2EDZ A;  1FCF A;  3WKL A;  5A2P A;  1V5L A;  1Z86 A;  2KJK A;  4JOP A;  4KFW A;  2PKT A;  5HF4 A;  4REY A;  2LUI A;  2KOM A;  2DLU A;  1U37 A;  3O46 A;  3TSV A;  3OU0 A;  1TP3 A;  3KDG A;  4JOK A;  2GZV A;  1WJL A;  4NMS A;  2G5M B;  1FC6 A;  3EGH C;  1B8Q A;  3QDO A;  2EGK A;  5E6P B;  5H3J A;  2Z9I A;  5HFB A;  2K20 A;  2EDP A;  1UEW A;  2YT8 A;  2M0Z A;  4P0C A;  2QT5 A;  2Q9V A;  1WG6 A;  2LC6 A;  2IWP A;  2Q3G A;  2KYL A;  1PDR A;  2D8I A;  2V90 A;  4WYT A;  2E7K A;  2LA8 A;  4RI0 A;  3GDV A;  5E1Y A;  1UF1 A;  2D92 A;  1GM1 A;  3DJ1 A;  4GHN A;  2EEJ A;  2F5Y A;  1G9O A;  3QO6 A;  1WI2 A;  2I6V A;  1KWA A;  1UJV A;  3I1E A;  3CH8 A;  3GCO A;  4FGM A;  2EXG A;  2X7Z A;  2RRM A;  1UIT A;  3SFJ A;  4NMT A;  2I4S A;  5F3X A;  1SOT A;  2VRF A;  3L4F D;  2KAW A;  5HFD A;  3TMH A;  1OBX A;  2L4T A;  1NF3 C;  2P3W A;  1BE9 A;  2EAQ A;  2KBS A;  2L97 A;  2EEH A;  5HFF A;  1IHJ A;  5FB8 C;  1MFL A;  3NGH A;  2R4H A;  2HGA A;  2M0T A;  2V1W A;  4F8K A;  3DOR A;  1SOZ A;  1Q3O A;  1WF7 A;  2VSP A;  1TP5 A;  5B42 A;  1WF8 A;  5EYZ A;  3MH6 A;  4Q2Q A;  4Q3H A;  1RGR A;  1VA8 A;  2H2B A;  4IC6 A;  3KZD A;  2DAZ A;  4P2A B;  2ZPL A;  3KDK A;  1Z87 A;  1X5Q A;  1WFG A;  3LNX A;  3GDS A;  2JXO A;  2DMZ A;  2CSS A;  2DB5 A;  3JXT A;  1N99 A;  3CC0 A;  5GND A;  3NFL A;  2AWU A;  5E22 A;  3CBX A;  1WHA A;  1BFE A;  3PV2 A;  4HOP A;  2D90 A;  2FCF A;  1X5R A;  1UFX A;  2EJY A;  1TE0 A;  2AWX A;  2O2T A;  5DTH A;  2OPG A;  2OQS A;  3DJA A;  4OEO A;  2JIL A;  2OCS A;  2K1Z A;  3O5N A;  4JOE A;  1QLC A;  2KA9 A;  4JJ0 A;  4AMH A;  3ID3 A;  2QBW A;  1OBZ A;  1Y7N A; 
#chains in the Genus database with same CATH homology
 4OAJ A;  2DLS A;  2KJP A;  4K76 A;  3I4W A;  2PZD A;  1VAE A;  3EGG C;  1IU0 A;  3ID2 A;  4K6Y A;  2KG2 A;  2QKU A;  5HFE A;  2M10 A;  5F67 A;  1VJ6 A;  1U39 A;  1QAV A;  4N6X A;  1RZX A;  4MPA A;  1UEZ A;  5HET A;  3MH7 A;  1RGW A;  2FN5 A;  4JL7 A;  4Q2N A;  3CS0 A;  2REY A;  5G1E A;  2LOB A;  1KEF A;  2VZ5 A;  4NMR A;  4Z33 A;  1I16 A;  2GEF A;  3DIW A;  5FHT A;  2ZPM A;  4NNM A;  4JJ3 A;  5D13 A;  3STJ A;  2I0L A;  2JRE A;  2MHO A;  2JIK A;  2YUB A;  2KOH A;  1X9Z A;  2OMJ A;  1UHP A;  4YYX A;  2EGN A;  3E17 A;  5EZ0 A;  1N6F A;  1LCY A;  2JWE A;  4GVD A;  2L4S A;  5IL9 A;  5G1D A;  1W9E A;  2H2C A;  1MC7 A;  2QKT A;  4JOJ A;  4JOR A;  2KPL A;  1UJU A;  2H3M A;  1UM7 A;  3CBZ A;  4G69 A;  2EV8 A;  3ID4 A;  1XZ9 A;  2HE4 A;  5HF1 A;  3BPU A;  2M0V A;  1GQ5 A;  3VQF A;  3SOE A;  2JOA A;  1D5G A;  3PV4 A;  2RCZ A;  3GDU A;  4H11 A;  2KV8 A;  2HE2 A;  2IWQ A;  2YT7 A;  1X8S A;  1VCW A;  2PNT A;  2EEI A;  1WIF A;  1U38 A;  1FC9 A;  1W9O A;  3RL8 A;  2EEG A;  3R0H A;  3RLE A;  3PDZ A;  2DC2 A;  2I0I A;  2CS5 A;  4Q2P A;  4K75 A;  1VB7 A;  4PQW A;  5HED A;  3PS4 A;  3B76 A;  1WHD A;  3DJ3 A;  3SHW A;  2OSG A;  3K50 A;  1OZI A;  1M5Z A;  3GJ9 A;  4JOG A;  1ZUB A;  1N6D A;  5E11 A;  1WH1 A;  2DM8 A;  2I04 A;  2QKV A;  2VPH A;  3HPK A;  2PDZ A;  2EGO A;  5HFC A;  1UJD A;  1TQ3 A;  1IU2 A;  4NMP A;  2YTW A;  4UU5 A;  3NFK A;  3MH4 A;  1NTE A;  3QE1 A;  4NMO A;  3WKM A;  2KJD A;  4XHV A;  2ENO A;  5E21 A;  3LNY A;  4JOH A;  3QJM A;  4UU6 A;  2OGP A;  4GVC A;  2KQF A;  1FC7 A;  3KHF A;  2KRG A;  2IWN A;  1N7E A;  2W4F A;  1WFV A;  2VWR A;  3VQG A;  4E34 A;  2AIN A;  1P1E A;  3GGE A;  3R68 A;  4NMQ A;  4R2Z A;  2M3M A;  3SUZ A;  2YUY A;  2W7R A;  4NMV A;  2EHR A;  1N7T A;  2OZF A;  1Q7X A;  3RL7 A;  5B6L A;  2DJT A;  5I7Z A;  3K82 A;  5ILB A;  1X5N A;  4EDJ A;  2OS6 A;  4NXR A;  4HOP B;  4Z8J A;  2R3Y A;  3TSW A;  3CYY A;  4K72 A;  3PDV A;  2UZC A;  5HDY A;  3OTP A;  2M0U A;  2F0A A;  4YDP A;  4KFV A;  1V6B A;  3SHU A;  2VSV A;  4Q6S A;  2AWW A;  4OEP A;  4K78 A;  5HEB A;  2H3L A;  1T2M A;  1L6O A;  3QGL A;  1X45 A;  1V62 A;  1K32 A;  3TSZ A;  1QAV B;  2PKU A;  1I92 A;  1W9Q A;  3QJN A;  1UM1 A;  3I18 A;  2FNE A;  2KPK A;  1YBO A;  2QG1 A;  1QAU A;  5HEY A;  2WL7 A;  3GCN A;  5GLJ A;  4E3B A;  2JSN A;  4L8N A;  4NXQ A;  1Q3P A;  1RY4 A;  4LMM A;  2CSJ A;  1X6D A;  2EDV A;  3QIK A;  1U3B A;  2LC7 A;  1P1D A;  2JIN A;  3KZE A;  5HJ1 A;  3PV5 A;  5JXB A;  1ZOK A;  1GQ4 A;  1WI4 A;  2MX6 A;  2BYG A;  3AXA A;  1Y8T A;  2G2L A;  1KY9 A;  1R6J A;  3GSL A;  3CBY A;  4JOF A;  3K1R A;  1V1T A;  2FE5 A;  2DKR A;  4NNL A;  2KOJ A;  2Z17 A;  3HPM A;  4FLN A;  1MFG A;  1UEP A;  1V5Q A;  3ZRT A;  2PA1 A;  3R69 A;  4WYU A;  4E35 A;  1OBY A;  3ID1 A;  4O06 A;  1N6E A;  1UEQ A;  2IWO A;  3GAB A;  4NXP A;  1N7F A;  2KL1 A;  4Q2O A;  3HVQ C;  3FY5 A;  2I1N A;  4Q6H A;  3NCV A;  2EDZ A;  1FCF A;  3WKL A;  5A2P A;  1V5L A;  1Z86 A;  2KJK A;  4JOP A;  4KFW A;  2PKT A;  5HF4 A;  4REY A;  2LUI A;  2KOM A;  2DLU A;  1U37 A;  3O46 A;  3TSV A;  3OU0 A;  1TP3 A;  3KDG A;  4JOK A;  2GZV A;  1WJL A;  4NMS A;  2G5M B;  1FC6 A;  3EGH C;  1B8Q A;  3QDO A;  2EGK A;  5E6P B;  5H3J A;  2Z9I A;  5HFB A;  2K20 A;  2EDP A;  1UEW A;  2YT8 A;  2M0Z A;  4P0C A;  2QT5 A;  2Q9V A;  1WG6 A;  2LC6 A;  2IWP A;  2Q3G A;  2KYL A;  1PDR A;  2D8I A;  2V90 A;  4WYT A;  2E7K A;  2LA8 A;  4RI0 A;  3GDV A;  5E1Y A;  1UF1 A;  2D92 A;  1GM1 A;  3DJ1 A;  4GHN A;  2EEJ A;  2F5Y A;  1G9O A;  3QO6 A;  1WI2 A;  2I6V A;  1KWA A;  1UJV A;  3I1E A;  3CH8 A;  3GCO A;  4FGM A;  2EXG A;  2X7Z A;  2RRM A;  1UIT A;  3SFJ A;  4NMT A;  2I4S A;  5F3X A;  1SOT A;  2VRF A;  3L4F D;  2KAW A;  5HFD A;  3TMH A;  1OBX A;  2L4T A;  1NF3 C;  2P3W A;  1BE9 A;  2EAQ A;  2KBS A;  2L97 A;  2EEH A;  5HFF A;  1IHJ A;  5FB8 C;  1MFL A;  3NGH A;  2R4H A;  2HGA A;  2M0T A;  2V1W A;  4F8K A;  3DOR A;  1SOZ A;  1Q3O A;  1WF7 A;  2VSP A;  1TP5 A;  5B42 A;  1WF8 A;  5EYZ A;  3MH6 A;  4Q2Q A;  4Q3H A;  1RGR A;  1VA8 A;  2H2B A;  4IC6 A;  3KZD A;  2DAZ A;  4P2A B;  2ZPL A;  3KDK A;  1Z87 A;  1X5Q A;  1WFG A;  3LNX A;  3GDS A;  2JXO A;  2DMZ A;  2CSS A;  2DB5 A;  3JXT A;  1N99 A;  3CC0 A;  5GND A;  3NFL A;  2AWU A;  5E22 A;  3CBX A;  1WHA A;  1BFE A;  3PV2 A;  4HOP A;  2D90 A;  2FCF A;  1X5R A;  1UFX A;  2EJY A;  1TE0 A;  2AWX A;  2O2T A;  5DTH A;  2OPG A;  2OQS A;  3DJA A;  4OEO A;  2JIL A;  2OCS A;  2K1Z A;  3O5N A;  4JOE A;  1QLC A;  2KA9 A;  4JJ0 A;  4AMH A;  3ID3 A;  2QBW A;  1OBZ A;  1Y7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...