4E35A

Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36-l (ansrwptsil) peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Determinants of C-terminal Specificity in PDZ Peptide-binding Domains: A NOVEL CONTRIBUTION OF THE CARBOXYLATE-BINDING LOOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4e35A00
1RGWA 2DMZA 3AXAA 2MX6A 2JINA 2KOMA 2OQSA 2MHOA 4N6XA 3GDUA 5E1YA 2L4SA 3RLEA 3DIWA 1X45A 3QGLA 4E35A 2EGOA 4IC6A 2G2LA 4WYUA 5FHTA 4NMOA 2RRMA 2YTWA 3KZDA 3OTPA 2AWWA 3ID2A 5HEDA 5HETA 1WH1A 1N7FA 5G1DA 2KG2A 1V5LA 4UU5A 1TP5A 2CS5A 2QG1A 2KBSA 4LMMA 3HPKA 1GM1A 2WL7A 4F8KA 2HE4A 4OEOA 5EZ0A 2JREA 3FY5A 1Q3PA 1TE0A 2O2TA 2JIKA 2KQFA 2M3MA 4UU6A 1W9EA 1M5ZA 2V90A 4REYA 4HOPA 2DAZA 2KRGA 2DC2A 5HF1A 2K20A 2H2BA 3HVQC 1LCYA 2ZPMA 1FCFA 2H3LA 4O06A 3GSLA 2DLUA 5HFFA 3CBXA 1MFGA 5HF4A 1OZIA 1NTEA 2M0UA 2R4HA 2M10A 2EGKA 2DB5A 3KHFA 5EYZA 2I4SA 3DJ1A 2Q3GA 1V5QA 1VAEA 1U37A 3JXTA 4G69A 1Z86A 1WHAA 2VSPA 1RZXA 3K50A 1BE9A 2DM8A 4NXRA 5E22A 3R68A 5HEYA 2OGPA 1N6DA 4JOGA 2PKUA 4YDPA 1OBXA 2YUYA 2Z17A 4NNLA 3TMHA 1V1TA 2REYA 3OU0A 2FE5A 2RCZA 2KOHA 1VJ6A 2YUBA 5DTHA 5HJ1A 2E7KA 5B6LA 3QE1A 4E34A 3R69A 2EXGA 1ZUBA 1SOTA 2PKTA 3QJNA 1WI2A 2I04A 3BPUA 1WHDA 4FGMA 4Q6SA 1N6EA 5HEBA 4NNMA 4NMVA 3QJMA 2JOAA 2M0ZA 4K76A 2OSGA 2JXOA 4JORA 3STJA 3L4FD 2QKVA 1WIFA 1GQ4A 1UITA 2OS6A 1BFEA 1TP3A 1N99A 1UEZA 2VSVA 3CH8A 4Q2QA 1KWAA 1U3BA 2JILA 1N7TA 1UF1A 2KJKA 1VCWA 3LNXA 1WFVA 2VRFA 2KOJA 4NMSA 2H2CA 3O46A 2DLSA 3QO6A 5JXBA 1P1EA 1UEQA 2LC6A 3GGEA 3KZEA 2L97A 2F5YA 1SOZA 2VWRA 2V1WA 3NFLA 3SFJA 4PQWA 2DKRA 5HDYA 3O5NA 4NMPA 1WJLA 4WYTA 2W4FA 4EDJA 2CSSA 4Q2OA 5GNDA 4K6YA 1UJUA 1OBYA 2KAWA 3DJAA 4JOJA 3MH4A 1R6JA 5D13A 1KEFA 2AWUA 2KPLA 3SHWA 2KPKA 2ZPLA 2I6VA 1FC6A 3LNYA 3NFKA 3TSVA 2DJTA 2K1ZA 2L4TA 1WG6A 3PV2A 2IWQA 4Q2NA 1FC7A 3I18A 2I0IA 4P2AB 3QDOA 5E11A 2EEHA 3EGGC 2D8IA 2OPGA 3SOEA 1Q7XA 2PZDA 2AWXA 1IU0A 5G1EA 4Q2PA 2BYGA 3K82A 2HE2A 1X5RA 1X6DA 3PV5A 2KJPA 3SHUA 2PA1A 2KYLA 3EGHC 2QBWA 3RL7A 3PDVA 2Q9VA 1WF7A 4K75A 1PDRA 5H3JA 1IU2A 2YT8A 4GVDA 2PDZA 1ZOKA 3MH7A 1FC9A 5FB8C 1QAVB 3TSWA 2EJYA 1Y8TA 2FCFA 2EHRA 4Q3HA 4K72A 1I16A 2M0VA 1RY4A 1Q3OA 2FNEA 4AMHA 4GVCA 4RI0A 1N7EA 3PDZA 1K32A 3ID3A 3I1EA 3CC0A 2QKTA 1P1DA 2LC7A 1UM1A 4XHVA 3WKLA 1MC7A 2FN5A 2X7ZA 4MPAA 1WF8A 3MH6A 2UZCA 4OAJA 1RGRA 5A2PA 2KL1A 5F3XA 3QIKA 5F67A 2QKUA 3ZRTA 4Z33A 1X8SA 2EDVA 2GZVA 1Z87A 2HGAA 1XZ9A 3DORA 4JOEA 2EEJA 1UHPA 4P0CA 4NMTA 4JOKA 1L6OA 3K1RA 1UM7A 3GCNA 1VA8A 3RL8A 2LUIA 3GDSA 3VQGA 3CS0A 5I7ZA 3GJ9A 4GHNA 2EEIA 2ENOA 4NXQA 2IWNA 3NGHA 2IWPA 1UEWA 2KJDA 3SUZA 4JL7A 2EEGA 1UJVA 1UEPA 3I4WA 2AINA 3GDVA 4Q6HA 4JOHA 3CBZA 1YBOA 2PNTA 3ID4A 1OBZA 1UJDA 2G5MB 2JWEA 1U39A 3B76A 4E3BA 1D5GA 5GLJA 3HPMA 2D92A 2LOBA 4H11A 1MFLA 1QLCA 1T2MA 3ID1A 3VQFA 3WKMA 1U38A 1G9OA 2OMJA 1KY9A 2LA8A 1VB7A 4OEPA 4R2ZA 5HFEA 4HOPB 4K78A 4KFWA 4KFVA 4JOFA 4L8NA 2VPHA 1V6BA 2KA9A 1QAVA 3E17A 4Z8JA 3DJ3A 1X5QA 1Y7NA 1N6FA 4YYXA 2YT7A 1V62A 1X5NA 2EGNA 3PS4A 5HFBA 4NMRA 1GQ5A 1WFGA 2QT5A 3GCOA 3TSZA 5E6PB 2EDPA 5HFCA 5HFDA 2F0AA 2Z9IA 2P3WA 1W9OA 4NMQA 2IWOA 2M0TA 3CBYA 1UFXA 2VZ5A 1NF3C 1WI4A 2H3MA 1B8QA 2R3YA 2OZFA 4NXPA 1IHJA 2CSJA 3R0HA 2EV8A 2I0LA 2I1NA 2EDZA 2W7RA 3CYYA 2D90A 4JOPA 1QAUA 2OCSA 5E21A 1W9QA 2KV8A 3PV4A 1I92A 2EAQA 1TQ3A
chains in the Genus database with same CATH superfamily
1RGWA 2DMZA 3AXAA 2MX6A 2JINA 2KOMA 2OQSA 2MHOA 4N6XA 3GDUA 5E1YA 2L4SA 3RLEA 3DIWA 1X45A 3QGLA 4E35A 2EGOA 4IC6A 2G2LA 4WYUA 5FHTA 4NMOA 2RRMA 2YTWA 3KZDA 3OTPA 2AWWA 3ID2A 5HEDA 5HETA 1WH1A 1N7FA 5G1DA 2KG2A 1V5LA 4UU5A 1TP5A 2CS5A 2QG1A 2KBSA 4LMMA 3HPKA 1GM1A 2WL7A 4F8KA 2HE4A 4OEOA 5EZ0A 2JREA 3FY5A 1Q3PA 1TE0A 2O2TA 2JIKA 2KQFA 2M3MA 4UU6A 1W9EA 1M5ZA 2V90A 1X9ZA 4REYA 4HOPA 2DAZA 2KRGA 2DC2A 5HF1A 2K20A 2H2BA 3HVQC 1LCYA 2ZPMA 1FCFA 2H3LA 4O06A 3GSLA 2DLUA 5HFFA 3CBXA 1MFGA 5HF4A 1OZIA 1NTEA 2M0UA 2R4HA 2M10A 2EGKA 2DB5A 3KHFA 5EYZA 2I4SA 3DJ1A 2Q3GA 1V5QA 1VAEA 1U37A 3JXTA 4G69A 1Z86A 1WHAA 2VSPA 1RZXA 3K50A 1BE9A 2DM8A 4NXRA 5E22A 3R68A 5HEYA 2OGPA 1N6DA 4JOGA 2PKUA 4YDPA 1OBXA 2YUYA 2Z17A 4NNLA 3TMHA 1V1TA 2REYA 3OU0A 2FE5A 2RCZA 2KOHA 1VJ6A 2YUBA 2GEFA 5DTHA 5HJ1A 2E7KA 5B6LA 3QE1A 4E34A 3R69A 2EXGA 1ZUBA 1SOTA 2PKTA 3QJNA 1WI2A 2I04A 3BPUA 1WHDA 4FGMA 4Q6SA 1N6EA 5HEBA 4NNMA 4NMVA 3QJMA 2JOAA 2M0ZA 4K76A 2OSGA 2JXOA 4JORA 3STJA 3L4FD 2QKVA 1WIFA 1GQ4A 1UITA 2OS6A 1BFEA 1TP3A 1N99A 1UEZA 2VSVA 3CH8A 4Q2QA 1KWAA 1U3BA 2JILA 1N7TA 1UF1A 2KJKA 1VCWA 4FLNA 3LNXA 1WFVA 3NCVA 2VRFA 2KOJA 4NMSA 2H2CA 3O46A 2DLSA 3QO6A 5JXBA 1P1EA 1UEQA 2LC6A 3GGEA 3KZEA 2L97A 2F5YA 1SOZA 2VWRA 2V1WA 3NFLA 3SFJA 4PQWA 5IL9A 2DKRA 5HDYA 3O5NA 4NMPA 1WJLA 3KDKA 4WYTA 2W4FA 4EDJA 2CSSA 4Q2OA 5GNDA 4K6YA 1UJUA 1OBYA 2KAWA 3DJAA 4JOJA 3MH4A 1R6JA 5D13A 1KEFA 2AWUA 2KPLA 3SHWA 2KPKA 2ZPLA 2I6VA 1FC6A 3LNYA 3NFKA 3TSVA 2DJTA 2K1ZA 2L4TA 1WG6A 3PV2A 2IWQA 4Q2NA 1FC7A 3I18A 2I0IA 4P2AB 3QDOA 5E11A 2EEHA 3EGGC 2D8IA 2OPGA 3SOEA 1Q7XA 2PZDA 4JJ3A 2AWXA 1IU0A 5G1EA 4Q2PA 2BYGA 3K82A 2HE2A 1X5RA 1X6DA 3PV5A 2KJPA 3SHUA 2PA1A 2KYLA 3EGHC 2QBWA 3RL7A 3PDVA 2Q9VA 1WF7A 4K75A 1PDRA 5H3JA 1IU2A 2YT8A 4GVDA 2PDZA 1ZOKA 3MH7A 1FC9A 5FB8C 1QAVB 3TSWA 2EJYA 1Y8TA 2FCFA 2EHRA 4Q3HA 4K72A 1I16A 2M0VA 1RY4A 1Q3OA 2FNEA 4AMHA 4GVCA 4RI0A 1N7EA 3PDZA 1K32A 3ID3A 3I1EA 3CC0A 2QKTA 1P1DA 2LC7A 1UM1A 4XHVA 3WKLA 1MC7A 2FN5A 2X7ZA 4MPAA 1WF8A 3MH6A 2UZCA 4OAJA 1RGRA 5A2PA 2KL1A 5F3XA 3QIKA 5F67A 2QKUA 3ZRTA 4Z33A 1X8SA 2EDVA 2GZVA 1Z87A 2HGAA 1XZ9A 3DORA 4JOEA 2EEJA 1UHPA 4P0CA 4NMTA 4JOKA 1L6OA 3K1RA 1UM7A 3GCNA 1VA8A 3RL8A 2LUIA 3GDSA 3VQGA 3CS0A 5I7ZA 3GJ9A 4JJ0A 4GHNA 2EEIA 2ENOA 4NXQA 2IWNA 3NGHA 2IWPA 1UEWA 5B42A 2KJDA 3SUZA 4JL7A 2EEGA 1UJVA 1UEPA 3I4WA 2AINA 3GDVA 4Q6HA 4JOHA 3CBZA 1YBOA 2PNTA 3ID4A 1OBZA 1UJDA 2G5MB 2JWEA 1U39A 3B76A 4E3BA 1D5GA 5GLJA 3HPMA 2D92A 2LOBA 4H11A 1MFLA 1QLCA 1T2MA 3ID1A 3VQFA 3WKMA 1U38A 1G9OA 2OMJA 1KY9A 2LA8A 1VB7A 4OEPA 4R2ZA 5HFEA 4HOPB 4K78A 4KFWA 4KFVA 4JOFA 4L8NA 2VPHA 1V6BA 2KA9A 1QAVA 3E17A 4Z8JA 3DJ3A 1X5QA 1Y7NA 1N6FA 4YYXA 2YT7A 1V62A 1X5NA 2EGNA 3PS4A 5HFBA 4NMRA 1GQ5A 1WFGA 2QT5A 3GCOA 3TSZA 5E6PB 2EDPA 5HFCA 5HFDA 2F0AA 2Z9IA 2P3WA 2JSNA 1W9OA 4NMQA 2IWOA 2M0TA 3CBYA 1UFXA 2VZ5A 1NF3C 1WI4A 2H3MA 1B8QA 2R3YA 3KDGA 2OZFA 3GABA 4NXPA 1IHJA 2CSJA 3R0HA 2EV8A 2I0LA 2I1NA 2EDZA 2W7RA 3CYYA 5ILBA 2D90A 4JOPA 1QAUA 2OCSA 5E21A 1W9QA 2KV8A 3PV4A 1I92A 2EAQA 1TQ3A
chains in the Genus database with same CATH topology
1RGWA 2DMZA 3AXAA 2MX6A 2JINA 2KOMA 2OQSA 2MHOA 4N6XA 3GDUA 5E1YA 2L4SA 3RLEA 3DIWA 1X45A 3QGLA 4E35A 2EGOA 4IC6A 2G2LA 4WYUA 5FHTA 4NMOA 2RRMA 2YTWA 3KZDA 3OTPA 2AWWA 3ID2A 5HEDA 5HETA 1WH1A 1N7FA 5G1DA 2KG2A 1V5LA 4UU5A 1TP5A 2CS5A 2QG1A 2KBSA 4LMMA 3HPKA 1GM1A 2WL7A 4F8KA 2HE4A 4OEOA 5EZ0A 2JREA 3FY5A 1Q3PA 1TE0A 2O2TA 2JIKA 2KQFA 2M3MA 4UU6A 1W9EA 1M5ZA 2V90A 1X9ZA 4REYA 4HOPA 2DAZA 2KRGA 2DC2A 5HF1A 2K20A 2H2BA 3HVQC 1LCYA 2ZPMA 1FCFA 2H3LA 4O06A 3GSLA 2DLUA 5HFFA 3CBXA 1MFGA 5HF4A 1OZIA 1NTEA 2M0UA 2R4HA 2M10A 2EGKA 2DB5A 3KHFA 5EYZA 2I4SA 3DJ1A 2Q3GA 1V5QA 1VAEA 1U37A 3JXTA 4G69A 1Z86A 1WHAA 2VSPA 1RZXA 3K50A 1BE9A 2DM8A 4NXRA 5E22A 3R68A 5HEYA 2OGPA 1N6DA 4JOGA 2PKUA 4YDPA 1OBXA 2YUYA 2Z17A 4NNLA 3TMHA 1V1TA 2REYA 3OU0A 2FE5A 2RCZA 2KOHA 1VJ6A 2YUBA 2GEFA 5DTHA 5HJ1A 2E7KA 5B6LA 3QE1A 4E34A 3R69A 2EXGA 1ZUBA 1SOTA 2PKTA 3QJNA 1WI2A 2I04A 3BPUA 1WHDA 4FGMA 4Q6SA 1N6EA 5HEBA 4NNMA 4NMVA 3QJMA 2JOAA 2M0ZA 4K76A 2OSGA 2JXOA 4JORA 3STJA 3L4FD 2QKVA 1WIFA 1GQ4A 1UITA 2OS6A 1BFEA 1TP3A 1N99A 1UEZA 2VSVA 3CH8A 4Q2QA 1KWAA 1U3BA 2JILA 1N7TA 1UF1A 2KJKA 1VCWA 4FLNA 3LNXA 1WFVA 3NCVA 2VRFA 2KOJA 4NMSA 2H2CA 3O46A 2DLSA 3QO6A 5JXBA 1P1EA 1UEQA 2LC6A 3GGEA 3KZEA 2L97A 2F5YA 1SOZA 2VWRA 2V1WA 3NFLA 3SFJA 4PQWA 5IL9A 2DKRA 5HDYA 3O5NA 4NMPA 1WJLA 3KDKA 4WYTA 2W4FA 4EDJA 2CSSA 4Q2OA 5GNDA 4K6YA 1UJUA 1OBYA 2KAWA 3DJAA 4JOJA 3MH4A 1R6JA 5D13A 1KEFA 2AWUA 2KPLA 3SHWA 2KPKA 2ZPLA 2I6VA 1FC6A 3LNYA 3NFKA 3TSVA 2DJTA 2K1ZA 2L4TA 1WG6A 3PV2A 2IWQA 4Q2NA 1FC7A 3I18A 2I0IA 4P2AB 3QDOA 5E11A 2EEHA 3EGGC 2D8IA 2OPGA 3SOEA 1Q7XA 2PZDA 4JJ3A 2AWXA 1IU0A 5G1EA 4Q2PA 2BYGA 3K82A 2HE2A 1X5RA 1X6DA 3PV5A 2KJPA 3SHUA 2PA1A 2KYLA 3EGHC 2QBWA 3RL7A 3PDVA 2Q9VA 1WF7A 4K75A 1PDRA 5H3JA 1IU2A 2YT8A 4GVDA 2PDZA 1ZOKA 3MH7A 1FC9A 5FB8C 1QAVB 3TSWA 2EJYA 1Y8TA 2FCFA 2EHRA 4Q3HA 4K72A 1I16A 2M0VA 1RY4A 1Q3OA 2FNEA 4AMHA 4GVCA 4RI0A 1N7EA 3PDZA 1K32A 3ID3A 3I1EA 3CC0A 2QKTA 1P1DA 2LC7A 1UM1A 4XHVA 3WKLA 1MC7A 2FN5A 2X7ZA 4MPAA 1WF8A 3MH6A 2UZCA 4OAJA 1RGRA 5A2PA 2KL1A 5F3XA 3QIKA 5F67A 2QKUA 3ZRTA 4Z33A 1X8SA 2EDVA 2GZVA 1Z87A 2HGAA 1XZ9A 3DORA 4JOEA 2EEJA 1UHPA 4P0CA 4NMTA 4JOKA 1L6OA 3K1RA 1UM7A 3GCNA 1VA8A 3RL8A 2LUIA 3GDSA 3VQGA 3CS0A 5I7ZA 3GJ9A 4JJ0A 4GHNA 2EEIA 2ENOA 4NXQA 2IWNA 3NGHA 2IWPA 1UEWA 5B42A 2KJDA 3SUZA 4JL7A 2EEGA 1UJVA 1UEPA 3I4WA 2AINA 3GDVA 4Q6HA 4JOHA 3CBZA 1YBOA 2PNTA 3ID4A 1OBZA 1UJDA 2G5MB 2JWEA 1U39A 3B76A 4E3BA 1D5GA 5GLJA 3HPMA 2D92A 2LOBA 4H11A 1MFLA 1QLCA 1T2MA 3ID1A 3VQFA 3WKMA 1U38A 1G9OA 2OMJA 1KY9A 2LA8A 1VB7A 4OEPA 4R2ZA 5HFEA 4HOPB 4K78A 4KFWA 4KFVA 4JOFA 4L8NA 2VPHA 1V6BA 2KA9A 1QAVA 3E17A 4Z8JA 3DJ3A 1X5QA 1Y7NA 1N6FA 4YYXA 2YT7A 1V62A 1X5NA 2EGNA 3PS4A 5HFBA 4NMRA 1GQ5A 1WFGA 2QT5A 3GCOA 3TSZA 5E6PB 2EDPA 5HFCA 5HFDA 2F0AA 2Z9IA 2P3WA 2JSNA 1W9OA 4NMQA 2IWOA 2M0TA 3CBYA 1UFXA 2VZ5A 1NF3C 1WI4A 2H3MA 1B8QA 2R3YA 3KDGA 2OZFA 3GABA 4NXPA 1IHJA 2CSJA 3R0HA 2EV8A 2I0LA 2I1NA 2EDZA 2W7RA 3CYYA 5ILBA 2D90A 4JOPA 1QAUA 2OCSA 5E21A 1W9QA 2KV8A 3PV4A 1I92A 2EAQA 1TQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGW A;  2DMZ A;  3AXA A;  2MX6 A;  2JIN A;  2KOM A;  2OQS A;  2MHO A;  4N6X A;  3GDU A;  5E1Y A;  2L4S A;  3RLE A;  3DIW A;  1X45 A;  3QGL A;  4E35 A;  2EGO A;  4IC6 A;  2G2L A;  4WYU A;  5FHT A;  4NMO A;  2RRM A;  2YTW A;  3KZD A;  3OTP A;  2AWW A;  3ID2 A;  5HED A;  5HET A;  1WH1 A;  1N7F A;  5G1D A;  2KG2 A;  1V5L A;  4UU5 A;  1TP5 A;  2CS5 A;  2QG1 A;  2KBS A;  4LMM A;  3HPK A;  1GM1 A;  2WL7 A;  4F8K A;  2HE4 A;  4OEO A;  5EZ0 A;  2JRE A;  3FY5 A;  1Q3P A;  1TE0 A;  2O2T A;  2JIK A;  2KQF A;  2M3M A;  4UU6 A;  1W9E A;  1M5Z A;  2V90 A;  4REY A;  4HOP A;  2DAZ A;  2KRG A;  2DC2 A;  5HF1 A;  2K20 A;  2H2B A;  3HVQ C;  1LCY A;  2ZPM A;  1FCF A;  2H3L A;  4O06 A;  3GSL A;  2DLU A;  5HFF A;  3CBX A;  1MFG A;  5HF4 A;  1OZI A;  1NTE A;  2M0U A;  2R4H A;  2M10 A;  2EGK A;  2DB5 A;  3KHF A;  5EYZ A;  2I4S A;  3DJ1 A;  2Q3G A;  1V5Q A;  1VAE A;  1U37 A;  3JXT A;  4G69 A;  1Z86 A;  1WHA A;  2VSP A;  1RZX A;  3K50 A;  1BE9 A;  2DM8 A;  4NXR A;  5E22 A;  3R68 A;  5HEY A;  2OGP A;  1N6D A;  4JOG A;  2PKU A;  4YDP A;  1OBX A;  2YUY A;  2Z17 A;  4NNL A;  3TMH A;  1V1T A;  2REY A;  3OU0 A;  2FE5 A;  2RCZ A;  2KOH A;  1VJ6 A;  2YUB A;  5DTH A;  5HJ1 A;  2E7K A;  5B6L A;  3QE1 A;  4E34 A;  3R69 A;  2EXG A;  1ZUB A;  1SOT A;  2PKT A;  3QJN A;  1WI2 A;  2I04 A;  3BPU A;  1WHD A;  4FGM A;  4Q6S A;  1N6E A;  5HEB A;  4NNM A;  4NMV A;  3QJM A;  2JOA A;  2M0Z A;  4K76 A;  2OSG A;  2JXO A;  4JOR A;  3STJ A;  3L4F D;  2QKV A;  1WIF A;  1GQ4 A;  1UIT A;  2OS6 A;  1BFE A;  1TP3 A;  1N99 A;  1UEZ A;  2VSV A;  3CH8 A;  4Q2Q A;  1KWA A;  1U3B A;  2JIL A;  1N7T A;  1UF1 A;  2KJK A;  1VCW A;  3LNX A;  1WFV A;  2VRF A;  2KOJ A;  4NMS A;  2H2C A;  3O46 A;  2DLS A;  3QO6 A;  5JXB A;  1P1E A;  1UEQ A;  2LC6 A;  3GGE A;  3KZE A;  2L97 A;  2F5Y A;  1SOZ A;  2VWR A;  2V1W A;  3NFL A;  3SFJ A;  4PQW A;  2DKR A;  5HDY A;  3O5N A;  4NMP A;  1WJL A;  4WYT A;  2W4F A;  4EDJ A;  2CSS A;  4Q2O A;  5GND A;  4K6Y A;  1UJU A;  1OBY A;  2KAW A;  3DJA A;  4JOJ A;  3MH4 A;  1R6J A;  5D13 A;  1KEF A;  2AWU A;  2KPL A;  3SHW A;  2KPK A;  2ZPL A;  2I6V A;  1FC6 A;  3LNY A;  3NFK A;  3TSV A;  2DJT A;  2K1Z A;  2L4T A;  1WG6 A;  3PV2 A;  2IWQ A;  4Q2N A;  1FC7 A;  3I18 A;  2I0I A;  4P2A B;  3QDO A;  5E11 A;  2EEH A;  3EGG C;  2D8I A;  2OPG A;  3SOE A;  1Q7X A;  2PZD A;  2AWX A;  1IU0 A;  5G1E A;  4Q2P A;  2BYG A;  3K82 A;  2HE2 A;  1X5R A;  1X6D A;  3PV5 A;  2KJP A;  3SHU A;  2PA1 A;  2KYL A;  3EGH C;  2QBW A;  3RL7 A;  3PDV A;  2Q9V A;  1WF7 A;  4K75 A;  1PDR A;  5H3J A;  1IU2 A;  2YT8 A;  4GVD A;  2PDZ A;  1ZOK A;  3MH7 A;  1FC9 A;  5FB8 C;  1QAV B;  3TSW A;  2EJY A;  1Y8T A;  2FCF A;  2EHR A;  4Q3H A;  4K72 A;  1I16 A;  2M0V A;  1RY4 A;  1Q3O A;  2FNE A;  4AMH A;  4GVC A;  4RI0 A;  1N7E A;  3PDZ A;  1K32 A;  3ID3 A;  3I1E A;  3CC0 A;  2QKT A;  1P1D A;  2LC7 A;  1UM1 A;  4XHV A;  3WKL A;  1MC7 A;  2FN5 A;  2X7Z A;  4MPA A;  1WF8 A;  3MH6 A;  2UZC A;  4OAJ A;  1RGR A;  5A2P A;  2KL1 A;  5F3X A;  3QIK A;  5F67 A;  2QKU A;  3ZRT A;  4Z33 A;  1X8S A;  2EDV A;  2GZV A;  1Z87 A;  2HGA A;  1XZ9 A;  3DOR A;  4JOE A;  2EEJ A;  1UHP A;  4P0C A;  4NMT A;  4JOK A;  1L6O A;  3K1R A;  1UM7 A;  3GCN A;  1VA8 A;  3RL8 A;  2LUI A;  3GDS A;  3VQG A;  3CS0 A;  5I7Z A;  3GJ9 A;  4GHN A;  2EEI A;  2ENO A;  4NXQ A;  2IWN A;  3NGH A;  2IWP A;  1UEW A;  2KJD A;  3SUZ A;  4JL7 A;  2EEG A;  1UJV A;  1UEP A;  3I4W A;  2AIN A;  3GDV A;  4Q6H A;  4JOH A;  3CBZ A;  1YBO A;  2PNT A;  3ID4 A;  1OBZ A;  1UJD A;  2G5M B;  2JWE A;  1U39 A;  3B76 A;  4E3B A;  1D5G A;  5GLJ A;  3HPM A;  2D92 A;  2LOB A;  4H11 A;  1MFL A;  1QLC A;  1T2M A;  3ID1 A;  3VQF A;  3WKM A;  1U38 A;  1G9O A;  2OMJ A;  1KY9 A;  2LA8 A;  1VB7 A;  4OEP A;  4R2Z A;  5HFE A;  4HOP B;  4K78 A;  4KFW A;  4KFV A;  4JOF A;  4L8N A;  2VPH A;  1V6B A;  2KA9 A;  1QAV A;  3E17 A;  4Z8J A;  3DJ3 A;  1X5Q A;  1Y7N A;  1N6F A;  4YYX A;  2YT7 A;  1V62 A;  1X5N A;  2EGN A;  3PS4 A;  5HFB A;  4NMR A;  1GQ5 A;  1WFG A;  2QT5 A;  3GCO A;  3TSZ A;  5E6P B;  2EDP A;  5HFC A;  5HFD A;  2F0A A;  2Z9I A;  2P3W A;  1W9O A;  4NMQ A;  2IWO A;  2M0T A;  3CBY A;  1UFX A;  2VZ5 A;  1NF3 C;  1WI4 A;  2H3M A;  1B8Q A;  2R3Y A;  2OZF A;  4NXP A;  1IHJ A;  2CSJ A;  3R0H A;  2EV8 A;  2I0L A;  2I1N A;  2EDZ A;  2W7R A;  3CYY A;  2D90 A;  4JOP A;  1QAU A;  2OCS A;  5E21 A;  1W9Q A;  2KV8 A;  3PV4 A;  1I92 A;  2EAQ A;  1TQ3 A; 
#chains in the Genus database with same CATH topology
 1RGW A;  2DMZ A;  3AXA A;  2MX6 A;  2JIN A;  2KOM A;  2OQS A;  2MHO A;  4N6X A;  3GDU A;  5E1Y A;  2L4S A;  3RLE A;  3DIW A;  1X45 A;  3QGL A;  4E35 A;  2EGO A;  4IC6 A;  2G2L A;  4WYU A;  5FHT A;  4NMO A;  2RRM A;  2YTW A;  3KZD A;  3OTP A;  2AWW A;  3ID2 A;  5HED A;  5HET A;  1WH1 A;  1N7F A;  5G1D A;  2KG2 A;  1V5L A;  4UU5 A;  1TP5 A;  2CS5 A;  2QG1 A;  2KBS A;  4LMM A;  3HPK A;  1GM1 A;  2WL7 A;  4F8K A;  2HE4 A;  4OEO A;  5EZ0 A;  2JRE A;  3FY5 A;  1Q3P A;  1TE0 A;  2O2T A;  2JIK A;  2KQF A;  2M3M A;  4UU6 A;  1W9E A;  1M5Z A;  2V90 A;  1X9Z A;  4REY A;  4HOP A;  2DAZ A;  2KRG A;  2DC2 A;  5HF1 A;  2K20 A;  2H2B A;  3HVQ C;  1LCY A;  2ZPM A;  1FCF A;  2H3L A;  4O06 A;  3GSL A;  2DLU A;  5HFF A;  3CBX A;  1MFG A;  5HF4 A;  1OZI A;  1NTE A;  2M0U A;  2R4H A;  2M10 A;  2EGK A;  2DB5 A;  3KHF A;  5EYZ A;  2I4S A;  3DJ1 A;  2Q3G A;  1V5Q A;  1VAE A;  1U37 A;  3JXT A;  4G69 A;  1Z86 A;  1WHA A;  2VSP A;  1RZX A;  3K50 A;  1BE9 A;  2DM8 A;  4NXR A;  5E22 A;  3R68 A;  5HEY A;  2OGP A;  1N6D A;  4JOG A;  2PKU A;  4YDP A;  1OBX A;  2YUY A;  2Z17 A;  4NNL A;  3TMH A;  1V1T A;  2REY A;  3OU0 A;  2FE5 A;  2RCZ A;  2KOH A;  1VJ6 A;  2YUB A;  2GEF A;  5DTH A;  5HJ1 A;  2E7K A;  5B6L A;  3QE1 A;  4E34 A;  3R69 A;  2EXG A;  1ZUB A;  1SOT A;  2PKT A;  3QJN A;  1WI2 A;  2I04 A;  3BPU A;  1WHD A;  4FGM A;  4Q6S A;  1N6E A;  5HEB A;  4NNM A;  4NMV A;  3QJM A;  2JOA A;  2M0Z A;  4K76 A;  2OSG A;  2JXO A;  4JOR A;  3STJ A;  3L4F D;  2QKV A;  1WIF A;  1GQ4 A;  1UIT A;  2OS6 A;  1BFE A;  1TP3 A;  1N99 A;  1UEZ A;  2VSV A;  3CH8 A;  4Q2Q A;  1KWA A;  1U3B A;  2JIL A;  1N7T A;  1UF1 A;  2KJK A;  1VCW A;  4FLN A;  3LNX A;  1WFV A;  3NCV A;  2VRF A;  2KOJ A;  4NMS A;  2H2C A;  3O46 A;  2DLS A;  3QO6 A;  5JXB A;  1P1E A;  1UEQ A;  2LC6 A;  3GGE A;  3KZE A;  2L97 A;  2F5Y A;  1SOZ A;  2VWR A;  2V1W A;  3NFL A;  3SFJ A;  4PQW A;  5IL9 A;  2DKR A;  5HDY A;  3O5N A;  4NMP A;  1WJL A;  3KDK A;  4WYT A;  2W4F A;  4EDJ A;  2CSS A;  4Q2O A;  5GND A;  4K6Y A;  1UJU A;  1OBY A;  2KAW A;  3DJA A;  4JOJ A;  3MH4 A;  1R6J A;  5D13 A;  1KEF A;  2AWU A;  2KPL A;  3SHW A;  2KPK A;  2ZPL A;  2I6V A;  1FC6 A;  3LNY A;  3NFK A;  3TSV A;  2DJT A;  2K1Z A;  2L4T A;  1WG6 A;  3PV2 A;  2IWQ A;  4Q2N A;  1FC7 A;  3I18 A;  2I0I A;  4P2A B;  3QDO A;  5E11 A;  2EEH A;  3EGG C;  2D8I A;  2OPG A;  3SOE A;  1Q7X A;  2PZD A;  4JJ3 A;  2AWX A;  1IU0 A;  5G1E A;  4Q2P A;  2BYG A;  3K82 A;  2HE2 A;  1X5R A;  1X6D A;  3PV5 A;  2KJP A;  3SHU A;  2PA1 A;  2KYL A;  3EGH C;  2QBW A;  3RL7 A;  3PDV A;  2Q9V A;  1WF7 A;  4K75 A;  1PDR A;  5H3J A;  1IU2 A;  2YT8 A;  4GVD A;  2PDZ A;  1ZOK A;  3MH7 A;  1FC9 A;  5FB8 C;  1QAV B;  3TSW A;  2EJY A;  1Y8T A;  2FCF A;  2EHR A;  4Q3H A;  4K72 A;  1I16 A;  2M0V A;  1RY4 A;  1Q3O A;  2FNE A;  4AMH A;  4GVC A;  4RI0 A;  1N7E A;  3PDZ A;  1K32 A;  3ID3 A;  3I1E A;  3CC0 A;  2QKT A;  1P1D A;  2LC7 A;  1UM1 A;  4XHV A;  3WKL A;  1MC7 A;  2FN5 A;  2X7Z A;  4MPA A;  1WF8 A;  3MH6 A;  2UZC A;  4OAJ A;  1RGR A;  5A2P A;  2KL1 A;  5F3X A;  3QIK A;  5F67 A;  2QKU A;  3ZRT A;  4Z33 A;  1X8S A;  2EDV A;  2GZV A;  1Z87 A;  2HGA A;  1XZ9 A;  3DOR A;  4JOE A;  2EEJ A;  1UHP A;  4P0C A;  4NMT A;  4JOK A;  1L6O A;  3K1R A;  1UM7 A;  3GCN A;  1VA8 A;  3RL8 A;  2LUI A;  3GDS A;  3VQG A;  3CS0 A;  5I7Z A;  3GJ9 A;  4JJ0 A;  4GHN A;  2EEI A;  2ENO A;  4NXQ A;  2IWN A;  3NGH A;  2IWP A;  1UEW A;  5B42 A;  2KJD A;  3SUZ A;  4JL7 A;  2EEG A;  1UJV A;  1UEP A;  3I4W A;  2AIN A;  3GDV A;  4Q6H A;  4JOH A;  3CBZ A;  1YBO A;  2PNT A;  3ID4 A;  1OBZ A;  1UJD A;  2G5M B;  2JWE A;  1U39 A;  3B76 A;  4E3B A;  1D5G A;  5GLJ A;  3HPM A;  2D92 A;  2LOB A;  4H11 A;  1MFL A;  1QLC A;  1T2M A;  3ID1 A;  3VQF A;  3WKM A;  1U38 A;  1G9O A;  2OMJ A;  1KY9 A;  2LA8 A;  1VB7 A;  4OEP A;  4R2Z A;  5HFE A;  4HOP B;  4K78 A;  4KFW A;  4KFV A;  4JOF A;  4L8N A;  2VPH A;  1V6B A;  2KA9 A;  1QAV A;  3E17 A;  4Z8J A;  3DJ3 A;  1X5Q A;  1Y7N A;  1N6F A;  4YYX A;  2YT7 A;  1V62 A;  1X5N A;  2EGN A;  3PS4 A;  5HFB A;  4NMR A;  1GQ5 A;  1WFG A;  2QT5 A;  3GCO A;  3TSZ A;  5E6P B;  2EDP A;  5HFC A;  5HFD A;  2F0A A;  2Z9I A;  2P3W A;  2JSN A;  1W9O A;  4NMQ A;  2IWO A;  2M0T A;  3CBY A;  1UFX A;  2VZ5 A;  1NF3 C;  1WI4 A;  2H3M A;  1B8Q A;  2R3Y A;  3KDG A;  2OZF A;  3GAB A;  4NXP A;  1IHJ A;  2CSJ A;  3R0H A;  2EV8 A;  2I0L A;  2I1N A;  2EDZ A;  2W7R A;  3CYY A;  5ILB A;  2D90 A;  4JOP A;  1QAU A;  2OCS A;  5E21 A;  1W9Q A;  2KV8 A;  3PV4 A;  1I92 A;  2EAQ A;  1TQ3 A; 
#chains in the Genus database with same CATH homology
 1RGW A;  2DMZ A;  3AXA A;  2MX6 A;  2JIN A;  2KOM A;  2OQS A;  2MHO A;  4N6X A;  3GDU A;  5E1Y A;  2L4S A;  3RLE A;  3DIW A;  1X45 A;  3QGL A;  4E35 A;  2EGO A;  4IC6 A;  2G2L A;  4WYU A;  5FHT A;  4NMO A;  2RRM A;  2YTW A;  3KZD A;  3OTP A;  2AWW A;  3ID2 A;  5HED A;  5HET A;  1WH1 A;  1N7F A;  5G1D A;  2KG2 A;  1V5L A;  4UU5 A;  1TP5 A;  2CS5 A;  2QG1 A;  2KBS A;  4LMM A;  3HPK A;  1GM1 A;  2WL7 A;  4F8K A;  2HE4 A;  4OEO A;  5EZ0 A;  2JRE A;  3FY5 A;  1Q3P A;  1TE0 A;  2O2T A;  2JIK A;  2KQF A;  2M3M A;  4UU6 A;  1W9E A;  1M5Z A;  2V90 A;  1X9Z A;  4REY A;  4HOP A;  2DAZ A;  2KRG A;  2DC2 A;  5HF1 A;  2K20 A;  2H2B A;  3HVQ C;  1LCY A;  2ZPM A;  1FCF A;  2H3L A;  4O06 A;  3GSL A;  2DLU A;  5HFF A;  3CBX A;  1MFG A;  5HF4 A;  1OZI A;  1NTE A;  2M0U A;  2R4H A;  2M10 A;  2EGK A;  2DB5 A;  3KHF A;  5EYZ A;  2I4S A;  3DJ1 A;  2Q3G A;  1V5Q A;  1VAE A;  1U37 A;  3JXT A;  4G69 A;  1Z86 A;  1WHA A;  2VSP A;  1RZX A;  3K50 A;  1BE9 A;  2DM8 A;  4NXR A;  5E22 A;  3R68 A;  5HEY A;  2OGP A;  1N6D A;  4JOG A;  2PKU A;  4YDP A;  1OBX A;  2YUY A;  2Z17 A;  4NNL A;  3TMH A;  1V1T A;  2REY A;  3OU0 A;  2FE5 A;  2RCZ A;  2KOH A;  1VJ6 A;  2YUB A;  2GEF A;  5DTH A;  5HJ1 A;  2E7K A;  5B6L A;  3QE1 A;  4E34 A;  3R69 A;  2EXG A;  1ZUB A;  1SOT A;  2PKT A;  3QJN A;  1WI2 A;  2I04 A;  3BPU A;  1WHD A;  4FGM A;  4Q6S A;  1N6E A;  5HEB A;  4NNM A;  4NMV A;  3QJM A;  2JOA A;  2M0Z A;  4K76 A;  2OSG A;  2JXO A;  4JOR A;  3STJ A;  3L4F D;  2QKV A;  1WIF A;  1GQ4 A;  1UIT A;  2OS6 A;  1BFE A;  1TP3 A;  1N99 A;  1UEZ A;  2VSV A;  3CH8 A;  4Q2Q A;  1KWA A;  1U3B A;  2JIL A;  1N7T A;  1UF1 A;  2KJK A;  1VCW A;  4FLN A;  3LNX A;  1WFV A;  3NCV A;  2VRF A;  2KOJ A;  4NMS A;  2H2C A;  3O46 A;  2DLS A;  3QO6 A;  5JXB A;  1P1E A;  1UEQ A;  2LC6 A;  3GGE A;  3KZE A;  2L97 A;  2F5Y A;  1SOZ A;  2VWR A;  2V1W A;  3NFL A;  3SFJ A;  4PQW A;  5IL9 A;  2DKR A;  5HDY A;  3O5N A;  4NMP A;  1WJL A;  3KDK A;  4WYT A;  2W4F A;  4EDJ A;  2CSS A;  4Q2O A;  5GND A;  4K6Y A;  1UJU A;  1OBY A;  2KAW A;  3DJA A;  4JOJ A;  3MH4 A;  1R6J A;  5D13 A;  1KEF A;  2AWU A;  2KPL A;  3SHW A;  2KPK A;  2ZPL A;  2I6V A;  1FC6 A;  3LNY A;  3NFK A;  3TSV A;  2DJT A;  2K1Z A;  2L4T A;  1WG6 A;  3PV2 A;  2IWQ A;  4Q2N A;  1FC7 A;  3I18 A;  2I0I A;  4P2A B;  3QDO A;  5E11 A;  2EEH A;  3EGG C;  2D8I A;  2OPG A;  3SOE A;  1Q7X A;  2PZD A;  4JJ3 A;  2AWX A;  1IU0 A;  5G1E A;  4Q2P A;  2BYG A;  3K82 A;  2HE2 A;  1X5R A;  1X6D A;  3PV5 A;  2KJP A;  3SHU A;  2PA1 A;  2KYL A;  3EGH C;  2QBW A;  3RL7 A;  3PDV A;  2Q9V A;  1WF7 A;  4K75 A;  1PDR A;  5H3J A;  1IU2 A;  2YT8 A;  4GVD A;  2PDZ A;  1ZOK A;  3MH7 A;  1FC9 A;  5FB8 C;  1QAV B;  3TSW A;  2EJY A;  1Y8T A;  2FCF A;  2EHR A;  4Q3H A;  4K72 A;  1I16 A;  2M0V A;  1RY4 A;  1Q3O A;  2FNE A;  4AMH A;  4GVC A;  4RI0 A;  1N7E A;  3PDZ A;  1K32 A;  3ID3 A;  3I1E A;  3CC0 A;  2QKT A;  1P1D A;  2LC7 A;  1UM1 A;  4XHV A;  3WKL A;  1MC7 A;  2FN5 A;  2X7Z A;  4MPA A;  1WF8 A;  3MH6 A;  2UZC A;  4OAJ A;  1RGR A;  5A2P A;  2KL1 A;  5F3X A;  3QIK A;  5F67 A;  2QKU A;  3ZRT A;  4Z33 A;  1X8S A;  2EDV A;  2GZV A;  1Z87 A;  2HGA A;  1XZ9 A;  3DOR A;  4JOE A;  2EEJ A;  1UHP A;  4P0C A;  4NMT A;  4JOK A;  1L6O A;  3K1R A;  1UM7 A;  3GCN A;  1VA8 A;  3RL8 A;  2LUI A;  3GDS A;  3VQG A;  3CS0 A;  5I7Z A;  3GJ9 A;  4JJ0 A;  4GHN A;  2EEI A;  2ENO A;  4NXQ A;  2IWN A;  3NGH A;  2IWP A;  1UEW A;  5B42 A;  2KJD A;  3SUZ A;  4JL7 A;  2EEG A;  1UJV A;  1UEP A;  3I4W A;  2AIN A;  3GDV A;  4Q6H A;  4JOH A;  3CBZ A;  1YBO A;  2PNT A;  3ID4 A;  1OBZ A;  1UJD A;  2G5M B;  2JWE A;  1U39 A;  3B76 A;  4E3B A;  1D5G A;  5GLJ A;  3HPM A;  2D92 A;  2LOB A;  4H11 A;  1MFL A;  1QLC A;  1T2M A;  3ID1 A;  3VQF A;  3WKM A;  1U38 A;  1G9O A;  2OMJ A;  1KY9 A;  2LA8 A;  1VB7 A;  4OEP A;  4R2Z A;  5HFE A;  4HOP B;  4K78 A;  4KFW A;  4KFV A;  4JOF A;  4L8N A;  2VPH A;  1V6B A;  2KA9 A;  1QAV A;  3E17 A;  4Z8J A;  3DJ3 A;  1X5Q A;  1Y7N A;  1N6F A;  4YYX A;  2YT7 A;  1V62 A;  1X5N A;  2EGN A;  3PS4 A;  5HFB A;  4NMR A;  1GQ5 A;  1WFG A;  2QT5 A;  3GCO A;  3TSZ A;  5E6P B;  2EDP A;  5HFC A;  5HFD A;  2F0A A;  2Z9I A;  2P3W A;  2JSN A;  1W9O A;  4NMQ A;  2IWO A;  2M0T A;  3CBY A;  1UFX A;  2VZ5 A;  1NF3 C;  1WI4 A;  2H3M A;  1B8Q A;  2R3Y A;  3KDG A;  2OZF A;  3GAB A;  4NXP A;  1IHJ A;  2CSJ A;  3R0H A;  2EV8 A;  2I0L A;  2I1N A;  2EDZ A;  2W7R A;  3CYY A;  5ILB A;  2D90 A;  4JOP A;  1QAU A;  2OCS A;  5E21 A;  1W9Q A;  2KV8 A;  3PV4 A;  1I92 A;  2EAQ A;  1TQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...