3QDOA

Crystal structure of pdz domain of sorting nexin 27 (snx27) fused to the gly-gly linker followed by c-terminal (eseskv) of girk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVGGESESKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-27, G protein-activated inward rectifier potas
publication title Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3qdoA00
5HFCA 5HJ1A 5B6LA 2O2TA 1M5ZA 1TP5A 3I18A 1GQ5A 1N7FA 5G1DA 1KY9A 1L6OA 2EEHA 5HFBA 2DJTA 2JXOA 1UJUA 3EGGC 2KJKA 2Z9IA 3E17A 2PKTA 3ID4A 1U38A 2HE4A 5GLJA 4NMRA 4K72A 2G2LA 2M0UA 4WYTA 5HF1A 1N6EA 2EDVA 5FB8C 2OQSA 2F0AA 5HEYA 2KRGA 4JOPA 2IWQA 2DB5A 3CYYA 4LMMA 2EDPA 1KWAA 1N7EA 4Q3HA 2QKUA 1FC9A 2EGOA 4PQWA 2EEJA 2YTWA 2YUYA 5HEBA 2KL1A 2OGPA 1V62A 3K50A 5E11A 1RY4A 2W7RA 2IWOA 3DJAA 2GZVA 1WI4A 4Q6HA 4JOEA 2EHRA 2MHOA 4K6YA 2PA1A 3ID3A 2QBWA 3CBZA 4GVDA 4YYXA 4OAJA 4Q2PA 4Q2QA 2KAWA 1I16A 2LC7A 3MH4A 2FNEA 1TP3A 4EDJA 4P2AB 2ZPMA 4E35A 2BYGA 2P3WA 3RLEA 4NXQA 3WKLA 1NF3C 5H3JA 1QAUA 2KA9A 1N6DA 4NXRA 5GNDA 1FC6A 2VSVA 4UU6A 1WF8A 1UEPA 2E7KA 1RZXA 2KOHA 1GM1A 1T2MA 3K1RA 5F3XA 5E21A 1WJLA 2RCZA 5A2PA 2OS6A 2X7ZA 2V1WA 2DAZA 3GGEA 3K82A 2DC2A 3PDZA 2FCFA 4KFVA 1ZOKA 4NMQA 1BFEA 2EXGA 3I1EA 3TMHA 3SHWA 1GQ4A 3O46A 1UFXA 3FY5A 1K32A 3HVQC 3PV4A 1UM1A 2FE5A 3CBXA 2KOJA 2V90A 3KHFA 2KV8A 2OCSA 2UZCA 1SOZA 3QJMA 4P0CA 2REYA 2K1ZA 2AINA 2JIKA 1KEFA 2EEGA 1YBOA 4G69A 1U37A 3QDOA 4JORA 3GJ9A 3GCOA 1U39A 4K76A 2CSJA 1VJ6A 2VRFA 3R68A 4F8KA 1V5QA 4UU5A 2HGAA 4OEPA 3GDSA 4Q2OA 2EGKA 2CS5A 1WIFA 1WG6A 2KYLA 1W9OA 1D5GA 1RGRA 2ENOA 2QKVA 4RI0A 1IU0A 2I1NA 2VZ5A 3PDVA 2YT7A 2OPGA 1WHAA 2JILA 2EJYA 1X6DA 1G9OA 2I0IA 1UHPA 2LOBA 1TQ3A 2Z17A 4R2ZA 1U3BA 2EDZA 2M0VA 1VAEA 4NNMA 2Q9VA 3HPMA 1IU2A 2L4SA 2DLSA 2JWEA 3KZDA 3PS4A 2Q3GA 2IWPA 2PZDA 2DLUA 2QG1A 3NFLA 3TSVA 1RGWA 5HF4A 2HE2A 2AWUA 2PNTA 2KQFA 4NXPA 3GCNA 2VPHA 2LA8A 2H3LA 2OZFA 4Z8JA 4NMOA 1QAVB 1VCWA 3ID1A 1N6FA 3R69A 4JOKA 2KOMA 1N99A 3KZEA 4YDPA 5E22A 1UF1A 1Q3OA 5EYZA 3JXTA 4NMTA 4NNLA 3SUZA 2M0ZA 1Q3PA 3DJ1A 3GDVA 2JINA 2R3YA 4E3BA 1XZ9A 2H3MA 4JOFA 2D8IA 3QE1A 4JOGA 3TSZA 2R4HA 2FN5A 1R6JA 1BE9A 2CSSA 3SOEA 2YUBA 4IC6A 3ID2A 2AWXA 1NTEA 1OBYA 5HFEA 3WKMA 3B76A 1VA8A 3SHUA 4Q6SA 3DIWA 2G5MB 1V5LA 1Z86A 2AWWA 2ZPLA 4FGMA 4WYUA 1QAVA 3GDUA 1TE0A 1X5RA 2RRMA 1MFLA 4AMHA 1X5NA 1PDRA 4GVCA 4REYA 2M10A 3DJ3A 1MC7A 1X8SA 2DM8A 4L8NA 2YT8A 3AXAA 2EV8A 1OBXA 4JOHA 1SOTA 1WF7A 3R0HA 3CBYA 2QKTA 1MFGA 4HOPB 2KPLA 1UJDA 3GSLA 3PV5A 2LC6A 4XHVA 2VSPA 1LCYA 2IWNA 4OEOA 4JL7A 1V1TA 4Z33A 3SFJA 2D90A 1IHJA 2JREA 3CH8A 1W9QA 1WFGA 3LNYA 3NGHA 1UEQA 3LNXA 5G1EA 1UITA 5F67A 3QGLA 1Q7XA 5DTHA 1WI2A 2EAQA 4NMVA 2H2CA 3NFKA 3VQFA 1WH1A 4HOPA 1UJVA 3VQGA 4NMPA 4NMSA 1ZUBA 2M3MA 2WL7A 3RL8A 4KFWA 1B8QA 2M0TA 4E34A 2OSGA 1VB7A 1OBZA 1FCFA 1FC7A 5JXBA 1UM7A 1UEWA 5I7ZA 1V6BA 1N7TA 2I4SA 2EGNA 2KJPA 5E6PB 4H11A 4JOJA 2VWRA 3QIKA 1UEZA 3BPUA 5HETA 3O5NA 4Q2NA 3ZRTA 2QT5A 3DORA 4GHNA 2K20A 2I0LA 2L97A 2KBSA 3HPKA 3QJNA 1Z87A 5EZ0A 1P1DA 2KJDA 2L4TA 2H2BA 5HDYA 1QLCA 5FHTA 3MH6A 2DMZA 2KPKA 1X5QA 3MH7A 5HEDA 3OU0A 1P1EA 2OMJA 3I4WA 3PV2A 2MX6A 2F5YA 5D13A 2JOAA 1I92A 4MPAA 4O06A 1W9EA 1Y8TA 1WFVA 3L4FD 2PDZA 4K78A 2LUIA 1Y7NA 3TSWA 3CC0A 3RL7A 3STJA 4K75A 5HFFA 2W4FA 4N6XA 2D92A 1OZIA 1X45A 2PKUA 2KG2A 2I04A 2DKRA 2I6VA 1WHDA 3CS0A 5E1YA 3EGHC 5HFDA 3QO6A 2EEIA 3OTPA
chains in the Genus database with same CATH superfamily
5HFCA 5HJ1A 5B6LA 2O2TA 1M5ZA 1TP5A 3I18A 1GQ5A 1N7FA 5G1DA 1KY9A 1L6OA 2EEHA 5HFBA 2DJTA 2JXOA 1UJUA 3EGGC 2KJKA 2Z9IA 3E17A 2PKTA 3ID4A 1U38A 2HE4A 5GLJA 4NMRA 4K72A 2G2LA 2M0UA 4WYTA 5HF1A 1N6EA 2EDVA 5FB8C 2OQSA 2F0AA 5HEYA 2KRGA 4JOPA 2IWQA 2DB5A 3CYYA 4LMMA 2EDPA 4FLNA 1KWAA 1N7EA 4Q3HA 2QKUA 1FC9A 2EGOA 4PQWA 2EEJA 2YTWA 2YUYA 5HEBA 2KL1A 2OGPA 1V62A 3K50A 5E11A 1RY4A 2W7RA 2IWOA 3DJAA 2GZVA 1X9ZA 1WI4A 4Q6HA 4JOEA 2EHRA 2MHOA 4K6YA 2PA1A 3ID3A 2QBWA 3CBZA 4GVDA 4YYXA 4OAJA 4Q2PA 4Q2QA 2KAWA 1I16A 2LC7A 3MH4A 2FNEA 1TP3A 4EDJA 4P2AB 3KDKA 2ZPMA 4E35A 2BYGA 2P3WA 3RLEA 4NXQA 3WKLA 1NF3C 5H3JA 1QAUA 2KA9A 1N6DA 4NXRA 5GNDA 1FC6A 2VSVA 4UU6A 1WF8A 1UEPA 2E7KA 1RZXA 2KOHA 1GM1A 1T2MA 3K1RA 5F3XA 5E21A 1WJLA 2RCZA 5A2PA 2OS6A 2X7ZA 2V1WA 2DAZA 3GGEA 3K82A 2DC2A 3PDZA 2FCFA 4KFVA 1ZOKA 4NMQA 1BFEA 2EXGA 3I1EA 3TMHA 3SHWA 1GQ4A 3O46A 1UFXA 3FY5A 1K32A 3HVQC 3PV4A 1UM1A 2FE5A 3CBXA 2KOJA 2V90A 3KHFA 2KV8A 2OCSA 2UZCA 1SOZA 3QJMA 4P0CA 2REYA 2K1ZA 2AINA 2JIKA 1KEFA 2EEGA 1YBOA 4G69A 1U37A 3QDOA 4JORA 3GJ9A 3GCOA 1U39A 4K76A 2CSJA 1VJ6A 2VRFA 3R68A 4F8KA 1V5QA 4UU5A 2HGAA 4OEPA 3GDSA 4Q2OA 2EGKA 2CS5A 1WIFA 1WG6A 2KYLA 1W9OA 1D5GA 1RGRA 2GEFA 2ENOA 2QKVA 4RI0A 1IU0A 2I1NA 2VZ5A 3PDVA 2YT7A 2OPGA 1WHAA 2JILA 2EJYA 1X6DA 1G9OA 2I0IA 1UHPA 2LOBA 1TQ3A 2Z17A 4R2ZA 1U3BA 2EDZA 2M0VA 1VAEA 4NNMA 2Q9VA 3HPMA 1IU2A 2L4SA 2DLSA 2JWEA 3KZDA 3PS4A 2Q3GA 2IWPA 2PZDA 4JJ3A 2DLUA 2QG1A 3NFLA 3TSVA 1RGWA 5HF4A 2HE2A 2AWUA 2PNTA 2KQFA 4NXPA 3GCNA 2VPHA 2LA8A 2H3LA 2OZFA 4Z8JA 4NMOA 1QAVB 1VCWA 3ID1A 1N6FA 3R69A 4JOKA 2KOMA 1N99A 3KZEA 4YDPA 5E22A 1UF1A 1Q3OA 5EYZA 3JXTA 4NMTA 4NNLA 3SUZA 2M0ZA 1Q3PA 3DJ1A 3GDVA 2JINA 2R3YA 4E3BA 1XZ9A 2H3MA 4JOFA 2D8IA 3QE1A 4JOGA 3TSZA 2R4HA 2FN5A 1R6JA 1BE9A 2CSSA 3SOEA 2YUBA 4IC6A 3ID2A 2AWXA 1NTEA 3KDGA 4JJ0A 1OBYA 5HFEA 3WKMA 3B76A 1VA8A 3SHUA 4Q6SA 3DIWA 2G5MB 1V5LA 1Z86A 2AWWA 2ZPLA 4FGMA 4WYUA 1QAVA 3GDUA 1TE0A 1X5RA 2RRMA 1MFLA 4AMHA 1X5NA 1PDRA 4GVCA 4REYA 2M10A 3DJ3A 1MC7A 1X8SA 2DM8A 4L8NA 2YT8A 3AXAA 2EV8A 1OBXA 4JOHA 1SOTA 1WF7A 3R0HA 3CBYA 2QKTA 1MFGA 4HOPB 2KPLA 1UJDA 3GSLA 3PV5A 2LC6A 4XHVA 2VSPA 5B42A 1LCYA 2IWNA 4OEOA 4JL7A 1V1TA 4Z33A 3SFJA 2D90A 1IHJA 2JREA 3CH8A 1W9QA 1WFGA 3LNYA 3NGHA 1UEQA 3LNXA 5G1EA 1UITA 5F67A 3NCVA 3QGLA 1Q7XA 5DTHA 1WI2A 5IL9A 2EAQA 4NMVA 2H2CA 3NFKA 3VQFA 1WH1A 4HOPA 1UJVA 3VQGA 4NMPA 4NMSA 1ZUBA 2M3MA 2JSNA 2WL7A 3RL8A 4KFWA 1B8QA 2M0TA 4E34A 2OSGA 1VB7A 1OBZA 1FCFA 1FC7A 5JXBA 1UM7A 1UEWA 5I7ZA 1V6BA 1N7TA 2I4SA 2EGNA 2KJPA 5E6PB 4H11A 4JOJA 2VWRA 3QIKA 1UEZA 3BPUA 5HETA 3O5NA 4Q2NA 3ZRTA 2QT5A 3DORA 4GHNA 2K20A 2I0LA 2L97A 2KBSA 3HPKA 3QJNA 1Z87A 5EZ0A 3GABA 1P1DA 2KJDA 2L4TA 2H2BA 5HDYA 1QLCA 5FHTA 3MH6A 2DMZA 2KPKA 1X5QA 3MH7A 5HEDA 3OU0A 1P1EA 2OMJA 3I4WA 3PV2A 2MX6A 2F5YA 5D13A 2JOAA 1I92A 4MPAA 4O06A 1W9EA 1Y8TA 1WFVA 3L4FD 2PDZA 4K78A 2LUIA 5ILBA 1Y7NA 3TSWA 3CC0A 3RL7A 3STJA 4K75A 5HFFA 2W4FA 4N6XA 2D92A 1OZIA 1X45A 2PKUA 2KG2A 2I04A 2DKRA 2I6VA 1WHDA 3CS0A 5E1YA 3EGHC 5HFDA 3QO6A 2EEIA 3OTPA
chains in the Genus database with same CATH topology
5HFCA 5HJ1A 5B6LA 2O2TA 1M5ZA 1TP5A 3I18A 1GQ5A 1N7FA 5G1DA 1KY9A 1L6OA 2EEHA 5HFBA 2DJTA 2JXOA 1UJUA 3EGGC 2KJKA 2Z9IA 3E17A 2PKTA 3ID4A 1U38A 2HE4A 5GLJA 4NMRA 4K72A 2G2LA 2M0UA 4WYTA 5HF1A 1N6EA 2EDVA 5FB8C 2OQSA 2F0AA 5HEYA 2KRGA 4JOPA 2IWQA 2DB5A 3CYYA 4LMMA 2EDPA 4FLNA 1KWAA 1N7EA 4Q3HA 2QKUA 1FC9A 2EGOA 4PQWA 2EEJA 2YTWA 2YUYA 5HEBA 2KL1A 2OGPA 1V62A 3K50A 5E11A 1RY4A 2W7RA 2IWOA 3DJAA 2GZVA 1X9ZA 1WI4A 4Q6HA 4JOEA 2EHRA 2MHOA 4K6YA 2PA1A 3ID3A 2QBWA 3CBZA 4GVDA 4YYXA 4OAJA 4Q2PA 4Q2QA 2KAWA 1I16A 2LC7A 3MH4A 2FNEA 1TP3A 4EDJA 4P2AB 3KDKA 2ZPMA 4E35A 2BYGA 2P3WA 3RLEA 4NXQA 3WKLA 1NF3C 5H3JA 1QAUA 2KA9A 1N6DA 4NXRA 5GNDA 1FC6A 2VSVA 4UU6A 1WF8A 1UEPA 2E7KA 1RZXA 2KOHA 1GM1A 1T2MA 3K1RA 5F3XA 5E21A 1WJLA 2RCZA 5A2PA 2OS6A 2X7ZA 2V1WA 2DAZA 3GGEA 3K82A 2DC2A 3PDZA 2FCFA 4KFVA 1ZOKA 4NMQA 1BFEA 2EXGA 3I1EA 3TMHA 3SHWA 1GQ4A 3O46A 1UFXA 3FY5A 1K32A 3HVQC 3PV4A 1UM1A 2FE5A 3CBXA 2KOJA 2V90A 3KHFA 2KV8A 2OCSA 2UZCA 1SOZA 3QJMA 4P0CA 2REYA 2K1ZA 2AINA 2JIKA 1KEFA 2EEGA 1YBOA 4G69A 1U37A 3QDOA 4JORA 3GJ9A 3GCOA 1U39A 4K76A 2CSJA 1VJ6A 2VRFA 3R68A 4F8KA 1V5QA 4UU5A 2HGAA 4OEPA 3GDSA 4Q2OA 2EGKA 2CS5A 1WIFA 1WG6A 2KYLA 1W9OA 1D5GA 1RGRA 2GEFA 2ENOA 2QKVA 4RI0A 1IU0A 2I1NA 2VZ5A 3PDVA 2YT7A 2OPGA 1WHAA 2JILA 2EJYA 1X6DA 1G9OA 2I0IA 1UHPA 2LOBA 1TQ3A 2Z17A 4R2ZA 1U3BA 2EDZA 2M0VA 1VAEA 4NNMA 2Q9VA 3HPMA 1IU2A 2L4SA 2DLSA 2JWEA 3KZDA 3PS4A 2Q3GA 2IWPA 2PZDA 4JJ3A 2DLUA 2QG1A 3NFLA 3TSVA 1RGWA 5HF4A 2HE2A 2AWUA 2PNTA 2KQFA 4NXPA 3GCNA 2VPHA 2LA8A 2H3LA 2OZFA 4Z8JA 4NMOA 1QAVB 1VCWA 3ID1A 1N6FA 3R69A 4JOKA 2KOMA 1N99A 3KZEA 4YDPA 5E22A 1UF1A 1Q3OA 5EYZA 3JXTA 4NMTA 4NNLA 3SUZA 2M0ZA 1Q3PA 3DJ1A 3GDVA 2JINA 2R3YA 4E3BA 1XZ9A 2H3MA 4JOFA 2D8IA 3QE1A 4JOGA 3TSZA 2R4HA 2FN5A 1R6JA 1BE9A 2CSSA 3SOEA 2YUBA 4IC6A 3ID2A 2AWXA 1NTEA 3KDGA 4JJ0A 1OBYA 5HFEA 3WKMA 3B76A 1VA8A 3SHUA 4Q6SA 3DIWA 2G5MB 1V5LA 1Z86A 2AWWA 2ZPLA 4FGMA 4WYUA 1QAVA 3GDUA 1TE0A 1X5RA 2RRMA 1MFLA 4AMHA 1X5NA 1PDRA 4GVCA 4REYA 2M10A 3DJ3A 1MC7A 1X8SA 2DM8A 4L8NA 2YT8A 3AXAA 2EV8A 1OBXA 4JOHA 1SOTA 1WF7A 3R0HA 3CBYA 2QKTA 1MFGA 4HOPB 2KPLA 1UJDA 3GSLA 3PV5A 2LC6A 4XHVA 2VSPA 5B42A 1LCYA 2IWNA 4OEOA 4JL7A 1V1TA 4Z33A 3SFJA 2D90A 1IHJA 2JREA 3CH8A 1W9QA 1WFGA 3LNYA 3NGHA 1UEQA 3LNXA 5G1EA 1UITA 5F67A 3NCVA 3QGLA 1Q7XA 5DTHA 1WI2A 5IL9A 2EAQA 4NMVA 2H2CA 3NFKA 3VQFA 1WH1A 4HOPA 1UJVA 3VQGA 4NMPA 4NMSA 1ZUBA 2M3MA 2JSNA 2WL7A 3RL8A 4KFWA 1B8QA 2M0TA 4E34A 2OSGA 1VB7A 1OBZA 1FCFA 1FC7A 5JXBA 1UM7A 1UEWA 5I7ZA 1V6BA 1N7TA 2I4SA 2EGNA 2KJPA 5E6PB 4H11A 4JOJA 2VWRA 3QIKA 1UEZA 3BPUA 5HETA 3O5NA 4Q2NA 3ZRTA 2QT5A 3DORA 4GHNA 2K20A 2I0LA 2L97A 2KBSA 3HPKA 3QJNA 1Z87A 5EZ0A 3GABA 1P1DA 2KJDA 2L4TA 2H2BA 5HDYA 1QLCA 5FHTA 3MH6A 2DMZA 2KPKA 1X5QA 3MH7A 5HEDA 3OU0A 1P1EA 2OMJA 3I4WA 3PV2A 2MX6A 2F5YA 5D13A 2JOAA 1I92A 4MPAA 4O06A 1W9EA 1Y8TA 1WFVA 3L4FD 2PDZA 4K78A 2LUIA 5ILBA 1Y7NA 3TSWA 3CC0A 3RL7A 3STJA 4K75A 5HFFA 2W4FA 4N6XA 2D92A 1OZIA 1X45A 2PKUA 2KG2A 2I04A 2DKRA 2I6VA 1WHDA 3CS0A 5E1YA 3EGHC 5HFDA 3QO6A 2EEIA 3OTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFC A;  5HJ1 A;  5B6L A;  2O2T A;  1M5Z A;  1TP5 A;  3I18 A;  1GQ5 A;  1N7F A;  5G1D A;  1KY9 A;  1L6O A;  2EEH A;  5HFB A;  2DJT A;  2JXO A;  1UJU A;  3EGG C;  2KJK A;  2Z9I A;  3E17 A;  2PKT A;  3ID4 A;  1U38 A;  2HE4 A;  5GLJ A;  4NMR A;  4K72 A;  2G2L A;  2M0U A;  4WYT A;  5HF1 A;  1N6E A;  2EDV A;  5FB8 C;  2OQS A;  2F0A A;  5HEY A;  2KRG A;  4JOP A;  2IWQ A;  2DB5 A;  3CYY A;  4LMM A;  2EDP A;  1KWA A;  1N7E A;  4Q3H A;  2QKU A;  1FC9 A;  2EGO A;  4PQW A;  2EEJ A;  2YTW A;  2YUY A;  5HEB A;  2KL1 A;  2OGP A;  1V62 A;  3K50 A;  5E11 A;  1RY4 A;  2W7R A;  2IWO A;  3DJA A;  2GZV A;  1WI4 A;  4Q6H A;  4JOE A;  2EHR A;  2MHO A;  4K6Y A;  2PA1 A;  3ID3 A;  2QBW A;  3CBZ A;  4GVD A;  4YYX A;  4OAJ A;  4Q2P A;  4Q2Q A;  2KAW A;  1I16 A;  2LC7 A;  3MH4 A;  2FNE A;  1TP3 A;  4EDJ A;  4P2A B;  2ZPM A;  4E35 A;  2BYG A;  2P3W A;  3RLE A;  4NXQ A;  3WKL A;  1NF3 C;  5H3J A;  1QAU A;  2KA9 A;  1N6D A;  4NXR A;  5GND A;  1FC6 A;  2VSV A;  4UU6 A;  1WF8 A;  1UEP A;  2E7K A;  1RZX A;  2KOH A;  1GM1 A;  1T2M A;  3K1R A;  5F3X A;  5E21 A;  1WJL A;  2RCZ A;  5A2P A;  2OS6 A;  2X7Z A;  2V1W A;  2DAZ A;  3GGE A;  3K82 A;  2DC2 A;  3PDZ A;  2FCF A;  4KFV A;  1ZOK A;  4NMQ A;  1BFE A;  2EXG A;  3I1E A;  3TMH A;  3SHW A;  1GQ4 A;  3O46 A;  1UFX A;  3FY5 A;  1K32 A;  3HVQ C;  3PV4 A;  1UM1 A;  2FE5 A;  3CBX A;  2KOJ A;  2V90 A;  3KHF A;  2KV8 A;  2OCS A;  2UZC A;  1SOZ A;  3QJM A;  4P0C A;  2REY A;  2K1Z A;  2AIN A;  2JIK A;  1KEF A;  2EEG A;  1YBO A;  4G69 A;  1U37 A;  3QDO A;  4JOR A;  3GJ9 A;  3GCO A;  1U39 A;  4K76 A;  2CSJ A;  1VJ6 A;  2VRF A;  3R68 A;  4F8K A;  1V5Q A;  4UU5 A;  2HGA A;  4OEP A;  3GDS A;  4Q2O A;  2EGK A;  2CS5 A;  1WIF A;  1WG6 A;  2KYL A;  1W9O A;  1D5G A;  1RGR A;  2ENO A;  2QKV A;  4RI0 A;  1IU0 A;  2I1N A;  2VZ5 A;  3PDV A;  2YT7 A;  2OPG A;  1WHA A;  2JIL A;  2EJY A;  1X6D A;  1G9O A;  2I0I A;  1UHP A;  2LOB A;  1TQ3 A;  2Z17 A;  4R2Z A;  1U3B A;  2EDZ A;  2M0V A;  1VAE A;  4NNM A;  2Q9V A;  3HPM A;  1IU2 A;  2L4S A;  2DLS A;  2JWE A;  3KZD A;  3PS4 A;  2Q3G A;  2IWP A;  2PZD A;  2DLU A;  2QG1 A;  3NFL A;  3TSV A;  1RGW A;  5HF4 A;  2HE2 A;  2AWU A;  2PNT A;  2KQF A;  4NXP A;  3GCN A;  2VPH A;  2LA8 A;  2H3L A;  2OZF A;  4Z8J A;  4NMO A;  1QAV B;  1VCW A;  3ID1 A;  1N6F A;  3R69 A;  4JOK A;  2KOM A;  1N99 A;  3KZE A;  4YDP A;  5E22 A;  1UF1 A;  1Q3O A;  5EYZ A;  3JXT A;  4NMT A;  4NNL A;  3SUZ A;  2M0Z A;  1Q3P A;  3DJ1 A;  3GDV A;  2JIN A;  2R3Y A;  4E3B A;  1XZ9 A;  2H3M A;  4JOF A;  2D8I A;  3QE1 A;  4JOG A;  3TSZ A;  2R4H A;  2FN5 A;  1R6J A;  1BE9 A;  2CSS A;  3SOE A;  2YUB A;  4IC6 A;  3ID2 A;  2AWX A;  1NTE A;  1OBY A;  5HFE A;  3WKM A;  3B76 A;  1VA8 A;  3SHU A;  4Q6S A;  3DIW A;  2G5M B;  1V5L A;  1Z86 A;  2AWW A;  2ZPL A;  4FGM A;  4WYU A;  1QAV A;  3GDU A;  1TE0 A;  1X5R A;  2RRM A;  1MFL A;  4AMH A;  1X5N A;  1PDR A;  4GVC A;  4REY A;  2M10 A;  3DJ3 A;  1MC7 A;  1X8S A;  2DM8 A;  4L8N A;  2YT8 A;  3AXA A;  2EV8 A;  1OBX A;  4JOH A;  1SOT A;  1WF7 A;  3R0H A;  3CBY A;  2QKT A;  1MFG A;  4HOP B;  2KPL A;  1UJD A;  3GSL A;  3PV5 A;  2LC6 A;  4XHV A;  2VSP A;  1LCY A;  2IWN A;  4OEO A;  4JL7 A;  1V1T A;  4Z33 A;  3SFJ A;  2D90 A;  1IHJ A;  2JRE A;  3CH8 A;  1W9Q A;  1WFG A;  3LNY A;  3NGH A;  1UEQ A;  3LNX A;  5G1E A;  1UIT A;  5F67 A;  3QGL A;  1Q7X A;  5DTH A;  1WI2 A;  2EAQ A;  4NMV A;  2H2C A;  3NFK A;  3VQF A;  1WH1 A;  4HOP A;  1UJV A;  3VQG A;  4NMP A;  4NMS A;  1ZUB A;  2M3M A;  2WL7 A;  3RL8 A;  4KFW A;  1B8Q A;  2M0T A;  4E34 A;  2OSG A;  1VB7 A;  1OBZ A;  1FCF A;  1FC7 A;  5JXB A;  1UM7 A;  1UEW A;  5I7Z A;  1V6B A;  1N7T A;  2I4S A;  2EGN A;  2KJP A;  5E6P B;  4H11 A;  4JOJ A;  2VWR A;  3QIK A;  1UEZ A;  3BPU A;  5HET A;  3O5N A;  4Q2N A;  3ZRT A;  2QT5 A;  3DOR A;  4GHN A;  2K20 A;  2I0L A;  2L97 A;  2KBS A;  3HPK A;  3QJN A;  1Z87 A;  5EZ0 A;  1P1D A;  2KJD A;  2L4T A;  2H2B A;  5HDY A;  1QLC A;  5FHT A;  3MH6 A;  2DMZ A;  2KPK A;  1X5Q A;  3MH7 A;  5HED A;  3OU0 A;  1P1E A;  2OMJ A;  3I4W A;  3PV2 A;  2MX6 A;  2F5Y A;  5D13 A;  2JOA A;  1I92 A;  4MPA A;  4O06 A;  1W9E A;  1Y8T A;  1WFV A;  3L4F D;  2PDZ A;  4K78 A;  2LUI A;  1Y7N A;  3TSW A;  3CC0 A;  3RL7 A;  3STJ A;  4K75 A;  5HFF A;  2W4F A;  4N6X A;  2D92 A;  1OZI A;  1X45 A;  2PKU A;  2KG2 A;  2I04 A;  2DKR A;  2I6V A;  1WHD A;  3CS0 A;  5E1Y A;  3EGH C;  5HFD A;  3QO6 A;  2EEI A;  3OTP A; 
#chains in the Genus database with same CATH topology
 5HFC A;  5HJ1 A;  5B6L A;  2O2T A;  1M5Z A;  1TP5 A;  3I18 A;  1GQ5 A;  1N7F A;  5G1D A;  1KY9 A;  1L6O A;  2EEH A;  5HFB A;  2DJT A;  2JXO A;  1UJU A;  3EGG C;  2KJK A;  2Z9I A;  3E17 A;  2PKT A;  3ID4 A;  1U38 A;  2HE4 A;  5GLJ A;  4NMR A;  4K72 A;  2G2L A;  2M0U A;  4WYT A;  5HF1 A;  1N6E A;  2EDV A;  5FB8 C;  2OQS A;  2F0A A;  5HEY A;  2KRG A;  4JOP A;  2IWQ A;  2DB5 A;  3CYY A;  4LMM A;  2EDP A;  4FLN A;  1KWA A;  1N7E A;  4Q3H A;  2QKU A;  1FC9 A;  2EGO A;  4PQW A;  2EEJ A;  2YTW A;  2YUY A;  5HEB A;  2KL1 A;  2OGP A;  1V62 A;  3K50 A;  5E11 A;  1RY4 A;  2W7R A;  2IWO A;  3DJA A;  2GZV A;  1X9Z A;  1WI4 A;  4Q6H A;  4JOE A;  2EHR A;  2MHO A;  4K6Y A;  2PA1 A;  3ID3 A;  2QBW A;  3CBZ A;  4GVD A;  4YYX A;  4OAJ A;  4Q2P A;  4Q2Q A;  2KAW A;  1I16 A;  2LC7 A;  3MH4 A;  2FNE A;  1TP3 A;  4EDJ A;  4P2A B;  3KDK A;  2ZPM A;  4E35 A;  2BYG A;  2P3W A;  3RLE A;  4NXQ A;  3WKL A;  1NF3 C;  5H3J A;  1QAU A;  2KA9 A;  1N6D A;  4NXR A;  5GND A;  1FC6 A;  2VSV A;  4UU6 A;  1WF8 A;  1UEP A;  2E7K A;  1RZX A;  2KOH A;  1GM1 A;  1T2M A;  3K1R A;  5F3X A;  5E21 A;  1WJL A;  2RCZ A;  5A2P A;  2OS6 A;  2X7Z A;  2V1W A;  2DAZ A;  3GGE A;  3K82 A;  2DC2 A;  3PDZ A;  2FCF A;  4KFV A;  1ZOK A;  4NMQ A;  1BFE A;  2EXG A;  3I1E A;  3TMH A;  3SHW A;  1GQ4 A;  3O46 A;  1UFX A;  3FY5 A;  1K32 A;  3HVQ C;  3PV4 A;  1UM1 A;  2FE5 A;  3CBX A;  2KOJ A;  2V90 A;  3KHF A;  2KV8 A;  2OCS A;  2UZC A;  1SOZ A;  3QJM A;  4P0C A;  2REY A;  2K1Z A;  2AIN A;  2JIK A;  1KEF A;  2EEG A;  1YBO A;  4G69 A;  1U37 A;  3QDO A;  4JOR A;  3GJ9 A;  3GCO A;  1U39 A;  4K76 A;  2CSJ A;  1VJ6 A;  2VRF A;  3R68 A;  4F8K A;  1V5Q A;  4UU5 A;  2HGA A;  4OEP A;  3GDS A;  4Q2O A;  2EGK A;  2CS5 A;  1WIF A;  1WG6 A;  2KYL A;  1W9O A;  1D5G A;  1RGR A;  2GEF A;  2ENO A;  2QKV A;  4RI0 A;  1IU0 A;  2I1N A;  2VZ5 A;  3PDV A;  2YT7 A;  2OPG A;  1WHA A;  2JIL A;  2EJY A;  1X6D A;  1G9O A;  2I0I A;  1UHP A;  2LOB A;  1TQ3 A;  2Z17 A;  4R2Z A;  1U3B A;  2EDZ A;  2M0V A;  1VAE A;  4NNM A;  2Q9V A;  3HPM A;  1IU2 A;  2L4S A;  2DLS A;  2JWE A;  3KZD A;  3PS4 A;  2Q3G A;  2IWP A;  2PZD A;  4JJ3 A;  2DLU A;  2QG1 A;  3NFL A;  3TSV A;  1RGW A;  5HF4 A;  2HE2 A;  2AWU A;  2PNT A;  2KQF A;  4NXP A;  3GCN A;  2VPH A;  2LA8 A;  2H3L A;  2OZF A;  4Z8J A;  4NMO A;  1QAV B;  1VCW A;  3ID1 A;  1N6F A;  3R69 A;  4JOK A;  2KOM A;  1N99 A;  3KZE A;  4YDP A;  5E22 A;  1UF1 A;  1Q3O A;  5EYZ A;  3JXT A;  4NMT A;  4NNL A;  3SUZ A;  2M0Z A;  1Q3P A;  3DJ1 A;  3GDV A;  2JIN A;  2R3Y A;  4E3B A;  1XZ9 A;  2H3M A;  4JOF A;  2D8I A;  3QE1 A;  4JOG A;  3TSZ A;  2R4H A;  2FN5 A;  1R6J A;  1BE9 A;  2CSS A;  3SOE A;  2YUB A;  4IC6 A;  3ID2 A;  2AWX A;  1NTE A;  3KDG A;  4JJ0 A;  1OBY A;  5HFE A;  3WKM A;  3B76 A;  1VA8 A;  3SHU A;  4Q6S A;  3DIW A;  2G5M B;  1V5L A;  1Z86 A;  2AWW A;  2ZPL A;  4FGM A;  4WYU A;  1QAV A;  3GDU A;  1TE0 A;  1X5R A;  2RRM A;  1MFL A;  4AMH A;  1X5N A;  1PDR A;  4GVC A;  4REY A;  2M10 A;  3DJ3 A;  1MC7 A;  1X8S A;  2DM8 A;  4L8N A;  2YT8 A;  3AXA A;  2EV8 A;  1OBX A;  4JOH A;  1SOT A;  1WF7 A;  3R0H A;  3CBY A;  2QKT A;  1MFG A;  4HOP B;  2KPL A;  1UJD A;  3GSL A;  3PV5 A;  2LC6 A;  4XHV A;  2VSP A;  5B42 A;  1LCY A;  2IWN A;  4OEO A;  4JL7 A;  1V1T A;  4Z33 A;  3SFJ A;  2D90 A;  1IHJ A;  2JRE A;  3CH8 A;  1W9Q A;  1WFG A;  3LNY A;  3NGH A;  1UEQ A;  3LNX A;  5G1E A;  1UIT A;  5F67 A;  3NCV A;  3QGL A;  1Q7X A;  5DTH A;  1WI2 A;  5IL9 A;  2EAQ A;  4NMV A;  2H2C A;  3NFK A;  3VQF A;  1WH1 A;  4HOP A;  1UJV A;  3VQG A;  4NMP A;  4NMS A;  1ZUB A;  2M3M A;  2JSN A;  2WL7 A;  3RL8 A;  4KFW A;  1B8Q A;  2M0T A;  4E34 A;  2OSG A;  1VB7 A;  1OBZ A;  1FCF A;  1FC7 A;  5JXB A;  1UM7 A;  1UEW A;  5I7Z A;  1V6B A;  1N7T A;  2I4S A;  2EGN A;  2KJP A;  5E6P B;  4H11 A;  4JOJ A;  2VWR A;  3QIK A;  1UEZ A;  3BPU A;  5HET A;  3O5N A;  4Q2N A;  3ZRT A;  2QT5 A;  3DOR A;  4GHN A;  2K20 A;  2I0L A;  2L97 A;  2KBS A;  3HPK A;  3QJN A;  1Z87 A;  5EZ0 A;  3GAB A;  1P1D A;  2KJD A;  2L4T A;  2H2B A;  5HDY A;  1QLC A;  5FHT A;  3MH6 A;  2DMZ A;  2KPK A;  1X5Q A;  3MH7 A;  5HED A;  3OU0 A;  1P1E A;  2OMJ A;  3I4W A;  3PV2 A;  2MX6 A;  2F5Y A;  5D13 A;  2JOA A;  1I92 A;  4MPA A;  4O06 A;  1W9E A;  1Y8T A;  1WFV A;  3L4F D;  2PDZ A;  4K78 A;  2LUI A;  5ILB A;  1Y7N A;  3TSW A;  3CC0 A;  3RL7 A;  3STJ A;  4K75 A;  5HFF A;  2W4F A;  4N6X A;  2D92 A;  1OZI A;  1X45 A;  2PKU A;  2KG2 A;  2I04 A;  2DKR A;  2I6V A;  1WHD A;  3CS0 A;  5E1Y A;  3EGH C;  5HFD A;  3QO6 A;  2EEI A;  3OTP A; 
#chains in the Genus database with same CATH homology
 5HFC A;  5HJ1 A;  5B6L A;  2O2T A;  1M5Z A;  1TP5 A;  3I18 A;  1GQ5 A;  1N7F A;  5G1D A;  1KY9 A;  1L6O A;  2EEH A;  5HFB A;  2DJT A;  2JXO A;  1UJU A;  3EGG C;  2KJK A;  2Z9I A;  3E17 A;  2PKT A;  3ID4 A;  1U38 A;  2HE4 A;  5GLJ A;  4NMR A;  4K72 A;  2G2L A;  2M0U A;  4WYT A;  5HF1 A;  1N6E A;  2EDV A;  5FB8 C;  2OQS A;  2F0A A;  5HEY A;  2KRG A;  4JOP A;  2IWQ A;  2DB5 A;  3CYY A;  4LMM A;  2EDP A;  4FLN A;  1KWA A;  1N7E A;  4Q3H A;  2QKU A;  1FC9 A;  2EGO A;  4PQW A;  2EEJ A;  2YTW A;  2YUY A;  5HEB A;  2KL1 A;  2OGP A;  1V62 A;  3K50 A;  5E11 A;  1RY4 A;  2W7R A;  2IWO A;  3DJA A;  2GZV A;  1X9Z A;  1WI4 A;  4Q6H A;  4JOE A;  2EHR A;  2MHO A;  4K6Y A;  2PA1 A;  3ID3 A;  2QBW A;  3CBZ A;  4GVD A;  4YYX A;  4OAJ A;  4Q2P A;  4Q2Q A;  2KAW A;  1I16 A;  2LC7 A;  3MH4 A;  2FNE A;  1TP3 A;  4EDJ A;  4P2A B;  3KDK A;  2ZPM A;  4E35 A;  2BYG A;  2P3W A;  3RLE A;  4NXQ A;  3WKL A;  1NF3 C;  5H3J A;  1QAU A;  2KA9 A;  1N6D A;  4NXR A;  5GND A;  1FC6 A;  2VSV A;  4UU6 A;  1WF8 A;  1UEP A;  2E7K A;  1RZX A;  2KOH A;  1GM1 A;  1T2M A;  3K1R A;  5F3X A;  5E21 A;  1WJL A;  2RCZ A;  5A2P A;  2OS6 A;  2X7Z A;  2V1W A;  2DAZ A;  3GGE A;  3K82 A;  2DC2 A;  3PDZ A;  2FCF A;  4KFV A;  1ZOK A;  4NMQ A;  1BFE A;  2EXG A;  3I1E A;  3TMH A;  3SHW A;  1GQ4 A;  3O46 A;  1UFX A;  3FY5 A;  1K32 A;  3HVQ C;  3PV4 A;  1UM1 A;  2FE5 A;  3CBX A;  2KOJ A;  2V90 A;  3KHF A;  2KV8 A;  2OCS A;  2UZC A;  1SOZ A;  3QJM A;  4P0C A;  2REY A;  2K1Z A;  2AIN A;  2JIK A;  1KEF A;  2EEG A;  1YBO A;  4G69 A;  1U37 A;  3QDO A;  4JOR A;  3GJ9 A;  3GCO A;  1U39 A;  4K76 A;  2CSJ A;  1VJ6 A;  2VRF A;  3R68 A;  4F8K A;  1V5Q A;  4UU5 A;  2HGA A;  4OEP A;  3GDS A;  4Q2O A;  2EGK A;  2CS5 A;  1WIF A;  1WG6 A;  2KYL A;  1W9O A;  1D5G A;  1RGR A;  2GEF A;  2ENO A;  2QKV A;  4RI0 A;  1IU0 A;  2I1N A;  2VZ5 A;  3PDV A;  2YT7 A;  2OPG A;  1WHA A;  2JIL A;  2EJY A;  1X6D A;  1G9O A;  2I0I A;  1UHP A;  2LOB A;  1TQ3 A;  2Z17 A;  4R2Z A;  1U3B A;  2EDZ A;  2M0V A;  1VAE A;  4NNM A;  2Q9V A;  3HPM A;  1IU2 A;  2L4S A;  2DLS A;  2JWE A;  3KZD A;  3PS4 A;  2Q3G A;  2IWP A;  2PZD A;  4JJ3 A;  2DLU A;  2QG1 A;  3NFL A;  3TSV A;  1RGW A;  5HF4 A;  2HE2 A;  2AWU A;  2PNT A;  2KQF A;  4NXP A;  3GCN A;  2VPH A;  2LA8 A;  2H3L A;  2OZF A;  4Z8J A;  4NMO A;  1QAV B;  1VCW A;  3ID1 A;  1N6F A;  3R69 A;  4JOK A;  2KOM A;  1N99 A;  3KZE A;  4YDP A;  5E22 A;  1UF1 A;  1Q3O A;  5EYZ A;  3JXT A;  4NMT A;  4NNL A;  3SUZ A;  2M0Z A;  1Q3P A;  3DJ1 A;  3GDV A;  2JIN A;  2R3Y A;  4E3B A;  1XZ9 A;  2H3M A;  4JOF A;  2D8I A;  3QE1 A;  4JOG A;  3TSZ A;  2R4H A;  2FN5 A;  1R6J A;  1BE9 A;  2CSS A;  3SOE A;  2YUB A;  4IC6 A;  3ID2 A;  2AWX A;  1NTE A;  3KDG A;  4JJ0 A;  1OBY A;  5HFE A;  3WKM A;  3B76 A;  1VA8 A;  3SHU A;  4Q6S A;  3DIW A;  2G5M B;  1V5L A;  1Z86 A;  2AWW A;  2ZPL A;  4FGM A;  4WYU A;  1QAV A;  3GDU A;  1TE0 A;  1X5R A;  2RRM A;  1MFL A;  4AMH A;  1X5N A;  1PDR A;  4GVC A;  4REY A;  2M10 A;  3DJ3 A;  1MC7 A;  1X8S A;  2DM8 A;  4L8N A;  2YT8 A;  3AXA A;  2EV8 A;  1OBX A;  4JOH A;  1SOT A;  1WF7 A;  3R0H A;  3CBY A;  2QKT A;  1MFG A;  4HOP B;  2KPL A;  1UJD A;  3GSL A;  3PV5 A;  2LC6 A;  4XHV A;  2VSP A;  5B42 A;  1LCY A;  2IWN A;  4OEO A;  4JL7 A;  1V1T A;  4Z33 A;  3SFJ A;  2D90 A;  1IHJ A;  2JRE A;  3CH8 A;  1W9Q A;  1WFG A;  3LNY A;  3NGH A;  1UEQ A;  3LNX A;  5G1E A;  1UIT A;  5F67 A;  3NCV A;  3QGL A;  1Q7X A;  5DTH A;  1WI2 A;  5IL9 A;  2EAQ A;  4NMV A;  2H2C A;  3NFK A;  3VQF A;  1WH1 A;  4HOP A;  1UJV A;  3VQG A;  4NMP A;  4NMS A;  1ZUB A;  2M3M A;  2JSN A;  2WL7 A;  3RL8 A;  4KFW A;  1B8Q A;  2M0T A;  4E34 A;  2OSG A;  1VB7 A;  1OBZ A;  1FCF A;  1FC7 A;  5JXB A;  1UM7 A;  1UEW A;  5I7Z A;  1V6B A;  1N7T A;  2I4S A;  2EGN A;  2KJP A;  5E6P B;  4H11 A;  4JOJ A;  2VWR A;  3QIK A;  1UEZ A;  3BPU A;  5HET A;  3O5N A;  4Q2N A;  3ZRT A;  2QT5 A;  3DOR A;  4GHN A;  2K20 A;  2I0L A;  2L97 A;  2KBS A;  3HPK A;  3QJN A;  1Z87 A;  5EZ0 A;  3GAB A;  1P1D A;  2KJD A;  2L4T A;  2H2B A;  5HDY A;  1QLC A;  5FHT A;  3MH6 A;  2DMZ A;  2KPK A;  1X5Q A;  3MH7 A;  5HED A;  3OU0 A;  1P1E A;  2OMJ A;  3I4W A;  3PV2 A;  2MX6 A;  2F5Y A;  5D13 A;  2JOA A;  1I92 A;  4MPA A;  4O06 A;  1W9E A;  1Y8T A;  1WFV A;  3L4F D;  2PDZ A;  4K78 A;  2LUI A;  5ILB A;  1Y7N A;  3TSW A;  3CC0 A;  3RL7 A;  3STJ A;  4K75 A;  5HFF A;  2W4F A;  4N6X A;  2D92 A;  1OZI A;  1X45 A;  2PKU A;  2KG2 A;  2I04 A;  2DKR A;  2I6V A;  1WHD A;  3CS0 A;  5E1Y A;  3EGH C;  5HFD A;  3QO6 A;  2EEI A;  3OTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...