3QDOA

Crystal structure of pdz domain of sorting nexin 27 (snx27) fused to the gly-gly linker followed by c-terminal (eseskv) of girk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
b'GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVGGESESKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-27, G protein-activated inward rectifier potas
publication title Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3qdoA00
2BYGA 5E21A 2EEIA 4K6YA 5HETA 2PA1A 4UU6A 1K32A 2PNTA 2KV8A 2HGAA 3CBXA 2KQFA 4Z33A 3KZEA 2H3LA 3AXAA 5FHTA 1W9OA 2KA9A 4K75A 2KBSA 1WHAA 1GQ4A 2JXOA 1V6BA 1QAVA 2OS6A 3PV4A 1UFXA 2REYA 1ZUBA 2IWNA 4P0CA 1X8SA 2L4TA 2JWEA 3GDUA 2WL7A 4NMOA 2KPLA 3NGHA 1Y7NA 2H3MA 1FC9A 2ZPLA 4NMPA 5G1DA 3TMHA 3TSVA 1QLCA 2OMJA 4YDPA 2DAZA 3ID3A 2I04A 3DIWA 2VSPA 3O5NA 1D5GA 3CC0A 5E6PB 1Y8TA 2FNEA 1GQ5A 4NMTA 1UEQA 1TE0A 4MPAA 1V62A 2QBWA 4NMVA 2R4HA 3PDZA 2QG1A 3QDOA 5HF4A 4WYUA 4KFVA 1N7EA 3DORA 3QJNA 1VAEA 2EDVA 1MFGA 2OZFA 4HOPB 3CYYA 2Z9IA 3GCNA 1Q3OA 2OPGA 5E1YA 2I0LA 1SOTA 2EV8A 2KOJA 1OBXA 2JOAA 1UITA 3JXTA 5JXBA 1N7FA 2OCSA 5A2PA 2K1ZA 3GDVA 1KEFA 2ZPMA 3DJAA 5EZ0A 2DLSA 2RCZA 1UM1A 1V1TA 1VCWA 4GHNA 4Q2QA 4E3BA 2KJDA 1FC6A 5HJ1A 2JIKA 1MC7A 2KAWA 4WYTA 1PDRA 1X5QA 2MX6A 1N6FA 1LCYA 2I4SA 4PQWA 5FB8C 2DM8A 1B8QA 3K1RA 4OEOA 2DJTA 1Q7XA 2CS5A 1I16A 2VSVA 2IWOA 2FN5A 1SOZA 2P3WA 1U3BA 2O2TA 4Q2NA 4NMSA 2M0UA 3L4FD 4P2AB 2Q3GA 2CSJA 4NMQA 3FY5A 1TP5A 2E7KA 2I0IA 4L8NA 1UF1A 2L4SA 4RI0A 4OEPA 2DB5A 2UZCA 2KRGA 4EDJA 2KPKA 2FCFA 4G69A 3GSLA 2CSSA 2YUBA 3QIKA 2Q9VA 2AINA 4UU5A 4R2ZA 4OAJA 3DJ1A 5I7ZA 1WI2A 3ID1A 1YBOA 1V5LA 2V90A 1NTEA 3LNYA 2M0VA 3GCOA 1X6DA 4NXPA 4NXQA 2EGOA 3OU0A 2QKTA 2EHRA 1N6DA 1WFGA 3R0HA 5HEDA 2LOBA 4NNMA 4GVCA 1QAVB 1Q3PA 4YYXA 2OGPA 3SHUA 3NFKA 2EEJA 4FGMA 4N6XA 4K76A 2AWWA 3ZRTA 1RY4A 2IWQA 3RL7A 2M3MA 1XZ9A 2PKUA 3OTPA 2KG2A 2QKUA 2K20A 4IC6A 1OZIA 3QGLA 1KWAA 4JOHA 1WIFA 3HVQC 2F0AA 4XHVA 3O46A 1WF8A 3B76A 1FC7A 4HOPA 3GJ9A 1WI4A 3R69A 5G1EA 3MH4A 3VQGA 2OQSA 1WJLA 4JOFA 4E35A 2G2LA 2ENOA 5EYZA 2JINA 5GNDA 2VZ5A 4Z8JA 4JOPA 3RLEA 1UEZA 2EGKA 1L6OA 3I1EA 2D8IA 1TP3A 2EJYA 1BFEA 3K82A 2YUYA 4NNLA 5GLJA 1R6JA 3EGGC 4JOGA 3SUZA 1N6EA 4REYA 1W9EA 5H3JA 2QT5A 1U38A 4O06A 2EEHA 3TSWA 1NF3C 1RZXA 5HF1A 5HEYA 1WFVA 4LMMA 1WHDA 1VJ6A 2VPHA 3HPKA 3SHWA 4Q3HA 3I18A 3I4WA 1X5NA 3QJMA 2FE5A 2PDZA 4JOKA 3STJA 3QO6A 1BE9A 1UHPA 1X5RA 2H2CA 1MFLA 2AWUA 3MH7A 1P1EA 2D92A 1WH1A 2OSGA 5DTHA 4JORA 5B6LA 1Z87A 2W4FA 1UJDA 2L97A 1TQ3A 2JREA 1FCFA 2KJKA 2M10A 1ZOKA 2H2BA 5HFBA 1RGWA 4JL7A 3R68A 2KJPA 1X45A 2EDPA 3CH8A 2I6VA 1KY9A 2R3YA 1W9QA 2EGNA 2M0ZA 2KOHA 3E17A 2PZDA 1UJVA 1QAUA 2DC2A 3CBZA 3SOEA 1OBYA 1UM7A 1WF7A 3ID2A 4Q6HA 5HFCA 3VQFA 3K50A 1RGRA 3TSZA 5HEBA 1G9OA 5F3XA 1OBZA 5F67A 4H11A 2QKVA 4Q2PA 1U37A 1P1DA 5HFFA 1N7TA 1T2MA 1U39A 3DJ3A 2D90A 1V5QA 5HFDA 2DKRA 1UEWA 2LC7A 4K72A 4Q2OA 2V1WA 2X7ZA 2YTWA 2M0TA 4AMHA 1Z86A 2EDZA 2YT8A 2DLUA 2DMZA 4JOEA 2HE4A 3PV2A 3ID4A 2F5YA 3CS0A 3LNXA 2LC6A 4KFWA 1IU2A 3CBYA 1IHJA 4NMRA 1N99A 3QE1A 2YT7A 5HFEA 4K78A 4NXRA 2Z17A 3MH6A 2KOMA 1VA8A 2VWRA 1WG6A 2IWPA 3HPMA 3GGEA 2G5MB 2PKTA 1UJUA 3KHFA 3GDSA 2MHOA 5E22A 3SFJA 2W7RA 1I92A 1UEPA 3WKMA 1VB7A 1IU0A 3WKLA 2HE2A 2I1NA 2VRFA 2KYLA 2LA8A 4E34A 4JOJA 2EXGA 3PS4A 2EAQA 5D13A 3KZDA 2KL1A 2EEGA 5HDYA 3PV5A 5E11A 2GZVA 4GVDA 3NFLA 3PDVA 4F8KA 2LUIA 2AWXA 2RRMA 1M5ZA 2JILA 1GM1A 4Q6SA 3EGHC 3RL8A 3BPUA
chains in the Genus database with same CATH superfamily
2BYGA 5E21A 2EEIA 4K6YA 5HETA 2PA1A 4UU6A 1K32A 2PNTA 2KV8A 2HGAA 3CBXA 2KQFA 4Z33A 3KZEA 2H3LA 3AXAA 5FHTA 1W9OA 2KA9A 4K75A 2KBSA 1WHAA 1GQ4A 2JXOA 1V6BA 1QAVA 2OS6A 3PV4A 1UFXA 2REYA 1ZUBA 2IWNA 4P0CA 1X8SA 2L4TA 2JWEA 3GDUA 2WL7A 4NMOA 2KPLA 3NGHA 1Y7NA 2H3MA 1FC9A 2ZPLA 4NMPA 5G1DA 3TMHA 3TSVA 1QLCA 2OMJA 4YDPA 2DAZA 3ID3A 2I04A 3DIWA 2VSPA 3O5NA 1D5GA 3CC0A 5E6PB 5ILBA 1Y8TA 2FNEA 1GQ5A 4NMTA 1UEQA 1TE0A 4MPAA 1V62A 2QBWA 4NMVA 2R4HA 3PDZA 2QG1A 3QDOA 5HF4A 4WYUA 4KFVA 2JSNA 1N7EA 3DORA 3QJNA 1VAEA 2EDVA 1MFGA 2OZFA 4HOPB 3CYYA 2Z9IA 3GCNA 1Q3OA 2OPGA 5E1YA 2I0LA 1SOTA 2EV8A 2KOJA 1OBXA 2JOAA 1UITA 3JXTA 5JXBA 1N7FA 2OCSA 5A2PA 2K1ZA 3GDVA 1KEFA 2ZPMA 3DJAA 5EZ0A 2DLSA 2RCZA 1UM1A 1V1TA 1VCWA 4GHNA 4Q2QA 4E3BA 2KJDA 1FC6A 5HJ1A 2JIKA 1MC7A 2KAWA 4WYTA 1PDRA 1X5QA 2MX6A 1N6FA 1LCYA 2I4SA 4PQWA 5FB8C 2DM8A 1B8QA 3K1RA 4OEOA 2DJTA 1Q7XA 2CS5A 1I16A 2VSVA 2IWOA 2FN5A 1SOZA 2P3WA 1U3BA 2O2TA 4Q2NA 4NMSA 2M0UA 3L4FD 4P2AB 2Q3GA 2CSJA 4NMQA 3FY5A 1TP5A 2E7KA 2I0IA 4L8NA 1UF1A 2L4SA 4RI0A 4OEPA 2DB5A 2UZCA 2KRGA 4EDJA 2KPKA 2FCFA 4G69A 3GSLA 2CSSA 2YUBA 3QIKA 2Q9VA 2AINA 4UU5A 4R2ZA 4OAJA 3DJ1A 5I7ZA 1WI2A 3ID1A 1YBOA 1V5LA 2V90A 1NTEA 3LNYA 2M0VA 3GCOA 1X6DA 4NXPA 4NXQA 2EGOA 3OU0A 2QKTA 4JJ3A 2EHRA 1N6DA 1WFGA 3R0HA 5HEDA 2LOBA 4NNMA 4GVCA 1QAVB 1Q3PA 4YYXA 2OGPA 3SHUA 3NFKA 2EEJA 4FGMA 4N6XA 4K76A 2AWWA 3ZRTA 1RY4A 5B42A 2IWQA 3RL7A 2M3MA 1XZ9A 2PKUA 3OTPA 2KG2A 2QKUA 2K20A 4IC6A 3KDKA 1OZIA 3QGLA 1KWAA 4JOHA 1WIFA 3HVQC 2F0AA 4XHVA 3O46A 1WF8A 3B76A 1FC7A 4HOPA 3GJ9A 1WI4A 3R69A 5G1EA 3MH4A 3VQGA 2OQSA 1WJLA 3NCVA 4JOFA 4E35A 2G2LA 2ENOA 5EYZA 2JINA 5GNDA 2VZ5A 4Z8JA 4JOPA 3RLEA 1UEZA 2EGKA 1L6OA 3I1EA 2D8IA 1TP3A 2EJYA 1BFEA 3K82A 2YUYA 4NNLA 5GLJA 1R6JA 3EGGC 4JOGA 3SUZA 1N6EA 4REYA 1W9EA 5H3JA 2QT5A 1U38A 4O06A 2EEHA 3TSWA 1NF3C 1RZXA 5HF1A 5HEYA 1WFVA 4LMMA 4JJ0A 1WHDA 1VJ6A 2VPHA 3HPKA 3SHWA 4Q3HA 3I18A 3I4WA 1X5NA 3QJMA 2FE5A 2PDZA 4JOKA 3STJA 3QO6A 1BE9A 1UHPA 1X5RA 2H2CA 1MFLA 2AWUA 3MH7A 1P1EA 2D92A 1WH1A 2OSGA 5DTHA 4JORA 5B6LA 1Z87A 2W4FA 1UJDA 2L97A 1TQ3A 2GEFA 2JREA 1FCFA 2KJKA 2M10A 1ZOKA 2H2BA 5HFBA 1RGWA 4FLNA 4JL7A 3R68A 2KJPA 1X45A 2EDPA 3CH8A 2I6VA 1KY9A 2R3YA 1W9QA 2EGNA 2M0ZA 2KOHA 3E17A 2PZDA 1UJVA 1QAUA 2DC2A 3CBZA 3SOEA 1OBYA 1UM7A 3KDGA 1WF7A 3ID2A 4Q6HA 5HFCA 3VQFA 3K50A 1RGRA 3TSZA 5IL9A 5HEBA 1G9OA 5F3XA 1OBZA 5F67A 4H11A 2QKVA 4Q2PA 1U37A 1P1DA 5HFFA 1N7TA 1T2MA 1U39A 3DJ3A 2D90A 1V5QA 5HFDA 2DKRA 1UEWA 2LC7A 4K72A 4Q2OA 2V1WA 2X7ZA 2YTWA 2M0TA 4AMHA 1Z86A 2EDZA 2YT8A 2DLUA 2DMZA 4JOEA 2HE4A 3PV2A 3ID4A 2F5YA 3CS0A 3LNXA 2LC6A 4KFWA 1IU2A 3CBYA 1IHJA 4NMRA 1N99A 3QE1A 2YT7A 5HFEA 4K78A 4NXRA 2Z17A 3MH6A 2KOMA 1VA8A 2VWRA 1WG6A 2IWPA 3HPMA 3GGEA 2G5MB 2PKTA 1UJUA 3KHFA 3GDSA 2MHOA 5E22A 3SFJA 2W7RA 1I92A 1UEPA 3WKMA 1VB7A 1IU0A 3WKLA 2HE2A 2I1NA 2VRFA 2KYLA 2LA8A 4E34A 4JOJA 2EXGA 3PS4A 1X9ZA 2EAQA 5D13A 3KZDA 2KL1A 2EEGA 5HDYA 3PV5A 5E11A 2GZVA 4GVDA 3NFLA 3GABA 3PDVA 4F8KA 2LUIA 2AWXA 2RRMA 1M5ZA 2JILA 1GM1A 4Q6SA 3EGHC 3RL8A 3BPUA
chains in the Genus database with same CATH topology
2BYGA 5E21A 2EEIA 4K6YA 5HETA 2PA1A 4UU6A 1K32A 2PNTA 2KV8A 2HGAA 3CBXA 2KQFA 4Z33A 3KZEA 2H3LA 3AXAA 5FHTA 1W9OA 2KA9A 4K75A 2KBSA 1WHAA 1GQ4A 2JXOA 1V6BA 1QAVA 2OS6A 3PV4A 1UFXA 2REYA 1ZUBA 2IWNA 4P0CA 1X8SA 2L4TA 2JWEA 3GDUA 2WL7A 4NMOA 2KPLA 3NGHA 1Y7NA 2H3MA 1FC9A 2ZPLA 4NMPA 5G1DA 3TMHA 3TSVA 1QLCA 2OMJA 4YDPA 2DAZA 3ID3A 2I04A 3DIWA 2VSPA 3O5NA 1D5GA 3CC0A 5E6PB 5ILBA 1Y8TA 2FNEA 1GQ5A 4NMTA 1UEQA 1TE0A 4MPAA 1V62A 2QBWA 4NMVA 2R4HA 3PDZA 2QG1A 3QDOA 5HF4A 4WYUA 4KFVA 2JSNA 1N7EA 3DORA 3QJNA 1VAEA 2EDVA 1MFGA 2OZFA 4HOPB 3CYYA 2Z9IA 3GCNA 1Q3OA 2OPGA 5E1YA 2I0LA 1SOTA 2EV8A 2KOJA 1OBXA 2JOAA 1UITA 3JXTA 5JXBA 1N7FA 2OCSA 5A2PA 2K1ZA 3GDVA 1KEFA 2ZPMA 3DJAA 5EZ0A 2DLSA 2RCZA 1UM1A 1V1TA 1VCWA 4GHNA 4Q2QA 4E3BA 2KJDA 1FC6A 5HJ1A 2JIKA 1MC7A 2KAWA 4WYTA 1PDRA 1X5QA 2MX6A 1N6FA 1LCYA 2I4SA 4PQWA 5FB8C 2DM8A 1B8QA 3K1RA 4OEOA 2DJTA 1Q7XA 2CS5A 1I16A 2VSVA 2IWOA 2FN5A 1SOZA 2P3WA 1U3BA 2O2TA 4Q2NA 4NMSA 2M0UA 3L4FD 4P2AB 2Q3GA 2CSJA 4NMQA 3FY5A 1TP5A 2E7KA 2I0IA 4L8NA 1UF1A 2L4SA 4RI0A 4OEPA 2DB5A 2UZCA 2KRGA 4EDJA 2KPKA 2FCFA 4G69A 3GSLA 2CSSA 2YUBA 3QIKA 2Q9VA 2AINA 4UU5A 4R2ZA 4OAJA 3DJ1A 5I7ZA 1WI2A 3ID1A 1YBOA 1V5LA 2V90A 1NTEA 3LNYA 2M0VA 3GCOA 1X6DA 4NXPA 4NXQA 2EGOA 3OU0A 2QKTA 4JJ3A 2EHRA 1N6DA 1WFGA 3R0HA 5HEDA 2LOBA 4NNMA 4GVCA 1QAVB 1Q3PA 4YYXA 2OGPA 3SHUA 3NFKA 2EEJA 4FGMA 4N6XA 4K76A 2AWWA 3ZRTA 1RY4A 5B42A 2IWQA 3RL7A 2M3MA 1XZ9A 2PKUA 3OTPA 2KG2A 2QKUA 2K20A 4IC6A 3KDKA 1OZIA 3QGLA 1KWAA 4JOHA 1WIFA 3HVQC 2F0AA 4XHVA 3O46A 1WF8A 3B76A 1FC7A 4HOPA 3GJ9A 1WI4A 3R69A 5G1EA 3MH4A 3VQGA 2OQSA 1WJLA 3NCVA 4JOFA 4E35A 2G2LA 2ENOA 5EYZA 2JINA 5GNDA 2VZ5A 4Z8JA 4JOPA 3RLEA 1UEZA 2EGKA 1L6OA 3I1EA 2D8IA 1TP3A 2EJYA 1BFEA 3K82A 2YUYA 4NNLA 5GLJA 1R6JA 3EGGC 4JOGA 3SUZA 1N6EA 4REYA 1W9EA 5H3JA 2QT5A 1U38A 4O06A 2EEHA 3TSWA 1NF3C 1RZXA 5HF1A 5HEYA 1WFVA 4LMMA 4JJ0A 1WHDA 1VJ6A 2VPHA 3HPKA 3SHWA 4Q3HA 3I18A 3I4WA 1X5NA 3QJMA 2FE5A 2PDZA 4JOKA 3STJA 3QO6A 1BE9A 1UHPA 1X5RA 2H2CA 1MFLA 2AWUA 3MH7A 1P1EA 2D92A 1WH1A 2OSGA 5DTHA 4JORA 5B6LA 1Z87A 2W4FA 1UJDA 2L97A 1TQ3A 2GEFA 2JREA 1FCFA 2KJKA 2M10A 1ZOKA 2H2BA 5HFBA 1RGWA 4FLNA 4JL7A 3R68A 2KJPA 1X45A 2EDPA 3CH8A 2I6VA 1KY9A 2R3YA 1W9QA 2EGNA 2M0ZA 2KOHA 3E17A 2PZDA 1UJVA 1QAUA 2DC2A 3CBZA 3SOEA 1OBYA 1UM7A 3KDGA 1WF7A 3ID2A 4Q6HA 5HFCA 3VQFA 3K50A 1RGRA 3TSZA 5IL9A 5HEBA 1G9OA 5F3XA 1OBZA 5F67A 4H11A 2QKVA 4Q2PA 1U37A 1P1DA 5HFFA 1N7TA 1T2MA 1U39A 3DJ3A 2D90A 1V5QA 5HFDA 2DKRA 1UEWA 2LC7A 4K72A 4Q2OA 2V1WA 2X7ZA 2YTWA 2M0TA 4AMHA 1Z86A 2EDZA 2YT8A 2DLUA 2DMZA 4JOEA 2HE4A 3PV2A 3ID4A 2F5YA 3CS0A 3LNXA 2LC6A 4KFWA 1IU2A 3CBYA 1IHJA 4NMRA 1N99A 3QE1A 2YT7A 5HFEA 4K78A 4NXRA 2Z17A 3MH6A 2KOMA 1VA8A 2VWRA 1WG6A 2IWPA 3HPMA 3GGEA 2G5MB 2PKTA 1UJUA 3KHFA 3GDSA 2MHOA 5E22A 3SFJA 2W7RA 1I92A 1UEPA 3WKMA 1VB7A 1IU0A 3WKLA 2HE2A 2I1NA 2VRFA 2KYLA 2LA8A 4E34A 4JOJA 2EXGA 3PS4A 1X9ZA 2EAQA 5D13A 3KZDA 2KL1A 2EEGA 5HDYA 3PV5A 5E11A 2GZVA 4GVDA 3NFLA 3GABA 3PDVA 4F8KA 2LUIA 2AWXA 2RRMA 1M5ZA 2JILA 1GM1A 4Q6SA 3EGHC 3RL8A 3BPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYG A;  5E21 A;  2EEI A;  4K6Y A;  5HET A;  2PA1 A;  4UU6 A;  1K32 A;  2PNT A;  2KV8 A;  2HGA A;  3CBX A;  2KQF A;  4Z33 A;  3KZE A;  2H3L A;  3AXA A;  5FHT A;  1W9O A;  2KA9 A;  4K75 A;  2KBS A;  1WHA A;  1GQ4 A;  2JXO A;  1V6B A;  1QAV A;  2OS6 A;  3PV4 A;  1UFX A;  2REY A;  1ZUB A;  2IWN A;  4P0C A;  1X8S A;  2L4T A;  2JWE A;  3GDU A;  2WL7 A;  4NMO A;  2KPL A;  3NGH A;  1Y7N A;  2H3M A;  1FC9 A;  2ZPL A;  4NMP A;  5G1D A;  3TMH A;  3TSV A;  1QLC A;  2OMJ A;  4YDP A;  2DAZ A;  3ID3 A;  2I04 A;  3DIW A;  2VSP A;  3O5N A;  1D5G A;  3CC0 A;  5E6P B;  1Y8T A;  2FNE A;  1GQ5 A;  4NMT A;  1UEQ A;  1TE0 A;  4MPA A;  1V62 A;  2QBW A;  4NMV A;  2R4H A;  3PDZ A;  2QG1 A;  3QDO A;  5HF4 A;  4WYU A;  4KFV A;  1N7E A;  3DOR A;  3QJN A;  1VAE A;  2EDV A;  1MFG A;  2OZF A;  4HOP B;  3CYY A;  2Z9I A;  3GCN A;  1Q3O A;  2OPG A;  5E1Y A;  2I0L A;  1SOT A;  2EV8 A;  2KOJ A;  1OBX A;  2JOA A;  1UIT A;  3JXT A;  5JXB A;  1N7F A;  2OCS A;  5A2P A;  2K1Z A;  3GDV A;  1KEF A;  2ZPM A;  3DJA A;  5EZ0 A;  2DLS A;  2RCZ A;  1UM1 A;  1V1T A;  1VCW A;  4GHN A;  4Q2Q A;  4E3B A;  2KJD A;  1FC6 A;  5HJ1 A;  2JIK A;  1MC7 A;  2KAW A;  4WYT A;  1PDR A;  1X5Q A;  2MX6 A;  1N6F A;  1LCY A;  2I4S A;  4PQW A;  5FB8 C;  2DM8 A;  1B8Q A;  3K1R A;  4OEO A;  2DJT A;  1Q7X A;  2CS5 A;  1I16 A;  2VSV A;  2IWO A;  2FN5 A;  1SOZ A;  2P3W A;  1U3B A;  2O2T A;  4Q2N A;  4NMS A;  2M0U A;  3L4F D;  4P2A B;  2Q3G A;  2CSJ A;  4NMQ A;  3FY5 A;  1TP5 A;  2E7K A;  2I0I A;  4L8N A;  1UF1 A;  2L4S A;  4RI0 A;  4OEP A;  2DB5 A;  2UZC A;  2KRG A;  4EDJ A;  2KPK A;  2FCF A;  4G69 A;  3GSL A;  2CSS A;  2YUB A;  3QIK A;  2Q9V A;  2AIN A;  4UU5 A;  4R2Z A;  4OAJ A;  3DJ1 A;  5I7Z A;  1WI2 A;  3ID1 A;  1YBO A;  1V5L A;  2V90 A;  1NTE A;  3LNY A;  2M0V A;  3GCO A;  1X6D A;  4NXP A;  4NXQ A;  2EGO A;  3OU0 A;  2QKT A;  2EHR A;  1N6D A;  1WFG A;  3R0H A;  5HED A;  2LOB A;  4NNM A;  4GVC A;  1QAV B;  1Q3P A;  4YYX A;  2OGP A;  3SHU A;  3NFK A;  2EEJ A;  4FGM A;  4N6X A;  4K76 A;  2AWW A;  3ZRT A;  1RY4 A;  2IWQ A;  3RL7 A;  2M3M A;  1XZ9 A;  2PKU A;  3OTP A;  2KG2 A;  2QKU A;  2K20 A;  4IC6 A;  1OZI A;  3QGL A;  1KWA A;  4JOH A;  1WIF A;  3HVQ C;  2F0A A;  4XHV A;  3O46 A;  1WF8 A;  3B76 A;  1FC7 A;  4HOP A;  3GJ9 A;  1WI4 A;  3R69 A;  5G1E A;  3MH4 A;  3VQG A;  2OQS A;  1WJL A;  4JOF A;  4E35 A;  2G2L A;  2ENO A;  5EYZ A;  2JIN A;  5GND A;  2VZ5 A;  4Z8J A;  4JOP A;  3RLE A;  1UEZ A;  2EGK A;  1L6O A;  3I1E A;  2D8I A;  1TP3 A;  2EJY A;  1BFE A;  3K82 A;  2YUY A;  4NNL A;  5GLJ A;  1R6J A;  3EGG C;  4JOG A;  3SUZ A;  1N6E A;  4REY A;  1W9E A;  5H3J A;  2QT5 A;  1U38 A;  4O06 A;  2EEH A;  3TSW A;  1NF3 C;  1RZX A;  5HF1 A;  5HEY A;  1WFV A;  4LMM A;  1WHD A;  1VJ6 A;  2VPH A;  3HPK A;  3SHW A;  4Q3H A;  3I18 A;  3I4W A;  1X5N A;  3QJM A;  2FE5 A;  2PDZ A;  4JOK A;  3STJ A;  3QO6 A;  1BE9 A;  1UHP A;  1X5R A;  2H2C A;  1MFL A;  2AWU A;  3MH7 A;  1P1E A;  2D92 A;  1WH1 A;  2OSG A;  5DTH A;  4JOR A;  5B6L A;  1Z87 A;  2W4F A;  1UJD A;  2L97 A;  1TQ3 A;  2JRE A;  1FCF A;  2KJK A;  2M10 A;  1ZOK A;  2H2B A;  5HFB A;  1RGW A;  4JL7 A;  3R68 A;  2KJP A;  1X45 A;  2EDP A;  3CH8 A;  2I6V A;  1KY9 A;  2R3Y A;  1W9Q A;  2EGN A;  2M0Z A;  2KOH A;  3E17 A;  2PZD A;  1UJV A;  1QAU A;  2DC2 A;  3CBZ A;  3SOE A;  1OBY A;  1UM7 A;  1WF7 A;  3ID2 A;  4Q6H A;  5HFC A;  3VQF A;  3K50 A;  1RGR A;  3TSZ A;  5HEB A;  1G9O A;  5F3X A;  1OBZ A;  5F67 A;  4H11 A;  2QKV A;  4Q2P A;  1U37 A;  1P1D A;  5HFF A;  1N7T A;  1T2M A;  1U39 A;  3DJ3 A;  2D90 A;  1V5Q A;  5HFD A;  2DKR A;  1UEW A;  2LC7 A;  4K72 A;  4Q2O A;  2V1W A;  2X7Z A;  2YTW A;  2M0T A;  4AMH A;  1Z86 A;  2EDZ A;  2YT8 A;  2DLU A;  2DMZ A;  4JOE A;  2HE4 A;  3PV2 A;  3ID4 A;  2F5Y A;  3CS0 A;  3LNX A;  2LC6 A;  4KFW A;  1IU2 A;  3CBY A;  1IHJ A;  4NMR A;  1N99 A;  3QE1 A;  2YT7 A;  5HFE A;  4K78 A;  4NXR A;  2Z17 A;  3MH6 A;  2KOM A;  1VA8 A;  2VWR A;  1WG6 A;  2IWP A;  3HPM A;  3GGE A;  2G5M B;  2PKT A;  1UJU A;  3KHF A;  3GDS A;  2MHO A;  5E22 A;  3SFJ A;  2W7R A;  1I92 A;  1UEP A;  3WKM A;  1VB7 A;  1IU0 A;  3WKL A;  2HE2 A;  2I1N A;  2VRF A;  2KYL A;  2LA8 A;  4E34 A;  4JOJ A;  2EXG A;  3PS4 A;  2EAQ A;  5D13 A;  3KZD A;  2KL1 A;  2EEG A;  5HDY A;  3PV5 A;  5E11 A;  2GZV A;  4GVD A;  3NFL A;  3PDV A;  4F8K A;  2LUI A;  2AWX A;  2RRM A;  1M5Z A;  2JIL A;  1GM1 A;  4Q6S A;  3EGH C;  3RL8 A;  3BPU A; 
#chains in the Genus database with same CATH topology
 2BYG A;  5E21 A;  2EEI A;  4K6Y A;  5HET A;  2PA1 A;  4UU6 A;  1K32 A;  2PNT A;  2KV8 A;  2HGA A;  3CBX A;  2KQF A;  4Z33 A;  3KZE A;  2H3L A;  3AXA A;  5FHT A;  1W9O A;  2KA9 A;  4K75 A;  2KBS A;  1WHA A;  1GQ4 A;  2JXO A;  1V6B A;  1QAV A;  2OS6 A;  3PV4 A;  1UFX A;  2REY A;  1ZUB A;  2IWN A;  4P0C A;  1X8S A;  2L4T A;  2JWE A;  3GDU A;  2WL7 A;  4NMO A;  2KPL A;  3NGH A;  1Y7N A;  2H3M A;  1FC9 A;  2ZPL A;  4NMP A;  5G1D A;  3TMH A;  3TSV A;  1QLC A;  2OMJ A;  4YDP A;  2DAZ A;  3ID3 A;  2I04 A;  3DIW A;  2VSP A;  3O5N A;  1D5G A;  3CC0 A;  5E6P B;  5ILB A;  1Y8T A;  2FNE A;  1GQ5 A;  4NMT A;  1UEQ A;  1TE0 A;  4MPA A;  1V62 A;  2QBW A;  4NMV A;  2R4H A;  3PDZ A;  2QG1 A;  3QDO A;  5HF4 A;  4WYU A;  4KFV A;  2JSN A;  1N7E A;  3DOR A;  3QJN A;  1VAE A;  2EDV A;  1MFG A;  2OZF A;  4HOP B;  3CYY A;  2Z9I A;  3GCN A;  1Q3O A;  2OPG A;  5E1Y A;  2I0L A;  1SOT A;  2EV8 A;  2KOJ A;  1OBX A;  2JOA A;  1UIT A;  3JXT A;  5JXB A;  1N7F A;  2OCS A;  5A2P A;  2K1Z A;  3GDV A;  1KEF A;  2ZPM A;  3DJA A;  5EZ0 A;  2DLS A;  2RCZ A;  1UM1 A;  1V1T A;  1VCW A;  4GHN A;  4Q2Q A;  4E3B A;  2KJD A;  1FC6 A;  5HJ1 A;  2JIK A;  1MC7 A;  2KAW A;  4WYT A;  1PDR A;  1X5Q A;  2MX6 A;  1N6F A;  1LCY A;  2I4S A;  4PQW A;  5FB8 C;  2DM8 A;  1B8Q A;  3K1R A;  4OEO A;  2DJT A;  1Q7X A;  2CS5 A;  1I16 A;  2VSV A;  2IWO A;  2FN5 A;  1SOZ A;  2P3W A;  1U3B A;  2O2T A;  4Q2N A;  4NMS A;  2M0U A;  3L4F D;  4P2A B;  2Q3G A;  2CSJ A;  4NMQ A;  3FY5 A;  1TP5 A;  2E7K A;  2I0I A;  4L8N A;  1UF1 A;  2L4S A;  4RI0 A;  4OEP A;  2DB5 A;  2UZC A;  2KRG A;  4EDJ A;  2KPK A;  2FCF A;  4G69 A;  3GSL A;  2CSS A;  2YUB A;  3QIK A;  2Q9V A;  2AIN A;  4UU5 A;  4R2Z A;  4OAJ A;  3DJ1 A;  5I7Z A;  1WI2 A;  3ID1 A;  1YBO A;  1V5L A;  2V90 A;  1NTE A;  3LNY A;  2M0V A;  3GCO A;  1X6D A;  4NXP A;  4NXQ A;  2EGO A;  3OU0 A;  2QKT A;  4JJ3 A;  2EHR A;  1N6D A;  1WFG A;  3R0H A;  5HED A;  2LOB A;  4NNM A;  4GVC A;  1QAV B;  1Q3P A;  4YYX A;  2OGP A;  3SHU A;  3NFK A;  2EEJ A;  4FGM A;  4N6X A;  4K76 A;  2AWW A;  3ZRT A;  1RY4 A;  5B42 A;  2IWQ A;  3RL7 A;  2M3M A;  1XZ9 A;  2PKU A;  3OTP A;  2KG2 A;  2QKU A;  2K20 A;  4IC6 A;  3KDK A;  1OZI A;  3QGL A;  1KWA A;  4JOH A;  1WIF A;  3HVQ C;  2F0A A;  4XHV A;  3O46 A;  1WF8 A;  3B76 A;  1FC7 A;  4HOP A;  3GJ9 A;  1WI4 A;  3R69 A;  5G1E A;  3MH4 A;  3VQG A;  2OQS A;  1WJL A;  3NCV A;  4JOF A;  4E35 A;  2G2L A;  2ENO A;  5EYZ A;  2JIN A;  5GND A;  2VZ5 A;  4Z8J A;  4JOP A;  3RLE A;  1UEZ A;  2EGK A;  1L6O A;  3I1E A;  2D8I A;  1TP3 A;  2EJY A;  1BFE A;  3K82 A;  2YUY A;  4NNL A;  5GLJ A;  1R6J A;  3EGG C;  4JOG A;  3SUZ A;  1N6E A;  4REY A;  1W9E A;  5H3J A;  2QT5 A;  1U38 A;  4O06 A;  2EEH A;  3TSW A;  1NF3 C;  1RZX A;  5HF1 A;  5HEY A;  1WFV A;  4LMM A;  4JJ0 A;  1WHD A;  1VJ6 A;  2VPH A;  3HPK A;  3SHW A;  4Q3H A;  3I18 A;  3I4W A;  1X5N A;  3QJM A;  2FE5 A;  2PDZ A;  4JOK A;  3STJ A;  3QO6 A;  1BE9 A;  1UHP A;  1X5R A;  2H2C A;  1MFL A;  2AWU A;  3MH7 A;  1P1E A;  2D92 A;  1WH1 A;  2OSG A;  5DTH A;  4JOR A;  5B6L A;  1Z87 A;  2W4F A;  1UJD A;  2L97 A;  1TQ3 A;  2GEF A;  2JRE A;  1FCF A;  2KJK A;  2M10 A;  1ZOK A;  2H2B A;  5HFB A;  1RGW A;  4FLN A;  4JL7 A;  3R68 A;  2KJP A;  1X45 A;  2EDP A;  3CH8 A;  2I6V A;  1KY9 A;  2R3Y A;  1W9Q A;  2EGN A;  2M0Z A;  2KOH A;  3E17 A;  2PZD A;  1UJV A;  1QAU A;  2DC2 A;  3CBZ A;  3SOE A;  1OBY A;  1UM7 A;  3KDG A;  1WF7 A;  3ID2 A;  4Q6H A;  5HFC A;  3VQF A;  3K50 A;  1RGR A;  3TSZ A;  5IL9 A;  5HEB A;  1G9O A;  5F3X A;  1OBZ A;  5F67 A;  4H11 A;  2QKV A;  4Q2P A;  1U37 A;  1P1D A;  5HFF A;  1N7T A;  1T2M A;  1U39 A;  3DJ3 A;  2D90 A;  1V5Q A;  5HFD A;  2DKR A;  1UEW A;  2LC7 A;  4K72 A;  4Q2O A;  2V1W A;  2X7Z A;  2YTW A;  2M0T A;  4AMH A;  1Z86 A;  2EDZ A;  2YT8 A;  2DLU A;  2DMZ A;  4JOE A;  2HE4 A;  3PV2 A;  3ID4 A;  2F5Y A;  3CS0 A;  3LNX A;  2LC6 A;  4KFW A;  1IU2 A;  3CBY A;  1IHJ A;  4NMR A;  1N99 A;  3QE1 A;  2YT7 A;  5HFE A;  4K78 A;  4NXR A;  2Z17 A;  3MH6 A;  2KOM A;  1VA8 A;  2VWR A;  1WG6 A;  2IWP A;  3HPM A;  3GGE A;  2G5M B;  2PKT A;  1UJU A;  3KHF A;  3GDS A;  2MHO A;  5E22 A;  3SFJ A;  2W7R A;  1I92 A;  1UEP A;  3WKM A;  1VB7 A;  1IU0 A;  3WKL A;  2HE2 A;  2I1N A;  2VRF A;  2KYL A;  2LA8 A;  4E34 A;  4JOJ A;  2EXG A;  3PS4 A;  1X9Z A;  2EAQ A;  5D13 A;  3KZD A;  2KL1 A;  2EEG A;  5HDY A;  3PV5 A;  5E11 A;  2GZV A;  4GVD A;  3NFL A;  3GAB A;  3PDV A;  4F8K A;  2LUI A;  2AWX A;  2RRM A;  1M5Z A;  2JIL A;  1GM1 A;  4Q6S A;  3EGH C;  3RL8 A;  3BPU A; 
#chains in the Genus database with same CATH homology
 2BYG A;  5E21 A;  2EEI A;  4K6Y A;  5HET A;  2PA1 A;  4UU6 A;  1K32 A;  2PNT A;  2KV8 A;  2HGA A;  3CBX A;  2KQF A;  4Z33 A;  3KZE A;  2H3L A;  3AXA A;  5FHT A;  1W9O A;  2KA9 A;  4K75 A;  2KBS A;  1WHA A;  1GQ4 A;  2JXO A;  1V6B A;  1QAV A;  2OS6 A;  3PV4 A;  1UFX A;  2REY A;  1ZUB A;  2IWN A;  4P0C A;  1X8S A;  2L4T A;  2JWE A;  3GDU A;  2WL7 A;  4NMO A;  2KPL A;  3NGH A;  1Y7N A;  2H3M A;  1FC9 A;  2ZPL A;  4NMP A;  5G1D A;  3TMH A;  3TSV A;  1QLC A;  2OMJ A;  4YDP A;  2DAZ A;  3ID3 A;  2I04 A;  3DIW A;  2VSP A;  3O5N A;  1D5G A;  3CC0 A;  5E6P B;  5ILB A;  1Y8T A;  2FNE A;  1GQ5 A;  4NMT A;  1UEQ A;  1TE0 A;  4MPA A;  1V62 A;  2QBW A;  4NMV A;  2R4H A;  3PDZ A;  2QG1 A;  3QDO A;  5HF4 A;  4WYU A;  4KFV A;  2JSN A;  1N7E A;  3DOR A;  3QJN A;  1VAE A;  2EDV A;  1MFG A;  2OZF A;  4HOP B;  3CYY A;  2Z9I A;  3GCN A;  1Q3O A;  2OPG A;  5E1Y A;  2I0L A;  1SOT A;  2EV8 A;  2KOJ A;  1OBX A;  2JOA A;  1UIT A;  3JXT A;  5JXB A;  1N7F A;  2OCS A;  5A2P A;  2K1Z A;  3GDV A;  1KEF A;  2ZPM A;  3DJA A;  5EZ0 A;  2DLS A;  2RCZ A;  1UM1 A;  1V1T A;  1VCW A;  4GHN A;  4Q2Q A;  4E3B A;  2KJD A;  1FC6 A;  5HJ1 A;  2JIK A;  1MC7 A;  2KAW A;  4WYT A;  1PDR A;  1X5Q A;  2MX6 A;  1N6F A;  1LCY A;  2I4S A;  4PQW A;  5FB8 C;  2DM8 A;  1B8Q A;  3K1R A;  4OEO A;  2DJT A;  1Q7X A;  2CS5 A;  1I16 A;  2VSV A;  2IWO A;  2FN5 A;  1SOZ A;  2P3W A;  1U3B A;  2O2T A;  4Q2N A;  4NMS A;  2M0U A;  3L4F D;  4P2A B;  2Q3G A;  2CSJ A;  4NMQ A;  3FY5 A;  1TP5 A;  2E7K A;  2I0I A;  4L8N A;  1UF1 A;  2L4S A;  4RI0 A;  4OEP A;  2DB5 A;  2UZC A;  2KRG A;  4EDJ A;  2KPK A;  2FCF A;  4G69 A;  3GSL A;  2CSS A;  2YUB A;  3QIK A;  2Q9V A;  2AIN A;  4UU5 A;  4R2Z A;  4OAJ A;  3DJ1 A;  5I7Z A;  1WI2 A;  3ID1 A;  1YBO A;  1V5L A;  2V90 A;  1NTE A;  3LNY A;  2M0V A;  3GCO A;  1X6D A;  4NXP A;  4NXQ A;  2EGO A;  3OU0 A;  2QKT A;  4JJ3 A;  2EHR A;  1N6D A;  1WFG A;  3R0H A;  5HED A;  2LOB A;  4NNM A;  4GVC A;  1QAV B;  1Q3P A;  4YYX A;  2OGP A;  3SHU A;  3NFK A;  2EEJ A;  4FGM A;  4N6X A;  4K76 A;  2AWW A;  3ZRT A;  1RY4 A;  5B42 A;  2IWQ A;  3RL7 A;  2M3M A;  1XZ9 A;  2PKU A;  3OTP A;  2KG2 A;  2QKU A;  2K20 A;  4IC6 A;  3KDK A;  1OZI A;  3QGL A;  1KWA A;  4JOH A;  1WIF A;  3HVQ C;  2F0A A;  4XHV A;  3O46 A;  1WF8 A;  3B76 A;  1FC7 A;  4HOP A;  3GJ9 A;  1WI4 A;  3R69 A;  5G1E A;  3MH4 A;  3VQG A;  2OQS A;  1WJL A;  3NCV A;  4JOF A;  4E35 A;  2G2L A;  2ENO A;  5EYZ A;  2JIN A;  5GND A;  2VZ5 A;  4Z8J A;  4JOP A;  3RLE A;  1UEZ A;  2EGK A;  1L6O A;  3I1E A;  2D8I A;  1TP3 A;  2EJY A;  1BFE A;  3K82 A;  2YUY A;  4NNL A;  5GLJ A;  1R6J A;  3EGG C;  4JOG A;  3SUZ A;  1N6E A;  4REY A;  1W9E A;  5H3J A;  2QT5 A;  1U38 A;  4O06 A;  2EEH A;  3TSW A;  1NF3 C;  1RZX A;  5HF1 A;  5HEY A;  1WFV A;  4LMM A;  4JJ0 A;  1WHD A;  1VJ6 A;  2VPH A;  3HPK A;  3SHW A;  4Q3H A;  3I18 A;  3I4W A;  1X5N A;  3QJM A;  2FE5 A;  2PDZ A;  4JOK A;  3STJ A;  3QO6 A;  1BE9 A;  1UHP A;  1X5R A;  2H2C A;  1MFL A;  2AWU A;  3MH7 A;  1P1E A;  2D92 A;  1WH1 A;  2OSG A;  5DTH A;  4JOR A;  5B6L A;  1Z87 A;  2W4F A;  1UJD A;  2L97 A;  1TQ3 A;  2GEF A;  2JRE A;  1FCF A;  2KJK A;  2M10 A;  1ZOK A;  2H2B A;  5HFB A;  1RGW A;  4FLN A;  4JL7 A;  3R68 A;  2KJP A;  1X45 A;  2EDP A;  3CH8 A;  2I6V A;  1KY9 A;  2R3Y A;  1W9Q A;  2EGN A;  2M0Z A;  2KOH A;  3E17 A;  2PZD A;  1UJV A;  1QAU A;  2DC2 A;  3CBZ A;  3SOE A;  1OBY A;  1UM7 A;  3KDG A;  1WF7 A;  3ID2 A;  4Q6H A;  5HFC A;  3VQF A;  3K50 A;  1RGR A;  3TSZ A;  5IL9 A;  5HEB A;  1G9O A;  5F3X A;  1OBZ A;  5F67 A;  4H11 A;  2QKV A;  4Q2P A;  1U37 A;  1P1D A;  5HFF A;  1N7T A;  1T2M A;  1U39 A;  3DJ3 A;  2D90 A;  1V5Q A;  5HFD A;  2DKR A;  1UEW A;  2LC7 A;  4K72 A;  4Q2O A;  2V1W A;  2X7Z A;  2YTW A;  2M0T A;  4AMH A;  1Z86 A;  2EDZ A;  2YT8 A;  2DLU A;  2DMZ A;  4JOE A;  2HE4 A;  3PV2 A;  3ID4 A;  2F5Y A;  3CS0 A;  3LNX A;  2LC6 A;  4KFW A;  1IU2 A;  3CBY A;  1IHJ A;  4NMR A;  1N99 A;  3QE1 A;  2YT7 A;  5HFE A;  4K78 A;  4NXR A;  2Z17 A;  3MH6 A;  2KOM A;  1VA8 A;  2VWR A;  1WG6 A;  2IWP A;  3HPM A;  3GGE A;  2G5M B;  2PKT A;  1UJU A;  3KHF A;  3GDS A;  2MHO A;  5E22 A;  3SFJ A;  2W7R A;  1I92 A;  1UEP A;  3WKM A;  1VB7 A;  1IU0 A;  3WKL A;  2HE2 A;  2I1N A;  2VRF A;  2KYL A;  2LA8 A;  4E34 A;  4JOJ A;  2EXG A;  3PS4 A;  1X9Z A;  2EAQ A;  5D13 A;  3KZD A;  2KL1 A;  2EEG A;  5HDY A;  3PV5 A;  5E11 A;  2GZV A;  4GVD A;  3NFL A;  3GAB A;  3PDV A;  4F8K A;  2LUI A;  2AWX A;  2RRM A;  1M5Z A;  2JIL A;  1GM1 A;  4Q6S A;  3EGH C;  3RL8 A;  3BPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...