2VPHA

Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, pdz domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVESTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 4
publication title Crystal Structure of the Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2vphA01
1BFEA 2AWUA 2VZ5A 4NXRA 3GDUA 1MC7A 3GCOA 1N99A 2LOBA 1FC6A 2EEGA 1W9OA 2PZDA 2KBSA 4KFWA 3BPUA 2ZPMA 1UJDA 4PQWA 1FC9A 1U39A 3NGHA 1V1TA 3TSZA 2EHRA 3GDVA 2HGAA 2M0TA 4OAJA 2G2LA 1V6BA 2PKUA 1RGWA 3OU0A 1N6FA 1UITA 2HE4A 1W9QA 2R4HA 2CS5A 2DAZA 2OS6A 3I1EA 1N6EA 2D8IA 3K1RA 1UF1A 2KAWA 1GQ4A 4NMPA 3QE1A 4NNMA 2LUIA 2ZPLA 1UJVA 4R2ZA 2KJKA 2Z9IA 2PDZA 2EGNA 3I4WA 3R68A 1WHAA 4E35A 4NMTA 5DTHA 1GM1A 3KZDA 3L4FD 1I92A 3MH4A 3KHFA 4K72A 5G1DA 2Z17A 2YTWA 2KJDA 1QAVA 2AWWA 2FCFA 2KOMA 1UM1A 1UEQA 3FY5A 2HE2A 2EDPA 5HJ1A 3PDZA 3ID1A 1XZ9A 3DIWA 1RGRA 1WF8A 4P0CA 3DJ3A 1N7TA 3HPMA 5A2PA 1K32A 2KJPA 4GVCA 3AXAA 2EEJA 4WYTA 4HOPA 3NFKA 2DMZA 4Q3HA 1X5NA 3HPKA 4F8KA 5HF4A 1TQ3A 1X45A 3VQGA 4OEOA 1D5GA 2UZCA 3QJMA 1OZIA 2JILA 2LC6A 2EV8A 2IWOA 4E3BA 3RL7A 3DJAA 2QBWA 2JREA 3E17A 3QDOA 2QKUA 3SOEA 1V5LA 1U38A 1V5QA 2JOAA 4OEPA 2JINA 2H2CA 2KG2A 2DKRA 1IHJA 1RZXA 4K78A 2L4TA 3GCNA 4JOGA 2GZVA 4Q2QA 4JOPA 5E6PB 1WI4A 4K75A 3PV5A 5GLJA 3ID3A 3O46A 2FE5A 3K50A 3LNXA 3QJNA 5HETA 2RCZA 2V90A 4UU5A 1SOTA 4WYUA 1Z86A 3SUZA 2DJTA 2KV8A 4N6XA 3SHWA 2IWPA 2D90A 3PV4A 3QGLA 4Q6SA 2EDZA 1TE0A 1FCFA 1VJ6A 2PKTA 1LCYA 2DB5A 2EDVA 2H3LA 4JORA 1VCWA 2M0ZA 4NXQA 5HEYA 2FNEA 2QG1A 1V62A 1UFXA 2EXGA 4K76A 5HFCA 1Q3OA 5FB8C 2EAQA 4Q2OA 1QLCA 2OPGA 2AWXA 2X7ZA 1UEZA 2Q3GA 1SOZA 3OTPA 2OSGA 2IWNA 5HFEA 2L4SA 2O2TA 2EJYA 2K1ZA 3PS4A 4Q2PA 2G5MB 2KQFA 1PDRA 2KL1A 3DJ1A 2QKVA 3I18A 3JXTA 5I7ZA 3TSVA 4UU6A 2M3MA 3ID4A 2H3MA 5F3XA 4E34A 1UM7A 3KZEA 1OBZA 4NNLA 4NMVA 4YDPA 2OQSA 2K20A 2WL7A 2W7RA 5H3JA 5E11A 4G69A 3CBXA 4JOFA 2OGPA 2M0VA 3O5NA 5HFFA 2EEIA 1BE9A 3DORA 5HEBA 4JOHA 1Y8TA 5EZ0A 1VA8A 3QIKA 2YT7A 5HDYA 1WF7A 2MX6A 2CSJA 4LMMA 2M10A 3RL8A 5G1EA 3HVQC 1QAVB 2M0UA 4P2AB 4NXPA 5HEDA 3R69A 1KEFA 3MH6A 3GSLA 2I6VA 1WI2A 4JOEA 1U37A 3B76A 5E1YA 1M5ZA 2I4SA 1ZUBA 4FGMA 5GNDA 1IU0A 2JWEA 3GDSA 3STJA 3CC0A 4HOPB 1WHDA 2REYA 2OCSA 3ID2A 1N6DA 2MHOA 1N7EA 3WKMA 4MPAA 1WFVA 3WKLA 1TP3A 2FN5A 3K82A 1WH1A 2KPLA 1RY4A 3TSWA 1WJLA 4Q6HA 1Q3PA 1QAUA 4AMHA 1X8SA 4Z33A 2KYLA 1UEPA 3PDVA 3VQFA 5E21A 1GQ5A 1Q7XA 2BYGA 4GHNA 1L6OA 1W9EA 2W4FA 1Y7NA 2L97A 4NMQA 2D92A 5HFDA 2VRFA 2EGOA 3CH8A 4JOKA 1UJUA 1UHPA 1Z87A 2EGKA 2IWQA 1WFGA 2Q9VA 3CS0A 2V1WA 5HFBA 2YT8A 2VSPA 4JL7A 5B6LA 1G9OA 1KY9A 5JXBA 2KRGA 2F0AA 4NMOA 1YBOA 1N7FA 2LC7A 2QKTA 5F67A 2OZFA 3EGHC 4Z8JA 3R0HA 3PV2A 3SHUA 1UEWA 4NMRA 1ZOKA 2RRMA 1X5RA 1P1DA 2CSSA 3GGEA 3RLEA 1MFGA 2F5YA 1OBXA 2P3WA 2I0LA 2YUYA 1NTEA 3MH7A 1WIFA 2DM8A 5E22A 1VB7A 4KFVA 1NF3C 2KOHA 4EDJA 3GJ9A 3NFLA 2ENOA 4O06A 2KOJA 4XHVA 1B8QA 2H2BA 4IC6A 2DLUA 3EGGC 4L8NA 1OBYA 5HF1A 1IU2A 4GVDA 4K6YA 4NMSA 2I1NA 2JIKA 4JOJA 1I16A 2VPHA 3QO6A 2YUBA 1X5QA 2AINA 1X6DA 2PNTA 1FC7A 2VSVA 1P1EA 4YYXA 3TMHA 3CBYA 2DLSA 2OMJA 2I0IA 5D13A 3CBZA 1TP5A 3LNYA 2DC2A 1KWAA 1T2MA 2I04A 4REYA 2JXOA 2KPKA 2EEHA 1MFLA 1R6JA 2LA8A 4RI0A 2PA1A 1U3BA 4Q2NA 1VAEA 2R3YA 5FHTA 1WG6A 2VWRA 3CYYA 2E7KA 3ZRTA 5EYZA 2KA9A 2QT5A 3SFJA 4H11A
chains in the Genus database with same CATH superfamily
1BFEA 2AWUA 2VZ5A 4NXRA 3GDUA 1MC7A 3GCOA 1N99A 2LOBA 1FC6A 2EEGA 1W9OA 2PZDA 2KBSA 4KFWA 3BPUA 2ZPMA 1UJDA 4PQWA 1FC9A 1U39A 3NGHA 1V1TA 3TSZA 2EHRA 2GEFA 3GDVA 2HGAA 2M0TA 4OAJA 2G2LA 1V6BA 2PKUA 1RGWA 3OU0A 1N6FA 1UITA 2HE4A 1W9QA 2R4HA 2CS5A 2DAZA 2OS6A 3I1EA 1N6EA 2D8IA 3K1RA 1UF1A 2KAWA 1GQ4A 4NMPA 3QE1A 4NNMA 2LUIA 2ZPLA 1UJVA 4R2ZA 2KJKA 2Z9IA 2PDZA 2EGNA 3I4WA 3R68A 1WHAA 4E35A 4NMTA 5DTHA 1GM1A 3KZDA 3L4FD 1I92A 3MH4A 3KHFA 4K72A 5G1DA 2Z17A 2YTWA 2KJDA 1QAVA 2AWWA 2FCFA 2KOMA 1UM1A 1UEQA 3FY5A 2HE2A 2EDPA 5HJ1A 3PDZA 3ID1A 1XZ9A 3DIWA 1RGRA 1WF8A 4P0CA 3DJ3A 1N7TA 3HPMA 5A2PA 1K32A 2KJPA 4GVCA 3AXAA 2EEJA 4WYTA 4HOPA 3NFKA 2DMZA 4Q3HA 1X5NA 3HPKA 4F8KA 5HF4A 1TQ3A 1X45A 3VQGA 4OEOA 1D5GA 2UZCA 3QJMA 1OZIA 2JILA 2LC6A 2EV8A 2IWOA 4E3BA 3RL7A 3DJAA 2QBWA 2JREA 3E17A 3QDOA 2QKUA 3SOEA 1V5LA 1U38A 1V5QA 2JOAA 4OEPA 2JINA 2H2CA 2KG2A 2DKRA 1IHJA 1RZXA 4K78A 2L4TA 3GCNA 4JOGA 2GZVA 4Q2QA 4JOPA 5E6PB 1WI4A 4K75A 3PV5A 5GLJA 5B42A 3ID3A 3O46A 2FE5A 3K50A 3LNXA 3QJNA 5HETA 2RCZA 2V90A 4UU5A 1SOTA 4WYUA 1Z86A 3SUZA 2DJTA 2KV8A 4N6XA 3GABA 3SHWA 2IWPA 2D90A 3PV4A 3QGLA 4Q6SA 2EDZA 1TE0A 5ILBA 1FCFA 1VJ6A 2PKTA 1LCYA 2DB5A 2EDVA 2H3LA 4JORA 1VCWA 2M0ZA 4NXQA 5HEYA 2FNEA 2QG1A 1V62A 1UFXA 2EXGA 4K76A 5HFCA 1Q3OA 5FB8C 2EAQA 4Q2OA 1QLCA 2OPGA 2AWXA 2X7ZA 1UEZA 2Q3GA 1SOZA 3OTPA 2OSGA 2IWNA 5HFEA 2L4SA 2O2TA 4JJ3A 2EJYA 2K1ZA 3PS4A 4Q2PA 2G5MB 2KQFA 1PDRA 2KL1A 3DJ1A 2QKVA 3I18A 3JXTA 5I7ZA 3TSVA 4UU6A 2M3MA 3ID4A 2H3MA 5F3XA 4E34A 1UM7A 5IL9A 3KZEA 1OBZA 4NNLA 4NMVA 4YDPA 2OQSA 2K20A 2WL7A 2W7RA 5H3JA 5E11A 4G69A 3CBXA 4JOFA 2OGPA 2M0VA 3O5NA 5HFFA 2EEIA 1BE9A 3DORA 5HEBA 4JOHA 1Y8TA 5EZ0A 1VA8A 3QIKA 2YT7A 5HDYA 1WF7A 2MX6A 2CSJA 4LMMA 2M10A 3RL8A 5G1EA 3HVQC 1QAVB 2M0UA 4P2AB 4NXPA 5HEDA 3R69A 1KEFA 3KDGA 3MH6A 3GSLA 2I6VA 1WI2A 4JOEA 1U37A 3B76A 5E1YA 1M5ZA 2I4SA 1ZUBA 4FGMA 5GNDA 1IU0A 2JWEA 3GDSA 3STJA 3CC0A 4HOPB 1WHDA 2REYA 2OCSA 3ID2A 1N6DA 2MHOA 1N7EA 3WKMA 4MPAA 1WFVA 3WKLA 1TP3A 2FN5A 3K82A 1WH1A 2KPLA 1RY4A 3TSWA 1WJLA 1X9ZA 4Q6HA 1Q3PA 1QAUA 4AMHA 1X8SA 4Z33A 2KYLA 1UEPA 3PDVA 3VQFA 5E21A 1GQ5A 1Q7XA 2BYGA 4GHNA 1L6OA 1W9EA 2W4FA 1Y7NA 2L97A 4NMQA 3KDKA 2D92A 5HFDA 2VRFA 2EGOA 3CH8A 4JOKA 1UJUA 1UHPA 1Z87A 2EGKA 2IWQA 1WFGA 2Q9VA 3CS0A 2V1WA 5HFBA 2YT8A 2VSPA 4JL7A 5B6LA 1G9OA 1KY9A 5JXBA 2KRGA 2F0AA 4NMOA 1YBOA 1N7FA 2LC7A 2QKTA 5F67A 2OZFA 3EGHC 4Z8JA 3R0HA 3PV2A 3SHUA 1UEWA 4NMRA 1ZOKA 2RRMA 1X5RA 1P1DA 2CSSA 3GGEA 3RLEA 1MFGA 2F5YA 1OBXA 2P3WA 2I0LA 2YUYA 1NTEA 3MH7A 1WIFA 2JSNA 2DM8A 5E22A 1VB7A 4KFVA 1NF3C 2KOHA 4EDJA 3GJ9A 3NFLA 2ENOA 4O06A 2KOJA 4XHVA 1B8QA 2H2BA 4IC6A 2DLUA 3EGGC 4L8NA 4FLNA 1OBYA 5HF1A 1IU2A 4GVDA 4K6YA 4JJ0A 4NMSA 3NCVA 2I1NA 2JIKA 4JOJA 1I16A 2VPHA 3QO6A 2YUBA 1X5QA 2AINA 1X6DA 2PNTA 1FC7A 2VSVA 1P1EA 4YYXA 3TMHA 3CBYA 2DLSA 2OMJA 2I0IA 5D13A 3CBZA 1TP5A 3LNYA 2DC2A 1KWAA 1T2MA 2I04A 4REYA 2JXOA 2KPKA 2EEHA 1MFLA 1R6JA 2LA8A 4RI0A 2PA1A 1U3BA 4Q2NA 1VAEA 2R3YA 5FHTA 1WG6A 2VWRA 3CYYA 2E7KA 3ZRTA 5EYZA 2KA9A 2QT5A 3SFJA 4H11A
chains in the Genus database with same CATH topology
1BFEA 2AWUA 2VZ5A 4NXRA 3GDUA 1MC7A 3GCOA 1N99A 2LOBA 1FC6A 2EEGA 1W9OA 2PZDA 2KBSA 4KFWA 3BPUA 2ZPMA 1UJDA 4PQWA 1FC9A 1U39A 3NGHA 1V1TA 3TSZA 2EHRA 2GEFA 3GDVA 2HGAA 2M0TA 4OAJA 2G2LA 1V6BA 2PKUA 1RGWA 3OU0A 1N6FA 1UITA 2HE4A 1W9QA 2R4HA 2CS5A 2DAZA 2OS6A 3I1EA 1N6EA 2D8IA 3K1RA 1UF1A 2KAWA 1GQ4A 4NMPA 3QE1A 4NNMA 2LUIA 2ZPLA 1UJVA 4R2ZA 2KJKA 2Z9IA 2PDZA 2EGNA 3I4WA 3R68A 1WHAA 4E35A 4NMTA 5DTHA 1GM1A 3KZDA 3L4FD 1I92A 3MH4A 3KHFA 4K72A 5G1DA 2Z17A 2YTWA 2KJDA 1QAVA 2AWWA 2FCFA 2KOMA 1UM1A 1UEQA 3FY5A 2HE2A 2EDPA 5HJ1A 3PDZA 3ID1A 1XZ9A 3DIWA 1RGRA 1WF8A 4P0CA 3DJ3A 1N7TA 3HPMA 5A2PA 1K32A 2KJPA 4GVCA 3AXAA 2EEJA 4WYTA 4HOPA 3NFKA 2DMZA 4Q3HA 1X5NA 3HPKA 4F8KA 5HF4A 1TQ3A 1X45A 3VQGA 4OEOA 1D5GA 2UZCA 3QJMA 1OZIA 2JILA 2LC6A 2EV8A 2IWOA 4E3BA 3RL7A 3DJAA 2QBWA 2JREA 3E17A 3QDOA 2QKUA 3SOEA 1V5LA 1U38A 1V5QA 2JOAA 4OEPA 2JINA 2H2CA 2KG2A 2DKRA 1IHJA 1RZXA 4K78A 2L4TA 3GCNA 4JOGA 2GZVA 4Q2QA 4JOPA 5E6PB 1WI4A 4K75A 3PV5A 5GLJA 5B42A 3ID3A 3O46A 2FE5A 3K50A 3LNXA 3QJNA 5HETA 2RCZA 2V90A 4UU5A 1SOTA 4WYUA 1Z86A 3SUZA 2DJTA 2KV8A 4N6XA 3GABA 3SHWA 2IWPA 2D90A 3PV4A 3QGLA 4Q6SA 2EDZA 1TE0A 5ILBA 1FCFA 1VJ6A 2PKTA 1LCYA 2DB5A 2EDVA 2H3LA 4JORA 1VCWA 2M0ZA 4NXQA 5HEYA 2FNEA 2QG1A 1V62A 1UFXA 2EXGA 4K76A 5HFCA 1Q3OA 5FB8C 2EAQA 4Q2OA 1QLCA 2OPGA 2AWXA 2X7ZA 1UEZA 2Q3GA 1SOZA 3OTPA 2OSGA 2IWNA 5HFEA 2L4SA 2O2TA 4JJ3A 2EJYA 2K1ZA 3PS4A 4Q2PA 2G5MB 2KQFA 1PDRA 2KL1A 3DJ1A 2QKVA 3I18A 3JXTA 5I7ZA 3TSVA 4UU6A 2M3MA 3ID4A 2H3MA 5F3XA 4E34A 1UM7A 5IL9A 3KZEA 1OBZA 4NNLA 4NMVA 4YDPA 2OQSA 2K20A 2WL7A 2W7RA 5H3JA 5E11A 4G69A 3CBXA 4JOFA 2OGPA 2M0VA 3O5NA 5HFFA 2EEIA 1BE9A 3DORA 5HEBA 4JOHA 1Y8TA 5EZ0A 1VA8A 3QIKA 2YT7A 5HDYA 1WF7A 2MX6A 2CSJA 4LMMA 2M10A 3RL8A 5G1EA 3HVQC 1QAVB 2M0UA 4P2AB 4NXPA 5HEDA 3R69A 1KEFA 3KDGA 3MH6A 3GSLA 2I6VA 1WI2A 4JOEA 1U37A 3B76A 5E1YA 1M5ZA 2I4SA 1ZUBA 4FGMA 5GNDA 1IU0A 2JWEA 3GDSA 3STJA 3CC0A 4HOPB 1WHDA 2REYA 2OCSA 3ID2A 1N6DA 2MHOA 1N7EA 3WKMA 4MPAA 1WFVA 3WKLA 1TP3A 2FN5A 3K82A 1WH1A 2KPLA 1RY4A 3TSWA 1WJLA 1X9ZA 4Q6HA 1Q3PA 1QAUA 4AMHA 1X8SA 4Z33A 2KYLA 1UEPA 3PDVA 3VQFA 5E21A 1GQ5A 1Q7XA 2BYGA 4GHNA 1L6OA 1W9EA 2W4FA 1Y7NA 2L97A 4NMQA 3KDKA 2D92A 5HFDA 2VRFA 2EGOA 3CH8A 4JOKA 1UJUA 1UHPA 1Z87A 2EGKA 2IWQA 1WFGA 2Q9VA 3CS0A 2V1WA 5HFBA 2YT8A 2VSPA 4JL7A 5B6LA 1G9OA 1KY9A 5JXBA 2KRGA 2F0AA 4NMOA 1YBOA 1N7FA 2LC7A 2QKTA 5F67A 2OZFA 3EGHC 4Z8JA 3R0HA 3PV2A 3SHUA 1UEWA 4NMRA 1ZOKA 2RRMA 1X5RA 1P1DA 2CSSA 3GGEA 3RLEA 1MFGA 2F5YA 1OBXA 2P3WA 2I0LA 2YUYA 1NTEA 3MH7A 1WIFA 2JSNA 2DM8A 5E22A 1VB7A 4KFVA 1NF3C 2KOHA 4EDJA 3GJ9A 3NFLA 2ENOA 4O06A 2KOJA 4XHVA 1B8QA 2H2BA 4IC6A 2DLUA 3EGGC 4L8NA 4FLNA 1OBYA 5HF1A 1IU2A 4GVDA 4K6YA 4JJ0A 4NMSA 3NCVA 2I1NA 2JIKA 4JOJA 1I16A 2VPHA 3QO6A 2YUBA 1X5QA 2AINA 1X6DA 2PNTA 1FC7A 2VSVA 1P1EA 4YYXA 3TMHA 3CBYA 2DLSA 2OMJA 2I0IA 5D13A 3CBZA 1TP5A 3LNYA 2DC2A 1KWAA 1T2MA 2I04A 4REYA 2JXOA 2KPKA 2EEHA 1MFLA 1R6JA 2LA8A 4RI0A 2PA1A 1U3BA 4Q2NA 1VAEA 2R3YA 5FHTA 1WG6A 2VWRA 3CYYA 2E7KA 3ZRTA 5EYZA 2KA9A 2QT5A 3SFJA 4H11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFE A;  2AWU A;  2VZ5 A;  4NXR A;  3GDU A;  1MC7 A;  3GCO A;  1N99 A;  2LOB A;  1FC6 A;  2EEG A;  1W9O A;  2PZD A;  2KBS A;  4KFW A;  3BPU A;  2ZPM A;  1UJD A;  4PQW A;  1FC9 A;  1U39 A;  3NGH A;  1V1T A;  3TSZ A;  2EHR A;  3GDV A;  2HGA A;  2M0T A;  4OAJ A;  2G2L A;  1V6B A;  2PKU A;  1RGW A;  3OU0 A;  1N6F A;  1UIT A;  2HE4 A;  1W9Q A;  2R4H A;  2CS5 A;  2DAZ A;  2OS6 A;  3I1E A;  1N6E A;  2D8I A;  3K1R A;  1UF1 A;  2KAW A;  1GQ4 A;  4NMP A;  3QE1 A;  4NNM A;  2LUI A;  2ZPL A;  1UJV A;  4R2Z A;  2KJK A;  2Z9I A;  2PDZ A;  2EGN A;  3I4W A;  3R68 A;  1WHA A;  4E35 A;  4NMT A;  5DTH A;  1GM1 A;  3KZD A;  3L4F D;  1I92 A;  3MH4 A;  3KHF A;  4K72 A;  5G1D A;  2Z17 A;  2YTW A;  2KJD A;  1QAV A;  2AWW A;  2FCF A;  2KOM A;  1UM1 A;  1UEQ A;  3FY5 A;  2HE2 A;  2EDP A;  5HJ1 A;  3PDZ A;  3ID1 A;  1XZ9 A;  3DIW A;  1RGR A;  1WF8 A;  4P0C A;  3DJ3 A;  1N7T A;  3HPM A;  5A2P A;  1K32 A;  2KJP A;  4GVC A;  3AXA A;  2EEJ A;  4WYT A;  4HOP A;  3NFK A;  2DMZ A;  4Q3H A;  1X5N A;  3HPK A;  4F8K A;  5HF4 A;  1TQ3 A;  1X45 A;  3VQG A;  4OEO A;  1D5G A;  2UZC A;  3QJM A;  1OZI A;  2JIL A;  2LC6 A;  2EV8 A;  2IWO A;  4E3B A;  3RL7 A;  3DJA A;  2QBW A;  2JRE A;  3E17 A;  3QDO A;  2QKU A;  3SOE A;  1V5L A;  1U38 A;  1V5Q A;  2JOA A;  4OEP A;  2JIN A;  2H2C A;  2KG2 A;  2DKR A;  1IHJ A;  1RZX A;  4K78 A;  2L4T A;  3GCN A;  4JOG A;  2GZV A;  4Q2Q A;  4JOP A;  5E6P B;  1WI4 A;  4K75 A;  3PV5 A;  5GLJ A;  3ID3 A;  3O46 A;  2FE5 A;  3K50 A;  3LNX A;  3QJN A;  5HET A;  2RCZ A;  2V90 A;  4UU5 A;  1SOT A;  4WYU A;  1Z86 A;  3SUZ A;  2DJT A;  2KV8 A;  4N6X A;  3SHW A;  2IWP A;  2D90 A;  3PV4 A;  3QGL A;  4Q6S A;  2EDZ A;  1TE0 A;  1FCF A;  1VJ6 A;  2PKT A;  1LCY A;  2DB5 A;  2EDV A;  2H3L A;  4JOR A;  1VCW A;  2M0Z A;  4NXQ A;  5HEY A;  2FNE A;  2QG1 A;  1V62 A;  1UFX A;  2EXG A;  4K76 A;  5HFC A;  1Q3O A;  5FB8 C;  2EAQ A;  4Q2O A;  1QLC A;  2OPG A;  2AWX A;  2X7Z A;  1UEZ A;  2Q3G A;  1SOZ A;  3OTP A;  2OSG A;  2IWN A;  5HFE A;  2L4S A;  2O2T A;  2EJY A;  2K1Z A;  3PS4 A;  4Q2P A;  2G5M B;  2KQF A;  1PDR A;  2KL1 A;  3DJ1 A;  2QKV A;  3I18 A;  3JXT A;  5I7Z A;  3TSV A;  4UU6 A;  2M3M A;  3ID4 A;  2H3M A;  5F3X A;  4E34 A;  1UM7 A;  3KZE A;  1OBZ A;  4NNL A;  4NMV A;  4YDP A;  2OQS A;  2K20 A;  2WL7 A;  2W7R A;  5H3J A;  5E11 A;  4G69 A;  3CBX A;  4JOF A;  2OGP A;  2M0V A;  3O5N A;  5HFF A;  2EEI A;  1BE9 A;  3DOR A;  5HEB A;  4JOH A;  1Y8T A;  5EZ0 A;  1VA8 A;  3QIK A;  2YT7 A;  5HDY A;  1WF7 A;  2MX6 A;  2CSJ A;  4LMM A;  2M10 A;  3RL8 A;  5G1E A;  3HVQ C;  1QAV B;  2M0U A;  4P2A B;  4NXP A;  5HED A;  3R69 A;  1KEF A;  3MH6 A;  3GSL A;  2I6V A;  1WI2 A;  4JOE A;  1U37 A;  3B76 A;  5E1Y A;  1M5Z A;  2I4S A;  1ZUB A;  4FGM A;  5GND A;  1IU0 A;  2JWE A;  3GDS A;  3STJ A;  3CC0 A;  4HOP B;  1WHD A;  2REY A;  2OCS A;  3ID2 A;  1N6D A;  2MHO A;  1N7E A;  3WKM A;  4MPA A;  1WFV A;  3WKL A;  1TP3 A;  2FN5 A;  3K82 A;  1WH1 A;  2KPL A;  1RY4 A;  3TSW A;  1WJL A;  4Q6H A;  1Q3P A;  1QAU A;  4AMH A;  1X8S A;  4Z33 A;  2KYL A;  1UEP A;  3PDV A;  3VQF A;  5E21 A;  1GQ5 A;  1Q7X A;  2BYG A;  4GHN A;  1L6O A;  1W9E A;  2W4F A;  1Y7N A;  2L97 A;  4NMQ A;  2D92 A;  5HFD A;  2VRF A;  2EGO A;  3CH8 A;  4JOK A;  1UJU A;  1UHP A;  1Z87 A;  2EGK A;  2IWQ A;  1WFG A;  2Q9V A;  3CS0 A;  2V1W A;  5HFB A;  2YT8 A;  2VSP A;  4JL7 A;  5B6L A;  1G9O A;  1KY9 A;  5JXB A;  2KRG A;  2F0A A;  4NMO A;  1YBO A;  1N7F A;  2LC7 A;  2QKT A;  5F67 A;  2OZF A;  3EGH C;  4Z8J A;  3R0H A;  3PV2 A;  3SHU A;  1UEW A;  4NMR A;  1ZOK A;  2RRM A;  1X5R A;  1P1D A;  2CSS A;  3GGE A;  3RLE A;  1MFG A;  2F5Y A;  1OBX A;  2P3W A;  2I0L A;  2YUY A;  1NTE A;  3MH7 A;  1WIF A;  2DM8 A;  5E22 A;  1VB7 A;  4KFV A;  1NF3 C;  2KOH A;  4EDJ A;  3GJ9 A;  3NFL A;  2ENO A;  4O06 A;  2KOJ A;  4XHV A;  1B8Q A;  2H2B A;  4IC6 A;  2DLU A;  3EGG C;  4L8N A;  1OBY A;  5HF1 A;  1IU2 A;  4GVD A;  4K6Y A;  4NMS A;  2I1N A;  2JIK A;  4JOJ A;  1I16 A;  2VPH A;  3QO6 A;  2YUB A;  1X5Q A;  2AIN A;  1X6D A;  2PNT A;  1FC7 A;  2VSV A;  1P1E A;  4YYX A;  3TMH A;  3CBY A;  2DLS A;  2OMJ A;  2I0I A;  5D13 A;  3CBZ A;  1TP5 A;  3LNY A;  2DC2 A;  1KWA A;  1T2M A;  2I04 A;  4REY A;  2JXO A;  2KPK A;  2EEH A;  1MFL A;  1R6J A;  2LA8 A;  4RI0 A;  2PA1 A;  1U3B A;  4Q2N A;  1VAE A;  2R3Y A;  5FHT A;  1WG6 A;  2VWR A;  3CYY A;  2E7K A;  3ZRT A;  5EYZ A;  2KA9 A;  2QT5 A;  3SFJ A;  4H11 A; 
#chains in the Genus database with same CATH topology
 1BFE A;  2AWU A;  2VZ5 A;  4NXR A;  3GDU A;  1MC7 A;  3GCO A;  1N99 A;  2LOB A;  1FC6 A;  2EEG A;  1W9O A;  2PZD A;  2KBS A;  4KFW A;  3BPU A;  2ZPM A;  1UJD A;  4PQW A;  1FC9 A;  1U39 A;  3NGH A;  1V1T A;  3TSZ A;  2EHR A;  2GEF A;  3GDV A;  2HGA A;  2M0T A;  4OAJ A;  2G2L A;  1V6B A;  2PKU A;  1RGW A;  3OU0 A;  1N6F A;  1UIT A;  2HE4 A;  1W9Q A;  2R4H A;  2CS5 A;  2DAZ A;  2OS6 A;  3I1E A;  1N6E A;  2D8I A;  3K1R A;  1UF1 A;  2KAW A;  1GQ4 A;  4NMP A;  3QE1 A;  4NNM A;  2LUI A;  2ZPL A;  1UJV A;  4R2Z A;  2KJK A;  2Z9I A;  2PDZ A;  2EGN A;  3I4W A;  3R68 A;  1WHA A;  4E35 A;  4NMT A;  5DTH A;  1GM1 A;  3KZD A;  3L4F D;  1I92 A;  3MH4 A;  3KHF A;  4K72 A;  5G1D A;  2Z17 A;  2YTW A;  2KJD A;  1QAV A;  2AWW A;  2FCF A;  2KOM A;  1UM1 A;  1UEQ A;  3FY5 A;  2HE2 A;  2EDP A;  5HJ1 A;  3PDZ A;  3ID1 A;  1XZ9 A;  3DIW A;  1RGR A;  1WF8 A;  4P0C A;  3DJ3 A;  1N7T A;  3HPM A;  5A2P A;  1K32 A;  2KJP A;  4GVC A;  3AXA A;  2EEJ A;  4WYT A;  4HOP A;  3NFK A;  2DMZ A;  4Q3H A;  1X5N A;  3HPK A;  4F8K A;  5HF4 A;  1TQ3 A;  1X45 A;  3VQG A;  4OEO A;  1D5G A;  2UZC A;  3QJM A;  1OZI A;  2JIL A;  2LC6 A;  2EV8 A;  2IWO A;  4E3B A;  3RL7 A;  3DJA A;  2QBW A;  2JRE A;  3E17 A;  3QDO A;  2QKU A;  3SOE A;  1V5L A;  1U38 A;  1V5Q A;  2JOA A;  4OEP A;  2JIN A;  2H2C A;  2KG2 A;  2DKR A;  1IHJ A;  1RZX A;  4K78 A;  2L4T A;  3GCN A;  4JOG A;  2GZV A;  4Q2Q A;  4JOP A;  5E6P B;  1WI4 A;  4K75 A;  3PV5 A;  5GLJ A;  5B42 A;  3ID3 A;  3O46 A;  2FE5 A;  3K50 A;  3LNX A;  3QJN A;  5HET A;  2RCZ A;  2V90 A;  4UU5 A;  1SOT A;  4WYU A;  1Z86 A;  3SUZ A;  2DJT A;  2KV8 A;  4N6X A;  3GAB A;  3SHW A;  2IWP A;  2D90 A;  3PV4 A;  3QGL A;  4Q6S A;  2EDZ A;  1TE0 A;  5ILB A;  1FCF A;  1VJ6 A;  2PKT A;  1LCY A;  2DB5 A;  2EDV A;  2H3L A;  4JOR A;  1VCW A;  2M0Z A;  4NXQ A;  5HEY A;  2FNE A;  2QG1 A;  1V62 A;  1UFX A;  2EXG A;  4K76 A;  5HFC A;  1Q3O A;  5FB8 C;  2EAQ A;  4Q2O A;  1QLC A;  2OPG A;  2AWX A;  2X7Z A;  1UEZ A;  2Q3G A;  1SOZ A;  3OTP A;  2OSG A;  2IWN A;  5HFE A;  2L4S A;  2O2T A;  4JJ3 A;  2EJY A;  2K1Z A;  3PS4 A;  4Q2P A;  2G5M B;  2KQF A;  1PDR A;  2KL1 A;  3DJ1 A;  2QKV A;  3I18 A;  3JXT A;  5I7Z A;  3TSV A;  4UU6 A;  2M3M A;  3ID4 A;  2H3M A;  5F3X A;  4E34 A;  1UM7 A;  5IL9 A;  3KZE A;  1OBZ A;  4NNL A;  4NMV A;  4YDP A;  2OQS A;  2K20 A;  2WL7 A;  2W7R A;  5H3J A;  5E11 A;  4G69 A;  3CBX A;  4JOF A;  2OGP A;  2M0V A;  3O5N A;  5HFF A;  2EEI A;  1BE9 A;  3DOR A;  5HEB A;  4JOH A;  1Y8T A;  5EZ0 A;  1VA8 A;  3QIK A;  2YT7 A;  5HDY A;  1WF7 A;  2MX6 A;  2CSJ A;  4LMM A;  2M10 A;  3RL8 A;  5G1E A;  3HVQ C;  1QAV B;  2M0U A;  4P2A B;  4NXP A;  5HED A;  3R69 A;  1KEF A;  3KDG A;  3MH6 A;  3GSL A;  2I6V A;  1WI2 A;  4JOE A;  1U37 A;  3B76 A;  5E1Y A;  1M5Z A;  2I4S A;  1ZUB A;  4FGM A;  5GND A;  1IU0 A;  2JWE A;  3GDS A;  3STJ A;  3CC0 A;  4HOP B;  1WHD A;  2REY A;  2OCS A;  3ID2 A;  1N6D A;  2MHO A;  1N7E A;  3WKM A;  4MPA A;  1WFV A;  3WKL A;  1TP3 A;  2FN5 A;  3K82 A;  1WH1 A;  2KPL A;  1RY4 A;  3TSW A;  1WJL A;  1X9Z A;  4Q6H A;  1Q3P A;  1QAU A;  4AMH A;  1X8S A;  4Z33 A;  2KYL A;  1UEP A;  3PDV A;  3VQF A;  5E21 A;  1GQ5 A;  1Q7X A;  2BYG A;  4GHN A;  1L6O A;  1W9E A;  2W4F A;  1Y7N A;  2L97 A;  4NMQ A;  3KDK A;  2D92 A;  5HFD A;  2VRF A;  2EGO A;  3CH8 A;  4JOK A;  1UJU A;  1UHP A;  1Z87 A;  2EGK A;  2IWQ A;  1WFG A;  2Q9V A;  3CS0 A;  2V1W A;  5HFB A;  2YT8 A;  2VSP A;  4JL7 A;  5B6L A;  1G9O A;  1KY9 A;  5JXB A;  2KRG A;  2F0A A;  4NMO A;  1YBO A;  1N7F A;  2LC7 A;  2QKT A;  5F67 A;  2OZF A;  3EGH C;  4Z8J A;  3R0H A;  3PV2 A;  3SHU A;  1UEW A;  4NMR A;  1ZOK A;  2RRM A;  1X5R A;  1P1D A;  2CSS A;  3GGE A;  3RLE A;  1MFG A;  2F5Y A;  1OBX A;  2P3W A;  2I0L A;  2YUY A;  1NTE A;  3MH7 A;  1WIF A;  2JSN A;  2DM8 A;  5E22 A;  1VB7 A;  4KFV A;  1NF3 C;  2KOH A;  4EDJ A;  3GJ9 A;  3NFL A;  2ENO A;  4O06 A;  2KOJ A;  4XHV A;  1B8Q A;  2H2B A;  4IC6 A;  2DLU A;  3EGG C;  4L8N A;  4FLN A;  1OBY A;  5HF1 A;  1IU2 A;  4GVD A;  4K6Y A;  4JJ0 A;  4NMS A;  3NCV A;  2I1N A;  2JIK A;  4JOJ A;  1I16 A;  2VPH A;  3QO6 A;  2YUB A;  1X5Q A;  2AIN A;  1X6D A;  2PNT A;  1FC7 A;  2VSV A;  1P1E A;  4YYX A;  3TMH A;  3CBY A;  2DLS A;  2OMJ A;  2I0I A;  5D13 A;  3CBZ A;  1TP5 A;  3LNY A;  2DC2 A;  1KWA A;  1T2M A;  2I04 A;  4REY A;  2JXO A;  2KPK A;  2EEH A;  1MFL A;  1R6J A;  2LA8 A;  4RI0 A;  2PA1 A;  1U3B A;  4Q2N A;  1VAE A;  2R3Y A;  5FHT A;  1WG6 A;  2VWR A;  3CYY A;  2E7K A;  3ZRT A;  5EYZ A;  2KA9 A;  2QT5 A;  3SFJ A;  4H11 A; 
#chains in the Genus database with same CATH homology
 1BFE A;  2AWU A;  2VZ5 A;  4NXR A;  3GDU A;  1MC7 A;  3GCO A;  1N99 A;  2LOB A;  1FC6 A;  2EEG A;  1W9O A;  2PZD A;  2KBS A;  4KFW A;  3BPU A;  2ZPM A;  1UJD A;  4PQW A;  1FC9 A;  1U39 A;  3NGH A;  1V1T A;  3TSZ A;  2EHR A;  2GEF A;  3GDV A;  2HGA A;  2M0T A;  4OAJ A;  2G2L A;  1V6B A;  2PKU A;  1RGW A;  3OU0 A;  1N6F A;  1UIT A;  2HE4 A;  1W9Q A;  2R4H A;  2CS5 A;  2DAZ A;  2OS6 A;  3I1E A;  1N6E A;  2D8I A;  3K1R A;  1UF1 A;  2KAW A;  1GQ4 A;  4NMP A;  3QE1 A;  4NNM A;  2LUI A;  2ZPL A;  1UJV A;  4R2Z A;  2KJK A;  2Z9I A;  2PDZ A;  2EGN A;  3I4W A;  3R68 A;  1WHA A;  4E35 A;  4NMT A;  5DTH A;  1GM1 A;  3KZD A;  3L4F D;  1I92 A;  3MH4 A;  3KHF A;  4K72 A;  5G1D A;  2Z17 A;  2YTW A;  2KJD A;  1QAV A;  2AWW A;  2FCF A;  2KOM A;  1UM1 A;  1UEQ A;  3FY5 A;  2HE2 A;  2EDP A;  5HJ1 A;  3PDZ A;  3ID1 A;  1XZ9 A;  3DIW A;  1RGR A;  1WF8 A;  4P0C A;  3DJ3 A;  1N7T A;  3HPM A;  5A2P A;  1K32 A;  2KJP A;  4GVC A;  3AXA A;  2EEJ A;  4WYT A;  4HOP A;  3NFK A;  2DMZ A;  4Q3H A;  1X5N A;  3HPK A;  4F8K A;  5HF4 A;  1TQ3 A;  1X45 A;  3VQG A;  4OEO A;  1D5G A;  2UZC A;  3QJM A;  1OZI A;  2JIL A;  2LC6 A;  2EV8 A;  2IWO A;  4E3B A;  3RL7 A;  3DJA A;  2QBW A;  2JRE A;  3E17 A;  3QDO A;  2QKU A;  3SOE A;  1V5L A;  1U38 A;  1V5Q A;  2JOA A;  4OEP A;  2JIN A;  2H2C A;  2KG2 A;  2DKR A;  1IHJ A;  1RZX A;  4K78 A;  2L4T A;  3GCN A;  4JOG A;  2GZV A;  4Q2Q A;  4JOP A;  5E6P B;  1WI4 A;  4K75 A;  3PV5 A;  5GLJ A;  5B42 A;  3ID3 A;  3O46 A;  2FE5 A;  3K50 A;  3LNX A;  3QJN A;  5HET A;  2RCZ A;  2V90 A;  4UU5 A;  1SOT A;  4WYU A;  1Z86 A;  3SUZ A;  2DJT A;  2KV8 A;  4N6X A;  3GAB A;  3SHW A;  2IWP A;  2D90 A;  3PV4 A;  3QGL A;  4Q6S A;  2EDZ A;  1TE0 A;  5ILB A;  1FCF A;  1VJ6 A;  2PKT A;  1LCY A;  2DB5 A;  2EDV A;  2H3L A;  4JOR A;  1VCW A;  2M0Z A;  4NXQ A;  5HEY A;  2FNE A;  2QG1 A;  1V62 A;  1UFX A;  2EXG A;  4K76 A;  5HFC A;  1Q3O A;  5FB8 C;  2EAQ A;  4Q2O A;  1QLC A;  2OPG A;  2AWX A;  2X7Z A;  1UEZ A;  2Q3G A;  1SOZ A;  3OTP A;  2OSG A;  2IWN A;  5HFE A;  2L4S A;  2O2T A;  4JJ3 A;  2EJY A;  2K1Z A;  3PS4 A;  4Q2P A;  2G5M B;  2KQF A;  1PDR A;  2KL1 A;  3DJ1 A;  2QKV A;  3I18 A;  3JXT A;  5I7Z A;  3TSV A;  4UU6 A;  2M3M A;  3ID4 A;  2H3M A;  5F3X A;  4E34 A;  1UM7 A;  5IL9 A;  3KZE A;  1OBZ A;  4NNL A;  4NMV A;  4YDP A;  2OQS A;  2K20 A;  2WL7 A;  2W7R A;  5H3J A;  5E11 A;  4G69 A;  3CBX A;  4JOF A;  2OGP A;  2M0V A;  3O5N A;  5HFF A;  2EEI A;  1BE9 A;  3DOR A;  5HEB A;  4JOH A;  1Y8T A;  5EZ0 A;  1VA8 A;  3QIK A;  2YT7 A;  5HDY A;  1WF7 A;  2MX6 A;  2CSJ A;  4LMM A;  2M10 A;  3RL8 A;  5G1E A;  3HVQ C;  1QAV B;  2M0U A;  4P2A B;  4NXP A;  5HED A;  3R69 A;  1KEF A;  3KDG A;  3MH6 A;  3GSL A;  2I6V A;  1WI2 A;  4JOE A;  1U37 A;  3B76 A;  5E1Y A;  1M5Z A;  2I4S A;  1ZUB A;  4FGM A;  5GND A;  1IU0 A;  2JWE A;  3GDS A;  3STJ A;  3CC0 A;  4HOP B;  1WHD A;  2REY A;  2OCS A;  3ID2 A;  1N6D A;  2MHO A;  1N7E A;  3WKM A;  4MPA A;  1WFV A;  3WKL A;  1TP3 A;  2FN5 A;  3K82 A;  1WH1 A;  2KPL A;  1RY4 A;  3TSW A;  1WJL A;  1X9Z A;  4Q6H A;  1Q3P A;  1QAU A;  4AMH A;  1X8S A;  4Z33 A;  2KYL A;  1UEP A;  3PDV A;  3VQF A;  5E21 A;  1GQ5 A;  1Q7X A;  2BYG A;  4GHN A;  1L6O A;  1W9E A;  2W4F A;  1Y7N A;  2L97 A;  4NMQ A;  3KDK A;  2D92 A;  5HFD A;  2VRF A;  2EGO A;  3CH8 A;  4JOK A;  1UJU A;  1UHP A;  1Z87 A;  2EGK A;  2IWQ A;  1WFG A;  2Q9V A;  3CS0 A;  2V1W A;  5HFB A;  2YT8 A;  2VSP A;  4JL7 A;  5B6L A;  1G9O A;  1KY9 A;  5JXB A;  2KRG A;  2F0A A;  4NMO A;  1YBO A;  1N7F A;  2LC7 A;  2QKT A;  5F67 A;  2OZF A;  3EGH C;  4Z8J A;  3R0H A;  3PV2 A;  3SHU A;  1UEW A;  4NMR A;  1ZOK A;  2RRM A;  1X5R A;  1P1D A;  2CSS A;  3GGE A;  3RLE A;  1MFG A;  2F5Y A;  1OBX A;  2P3W A;  2I0L A;  2YUY A;  1NTE A;  3MH7 A;  1WIF A;  2JSN A;  2DM8 A;  5E22 A;  1VB7 A;  4KFV A;  1NF3 C;  2KOH A;  4EDJ A;  3GJ9 A;  3NFL A;  2ENO A;  4O06 A;  2KOJ A;  4XHV A;  1B8Q A;  2H2B A;  4IC6 A;  2DLU A;  3EGG C;  4L8N A;  4FLN A;  1OBY A;  5HF1 A;  1IU2 A;  4GVD A;  4K6Y A;  4JJ0 A;  4NMS A;  3NCV A;  2I1N A;  2JIK A;  4JOJ A;  1I16 A;  2VPH A;  3QO6 A;  2YUB A;  1X5Q A;  2AIN A;  1X6D A;  2PNT A;  1FC7 A;  2VSV A;  1P1E A;  4YYX A;  3TMH A;  3CBY A;  2DLS A;  2OMJ A;  2I0I A;  5D13 A;  3CBZ A;  1TP5 A;  3LNY A;  2DC2 A;  1KWA A;  1T2M A;  2I04 A;  4REY A;  2JXO A;  2KPK A;  2EEH A;  1MFL A;  1R6J A;  2LA8 A;  4RI0 A;  2PA1 A;  1U3B A;  4Q2N A;  1VAE A;  2R3Y A;  5FHT A;  1WG6 A;  2VWR A;  3CYY A;  2E7K A;  3ZRT A;  5EYZ A;  2KA9 A;  2QT5 A;  3SFJ A;  4H11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...