2KQFA

Solution structure of mast205-pdz complexed with the c-terminus of a rabies virus g protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated serine/threonine-protein kinase 2
publication title 1H, 13C and 15N resonance assignments of the PDZ of Microtubule-associated serine/threonine kinase 205 (MAST205) in complex with the C-Terminal motif from the rabies virus glycoprotein
rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide binding protein
total genus 15
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kqfA00
1N99A 2AINA 2M0UA 1VB7A 2M0TA 2G2LA 2H3LA 1UFXA 2I04A 4Z8JA 5EZ0A 3R68A 3CBZA 2MHOA 2OSGA 1N6DA 2PDZA 2OQSA 2EHRA 5F67A 4NMRA 4REYA 3SHUA 1QLCA 2IWQA 1IU2A 1N7FA 5HF4A 2VZ5A 2QT5A 4EDJA 4IC6A 4NXRA 2Q3GA 4G69A 1U39A 3ID2A 2KJKA 5HF1A 2EEJA 2D92A 2KJPA 4NXPA 1ZUBA 2EGNA 1VA8A 1WFGA 2LA8A 4UU6A 2JREA 2DLSA 4OEOA 3MH6A 3O46A 2KJDA 1IHJA 2ZPMA 3GSLA 1I16A 2D8IA 1P1DA 4O06A 2PKTA 3QJMA 3WKLA 1TE0A 3RL7A 3TSVA 2JWEA 3TSWA 4Q2PA 4K75A 5GNDA 4K78A 2HE4A 2R3YA 2HGAA 2M0ZA 4HOPA 1FC6A 2PA1A 4NNMA 4K72A 1Q3OA 1WF7A 1XZ9A 4GVDA 2KPLA 3ID4A 1V5LA 2BYGA 3I4WA 4JOFA 1QAUA 1UJDA 4WYTA 2JOAA 5HFEA 3GCNA 3ZRTA 4JL7A 1X45A 2KL1A 4JOHA 1WH1A 2UZCA 5FHTA 2OMJA 3DIWA 1GM1A 2LC6A 2JILA 3TSZA 1U3BA 1X6DA 2YUYA 2YTWA 4NXQA 2DB5A 5JXBA 4GHNA 5GLJA 2EGOA 1UF1A 3QE1A 1OZIA 3KZEA 5HJ1A 2I0LA 3ID3A 1TQ3A 5E22A 4P2AB 1BFEA 3SOEA 4AMHA 2KAWA 1RGWA 4JOPA 2VSVA 2OCSA 1UITA 3EGGC 1WF8A 1T2MA 1Z86A 3AXAA 2G5MB 1NTEA 3OTPA 1RZXA 1N7TA 2W7RA 1UEPA 2FCFA 2Q9VA 3HVQC 2K20A 1SOTA 3GDSA 2V90A 2FE5A 1U37A 4NMTA 1N6EA 2EJYA 3R69A 5F3XA 5E11A 1X5QA 1WI4A 3HPMA 2KBSA 3K82A 1FCFA 2I1NA 1QAVB 4RI0A 1FC7A 1Q7XA 2KV8A 2AWXA 1WG6A 1K32A 2X7ZA 1Y7NA 3GCOA 2LC7A 2RCZA 2DMZA 2KPKA 4JOKA 4YDPA 1VJ6A 4E34A 1W9OA 2VRFA 3I18A 4LMMA 2YT7A 4PQWA 2DC2A 1B8QA 3CBYA 1UEZA 1WIFA 3CC0A 2KOJA 2L4TA 1ZOKA 4JOJA 3KHFA 4Q3HA 3FY5A 4KFWA 1Y8TA 3R0HA 2JINA 3QGLA 2GZVA 2DAZA 3STJA 4OAJA 5DTHA 2CS5A 2KOHA 2V1WA 4JOGA 3PDVA 2DKRA 2RRMA 3GJ9A 2FNEA 2EDPA 1WHAA 4GVCA 4N6XA 2IWNA 2FN5A 2CSSA 2EXGA 4KFVA 2ENOA 3I1EA 3EGHC 1KWAA 4WYUA 3B76A 2R4HA 2AWUA 3CYYA 3L4FD 2EEGA 1YBOA 1IU0A 3CS0A 3QO6A 2EEIA 1OBZA 2Z9IA 2KA9A 1G9OA 1Q3PA 2OS6A 2YT8A 2KRGA 2M0VA 2KYLA 2IWOA 1BE9A 2QKVA 1FC9A 1P1EA 4NMQA 1GQ5A 1RY4A 4JORA 2VPHA 1UM7A 5HETA 2CSJA 4Q6HA 4F8KA 4MPAA 5I7ZA 1VAEA 2ZPLA 1PDRA 1I92A 2L97A 3HPKA 1KY9A 2DLUA 3PS4A 3DJAA 3RLEA 1D5GA 3PDZA 2JXOA 3SHWA 2LOBA 5FB8C 2WL7A 1NF3C 3K1RA 5H3JA 4Q2OA 2OPGA 1WJLA 2LUIA 1UEWA 3CH8A 2F5YA 5E21A 2MX6A 4FGMA 2QKTA 2VWRA 1SOZA 4P0CA 4R2ZA 2O2TA 3E17A 4NMSA 4UU5A 4OEPA 2IWPA 4K6YA 1V5QA 1MFLA 3SUZA 2E7KA 2PZDA 1V6BA 1X8SA 4NMPA 5HEYA 4YYXA 5HDYA 5HEBA 1QAVA 2D90A 3PV2A 1X5RA 3DJ1A 2M3MA 2YUBA 5E1YA 5HEDA 3PV4A 3KZDA 2P3WA 4Z33A 3LNYA 3QJNA 4Q2QA 4XHVA 2I0IA 4L8NA 2EV8A 1W9EA 2W4FA 1OBXA 3K50A 1N7EA 4Q6SA 1Z87A 1RGRA 1U38A 2QG1A 4HOPB 1TP5A 4Q2NA 3RL8A 1KEFA 5G1DA 1MC7A 3MH7A 4E3BA 2REYA 3PV5A 5B6LA 3CBXA 4NMOA 1GQ4A 3DORA 5HFFA 1L6OA 3GDVA 2DM8A 2KQFA 3TMHA 3NGHA 2PKUA 5E6PB 2I4SA 1OBYA 1UM1A 1M5ZA 1UJVA 4NMVA 3WKMA 3SFJA 4JOEA 1WI2A 5HFBA 3BPUA 2I6VA 2PNTA 2K1ZA 5EYZA 2OZFA 1WHDA 1N6FA 2H2CA 1LCYA 2AWWA 2Z17A 3QDOA 2HE2A 5G1EA 5D13A 1UJUA 2KOMA 3DJ3A 3ID1A 2L4SA 2EAQA 4K76A 1V62A 2F0AA 2EDZA 2JIKA 2EEHA 1WFVA 2H2BA 4H11A 5HFDA 1UHPA 3NFKA 2M10A 3GGEA 1MFGA 2DJTA 4E35A 2VSPA 4NNLA 1R6JA 3O5NA 3VQGA 3LNXA 2OGPA 1VCWA 1UEQA 3OU0A 5A2PA 1W9QA 2KG2A 2EDVA 3MH4A 3GDUA 1TP3A 2EGKA 2QBWA 1X5NA 2H3MA 5HFCA 1V1TA 2QKUA 3JXTA 3QIKA 3VQFA 3NFLA
chains in the Genus database with same CATH superfamily
1N99A 2AINA 2M0UA 1VB7A 2M0TA 2G2LA 2H3LA 1UFXA 2I04A 4Z8JA 5EZ0A 3R68A 4FLNA 3CBZA 2MHOA 2OSGA 1N6DA 2PDZA 2OQSA 2EHRA 5F67A 4NMRA 4REYA 3SHUA 1QLCA 2IWQA 1IU2A 2GEFA 1N7FA 5HF4A 2VZ5A 2QT5A 4EDJA 4IC6A 4NXRA 2Q3GA 4G69A 1U39A 3ID2A 2KJKA 5HF1A 2EEJA 2D92A 2KJPA 4NXPA 1ZUBA 2EGNA 1VA8A 1WFGA 2LA8A 4UU6A 2JREA 2DLSA 4OEOA 3MH6A 3O46A 2KJDA 1IHJA 2ZPMA 3GSLA 1I16A 2D8IA 1P1DA 4O06A 2PKTA 3QJMA 3WKLA 1TE0A 3RL7A 3TSVA 2JWEA 3TSWA 4Q2PA 4K75A 5GNDA 4K78A 3KDGA 2HE4A 2R3YA 2HGAA 2M0ZA 4HOPA 1FC6A 2PA1A 4NNMA 4K72A 1Q3OA 1WF7A 1XZ9A 4GVDA 2KPLA 3ID4A 1V5LA 2BYGA 3I4WA 4JOFA 1QAUA 1UJDA 4WYTA 2JOAA 5HFEA 3GCNA 3ZRTA 4JL7A 1X45A 2KL1A 4JOHA 1WH1A 2UZCA 5FHTA 2OMJA 3DIWA 1GM1A 5ILBA 2LC6A 2JILA 3TSZA 1U3BA 1X6DA 2YUYA 4JJ0A 2YTWA 4NXQA 2DB5A 5JXBA 4GHNA 5GLJA 5IL9A 2EGOA 1UF1A 3QE1A 1OZIA 3KZEA 5HJ1A 2I0LA 3ID3A 1TQ3A 5E22A 4P2AB 1BFEA 3SOEA 4AMHA 2KAWA 1RGWA 4JOPA 2VSVA 2OCSA 1UITA 3EGGC 1WF8A 1T2MA 1Z86A 3AXAA 2G5MB 1NTEA 3OTPA 1RZXA 1N7TA 2W7RA 1UEPA 2FCFA 2Q9VA 3HVQC 2K20A 1SOTA 3GDSA 3NCVA 2V90A 2FE5A 1U37A 4NMTA 1N6EA 2EJYA 3R69A 5F3XA 5E11A 1X5QA 1WI4A 3HPMA 2KBSA 3K82A 1FCFA 2I1NA 1QAVB 4RI0A 1FC7A 1Q7XA 2KV8A 2AWXA 1WG6A 1K32A 2X7ZA 1Y7NA 3GCOA 2LC7A 2RCZA 2DMZA 2KPKA 3GABA 4JOKA 4YDPA 1VJ6A 4E34A 1W9OA 2VRFA 3I18A 4LMMA 2YT7A 4PQWA 2DC2A 1B8QA 3CBYA 1UEZA 1WIFA 3CC0A 2KOJA 2L4TA 1ZOKA 4JOJA 3KHFA 4Q3HA 3FY5A 4KFWA 1Y8TA 3R0HA 2JINA 3QGLA 2GZVA 2DAZA 3STJA 4OAJA 5DTHA 2CS5A 2KOHA 2V1WA 4JOGA 3PDVA 2DKRA 2RRMA 3GJ9A 2FNEA 2EDPA 1WHAA 4GVCA 4N6XA 2IWNA 2FN5A 2CSSA 2EXGA 4KFVA 2ENOA 3I1EA 3EGHC 1KWAA 4WYUA 3B76A 2R4HA 2AWUA 3CYYA 3L4FD 2EEGA 1YBOA 1IU0A 3CS0A 3QO6A 2EEIA 1OBZA 2Z9IA 2KA9A 1G9OA 1Q3PA 2OS6A 2YT8A 2KRGA 2M0VA 2KYLA 2IWOA 1BE9A 2QKVA 1FC9A 1P1EA 4NMQA 1GQ5A 1RY4A 4JORA 2VPHA 1UM7A 5HETA 2CSJA 4Q6HA 4F8KA 4MPAA 5I7ZA 1VAEA 2ZPLA 1PDRA 1I92A 2L97A 3HPKA 1KY9A 2DLUA 3PS4A 3DJAA 3RLEA 1D5GA 3PDZA 2JXOA 3SHWA 2LOBA 5FB8C 2WL7A 1NF3C 3K1RA 5H3JA 4Q2OA 2OPGA 1WJLA 2LUIA 1UEWA 3CH8A 2F5YA 5E21A 2MX6A 4FGMA 2QKTA 2VWRA 1SOZA 4P0CA 4R2ZA 2O2TA 3E17A 4NMSA 4UU5A 4OEPA 2IWPA 4K6YA 1V5QA 1MFLA 3SUZA 2E7KA 2PZDA 1V6BA 1X8SA 4NMPA 5HEYA 4YYXA 5HDYA 5HEBA 1QAVA 2D90A 3PV2A 1X5RA 3DJ1A 2M3MA 2YUBA 5E1YA 5HEDA 3PV4A 3KZDA 2P3WA 4Z33A 3LNYA 3QJNA 4Q2QA 4XHVA 2JSNA 2I0IA 4L8NA 2EV8A 1W9EA 2W4FA 1OBXA 3K50A 1N7EA 4Q6SA 1Z87A 1RGRA 1U38A 2QG1A 4HOPB 1TP5A 4Q2NA 3RL8A 1KEFA 5G1DA 1MC7A 3MH7A 4E3BA 2REYA 3PV5A 5B6LA 3CBXA 4NMOA 1GQ4A 3DORA 5HFFA 1L6OA 3GDVA 2DM8A 2KQFA 3TMHA 3NGHA 2PKUA 5E6PB 2I4SA 1OBYA 1UM1A 1M5ZA 1UJVA 4NMVA 3WKMA 5B42A 3SFJA 4JOEA 1WI2A 5HFBA 3BPUA 2I6VA 2PNTA 2K1ZA 5EYZA 2OZFA 1WHDA 1N6FA 2H2CA 1LCYA 2AWWA 2Z17A 3QDOA 2HE2A 5G1EA 5D13A 1UJUA 1X9ZA 2KOMA 3DJ3A 3ID1A 2L4SA 2EAQA 4K76A 1V62A 2F0AA 2EDZA 2JIKA 2EEHA 1WFVA 2H2BA 4H11A 5HFDA 1UHPA 3NFKA 2M10A 3GGEA 1MFGA 2DJTA 4E35A 2VSPA 4NNLA 1R6JA 3O5NA 3VQGA 3LNXA 2OGPA 1VCWA 1UEQA 3KDKA 3OU0A 5A2PA 1W9QA 2KG2A 2EDVA 4JJ3A 3MH4A 3GDUA 1TP3A 2EGKA 2QBWA 1X5NA 2H3MA 5HFCA 1V1TA 2QKUA 3JXTA 3QIKA 3VQFA 3NFLA
chains in the Genus database with same CATH topology
1N99A 2AINA 2M0UA 1VB7A 2M0TA 2G2LA 2H3LA 1UFXA 2I04A 4Z8JA 5EZ0A 3R68A 4FLNA 3CBZA 2MHOA 2OSGA 1N6DA 2PDZA 2OQSA 2EHRA 5F67A 4NMRA 4REYA 3SHUA 1QLCA 2IWQA 1IU2A 2GEFA 1N7FA 5HF4A 2VZ5A 2QT5A 4EDJA 4IC6A 4NXRA 2Q3GA 4G69A 1U39A 3ID2A 2KJKA 5HF1A 2EEJA 2D92A 2KJPA 4NXPA 1ZUBA 2EGNA 1VA8A 1WFGA 2LA8A 4UU6A 2JREA 2DLSA 4OEOA 3MH6A 3O46A 2KJDA 1IHJA 2ZPMA 3GSLA 1I16A 2D8IA 1P1DA 4O06A 2PKTA 3QJMA 3WKLA 1TE0A 3RL7A 3TSVA 2JWEA 3TSWA 4Q2PA 4K75A 5GNDA 4K78A 3KDGA 2HE4A 2R3YA 2HGAA 2M0ZA 4HOPA 1FC6A 2PA1A 4NNMA 4K72A 1Q3OA 1WF7A 1XZ9A 4GVDA 2KPLA 3ID4A 1V5LA 2BYGA 3I4WA 4JOFA 1QAUA 1UJDA 4WYTA 2JOAA 5HFEA 3GCNA 3ZRTA 4JL7A 1X45A 2KL1A 4JOHA 1WH1A 2UZCA 5FHTA 2OMJA 3DIWA 1GM1A 5ILBA 2LC6A 2JILA 3TSZA 1U3BA 1X6DA 2YUYA 4JJ0A 2YTWA 4NXQA 2DB5A 5JXBA 4GHNA 5GLJA 5IL9A 2EGOA 1UF1A 3QE1A 1OZIA 3KZEA 5HJ1A 2I0LA 3ID3A 1TQ3A 5E22A 4P2AB 1BFEA 3SOEA 4AMHA 2KAWA 1RGWA 4JOPA 2VSVA 2OCSA 1UITA 3EGGC 1WF8A 1T2MA 1Z86A 3AXAA 2G5MB 1NTEA 3OTPA 1RZXA 1N7TA 2W7RA 1UEPA 2FCFA 2Q9VA 3HVQC 2K20A 1SOTA 3GDSA 3NCVA 2V90A 2FE5A 1U37A 4NMTA 1N6EA 2EJYA 3R69A 5F3XA 5E11A 1X5QA 1WI4A 3HPMA 2KBSA 3K82A 1FCFA 2I1NA 1QAVB 4RI0A 1FC7A 1Q7XA 2KV8A 2AWXA 1WG6A 1K32A 2X7ZA 1Y7NA 3GCOA 2LC7A 2RCZA 2DMZA 2KPKA 3GABA 4JOKA 4YDPA 1VJ6A 4E34A 1W9OA 2VRFA 3I18A 4LMMA 2YT7A 4PQWA 2DC2A 1B8QA 3CBYA 1UEZA 1WIFA 3CC0A 2KOJA 2L4TA 1ZOKA 4JOJA 3KHFA 4Q3HA 3FY5A 4KFWA 1Y8TA 3R0HA 2JINA 3QGLA 2GZVA 2DAZA 3STJA 4OAJA 5DTHA 2CS5A 2KOHA 2V1WA 4JOGA 3PDVA 2DKRA 2RRMA 3GJ9A 2FNEA 2EDPA 1WHAA 4GVCA 4N6XA 2IWNA 2FN5A 2CSSA 2EXGA 4KFVA 2ENOA 3I1EA 3EGHC 1KWAA 4WYUA 3B76A 2R4HA 2AWUA 3CYYA 3L4FD 2EEGA 1YBOA 1IU0A 3CS0A 3QO6A 2EEIA 1OBZA 2Z9IA 2KA9A 1G9OA 1Q3PA 2OS6A 2YT8A 2KRGA 2M0VA 2KYLA 2IWOA 1BE9A 2QKVA 1FC9A 1P1EA 4NMQA 1GQ5A 1RY4A 4JORA 2VPHA 1UM7A 5HETA 2CSJA 4Q6HA 4F8KA 4MPAA 5I7ZA 1VAEA 2ZPLA 1PDRA 1I92A 2L97A 3HPKA 1KY9A 2DLUA 3PS4A 3DJAA 3RLEA 1D5GA 3PDZA 2JXOA 3SHWA 2LOBA 5FB8C 2WL7A 1NF3C 3K1RA 5H3JA 4Q2OA 2OPGA 1WJLA 2LUIA 1UEWA 3CH8A 2F5YA 5E21A 2MX6A 4FGMA 2QKTA 2VWRA 1SOZA 4P0CA 4R2ZA 2O2TA 3E17A 4NMSA 4UU5A 4OEPA 2IWPA 4K6YA 1V5QA 1MFLA 3SUZA 2E7KA 2PZDA 1V6BA 1X8SA 4NMPA 5HEYA 4YYXA 5HDYA 5HEBA 1QAVA 2D90A 3PV2A 1X5RA 3DJ1A 2M3MA 2YUBA 5E1YA 5HEDA 3PV4A 3KZDA 2P3WA 4Z33A 3LNYA 3QJNA 4Q2QA 4XHVA 2JSNA 2I0IA 4L8NA 2EV8A 1W9EA 2W4FA 1OBXA 3K50A 1N7EA 4Q6SA 1Z87A 1RGRA 1U38A 2QG1A 4HOPB 1TP5A 4Q2NA 3RL8A 1KEFA 5G1DA 1MC7A 3MH7A 4E3BA 2REYA 3PV5A 5B6LA 3CBXA 4NMOA 1GQ4A 3DORA 5HFFA 1L6OA 3GDVA 2DM8A 2KQFA 3TMHA 3NGHA 2PKUA 5E6PB 2I4SA 1OBYA 1UM1A 1M5ZA 1UJVA 4NMVA 3WKMA 5B42A 3SFJA 4JOEA 1WI2A 5HFBA 3BPUA 2I6VA 2PNTA 2K1ZA 5EYZA 2OZFA 1WHDA 1N6FA 2H2CA 1LCYA 2AWWA 2Z17A 3QDOA 2HE2A 5G1EA 5D13A 1UJUA 1X9ZA 2KOMA 3DJ3A 3ID1A 2L4SA 2EAQA 4K76A 1V62A 2F0AA 2EDZA 2JIKA 2EEHA 1WFVA 2H2BA 4H11A 5HFDA 1UHPA 3NFKA 2M10A 3GGEA 1MFGA 2DJTA 4E35A 2VSPA 4NNLA 1R6JA 3O5NA 3VQGA 3LNXA 2OGPA 1VCWA 1UEQA 3KDKA 3OU0A 5A2PA 1W9QA 2KG2A 2EDVA 4JJ3A 3MH4A 3GDUA 1TP3A 2EGKA 2QBWA 1X5NA 2H3MA 5HFCA 1V1TA 2QKUA 3JXTA 3QIKA 3VQFA 3NFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N99 A;  2AIN A;  2M0U A;  1VB7 A;  2M0T A;  2G2L A;  2H3L A;  1UFX A;  2I04 A;  4Z8J A;  5EZ0 A;  3R68 A;  3CBZ A;  2MHO A;  2OSG A;  1N6D A;  2PDZ A;  2OQS A;  2EHR A;  5F67 A;  4NMR A;  4REY A;  3SHU A;  1QLC A;  2IWQ A;  1IU2 A;  1N7F A;  5HF4 A;  2VZ5 A;  2QT5 A;  4EDJ A;  4IC6 A;  4NXR A;  2Q3G A;  4G69 A;  1U39 A;  3ID2 A;  2KJK A;  5HF1 A;  2EEJ A;  2D92 A;  2KJP A;  4NXP A;  1ZUB A;  2EGN A;  1VA8 A;  1WFG A;  2LA8 A;  4UU6 A;  2JRE A;  2DLS A;  4OEO A;  3MH6 A;  3O46 A;  2KJD A;  1IHJ A;  2ZPM A;  3GSL A;  1I16 A;  2D8I A;  1P1D A;  4O06 A;  2PKT A;  3QJM A;  3WKL A;  1TE0 A;  3RL7 A;  3TSV A;  2JWE A;  3TSW A;  4Q2P A;  4K75 A;  5GND A;  4K78 A;  2HE4 A;  2R3Y A;  2HGA A;  2M0Z A;  4HOP A;  1FC6 A;  2PA1 A;  4NNM A;  4K72 A;  1Q3O A;  1WF7 A;  1XZ9 A;  4GVD A;  2KPL A;  3ID4 A;  1V5L A;  2BYG A;  3I4W A;  4JOF A;  1QAU A;  1UJD A;  4WYT A;  2JOA A;  5HFE A;  3GCN A;  3ZRT A;  4JL7 A;  1X45 A;  2KL1 A;  4JOH A;  1WH1 A;  2UZC A;  5FHT A;  2OMJ A;  3DIW A;  1GM1 A;  2LC6 A;  2JIL A;  3TSZ A;  1U3B A;  1X6D A;  2YUY A;  2YTW A;  4NXQ A;  2DB5 A;  5JXB A;  4GHN A;  5GLJ A;  2EGO A;  1UF1 A;  3QE1 A;  1OZI A;  3KZE A;  5HJ1 A;  2I0L A;  3ID3 A;  1TQ3 A;  5E22 A;  4P2A B;  1BFE A;  3SOE A;  4AMH A;  2KAW A;  1RGW A;  4JOP A;  2VSV A;  2OCS A;  1UIT A;  3EGG C;  1WF8 A;  1T2M A;  1Z86 A;  3AXA A;  2G5M B;  1NTE A;  3OTP A;  1RZX A;  1N7T A;  2W7R A;  1UEP A;  2FCF A;  2Q9V A;  3HVQ C;  2K20 A;  1SOT A;  3GDS A;  2V90 A;  2FE5 A;  1U37 A;  4NMT A;  1N6E A;  2EJY A;  3R69 A;  5F3X A;  5E11 A;  1X5Q A;  1WI4 A;  3HPM A;  2KBS A;  3K82 A;  1FCF A;  2I1N A;  1QAV B;  4RI0 A;  1FC7 A;  1Q7X A;  2KV8 A;  2AWX A;  1WG6 A;  1K32 A;  2X7Z A;  1Y7N A;  3GCO A;  2LC7 A;  2RCZ A;  2DMZ A;  2KPK A;  4JOK A;  4YDP A;  1VJ6 A;  4E34 A;  1W9O A;  2VRF A;  3I18 A;  4LMM A;  2YT7 A;  4PQW A;  2DC2 A;  1B8Q A;  3CBY A;  1UEZ A;  1WIF A;  3CC0 A;  2KOJ A;  2L4T A;  1ZOK A;  4JOJ A;  3KHF A;  4Q3H A;  3FY5 A;  4KFW A;  1Y8T A;  3R0H A;  2JIN A;  3QGL A;  2GZV A;  2DAZ A;  3STJ A;  4OAJ A;  5DTH A;  2CS5 A;  2KOH A;  2V1W A;  4JOG A;  3PDV A;  2DKR A;  2RRM A;  3GJ9 A;  2FNE A;  2EDP A;  1WHA A;  4GVC A;  4N6X A;  2IWN A;  2FN5 A;  2CSS A;  2EXG A;  4KFV A;  2ENO A;  3I1E A;  3EGH C;  1KWA A;  4WYU A;  3B76 A;  2R4H A;  2AWU A;  3CYY A;  3L4F D;  2EEG A;  1YBO A;  1IU0 A;  3CS0 A;  3QO6 A;  2EEI A;  1OBZ A;  2Z9I A;  2KA9 A;  1G9O A;  1Q3P A;  2OS6 A;  2YT8 A;  2KRG A;  2M0V A;  2KYL A;  2IWO A;  1BE9 A;  2QKV A;  1FC9 A;  1P1E A;  4NMQ A;  1GQ5 A;  1RY4 A;  4JOR A;  2VPH A;  1UM7 A;  5HET A;  2CSJ A;  4Q6H A;  4F8K A;  4MPA A;  5I7Z A;  1VAE A;  2ZPL A;  1PDR A;  1I92 A;  2L97 A;  3HPK A;  1KY9 A;  2DLU A;  3PS4 A;  3DJA A;  3RLE A;  1D5G A;  3PDZ A;  2JXO A;  3SHW A;  2LOB A;  5FB8 C;  2WL7 A;  1NF3 C;  3K1R A;  5H3J A;  4Q2O A;  2OPG A;  1WJL A;  2LUI A;  1UEW A;  3CH8 A;  2F5Y A;  5E21 A;  2MX6 A;  4FGM A;  2QKT A;  2VWR A;  1SOZ A;  4P0C A;  4R2Z A;  2O2T A;  3E17 A;  4NMS A;  4UU5 A;  4OEP A;  2IWP A;  4K6Y A;  1V5Q A;  1MFL A;  3SUZ A;  2E7K A;  2PZD A;  1V6B A;  1X8S A;  4NMP A;  5HEY A;  4YYX A;  5HDY A;  5HEB A;  1QAV A;  2D90 A;  3PV2 A;  1X5R A;  3DJ1 A;  2M3M A;  2YUB A;  5E1Y A;  5HED A;  3PV4 A;  3KZD A;  2P3W A;  4Z33 A;  3LNY A;  3QJN A;  4Q2Q A;  4XHV A;  2I0I A;  4L8N A;  2EV8 A;  1W9E A;  2W4F A;  1OBX A;  3K50 A;  1N7E A;  4Q6S A;  1Z87 A;  1RGR A;  1U38 A;  2QG1 A;  4HOP B;  1TP5 A;  4Q2N A;  3RL8 A;  1KEF A;  5G1D A;  1MC7 A;  3MH7 A;  4E3B A;  2REY A;  3PV5 A;  5B6L A;  3CBX A;  4NMO A;  1GQ4 A;  3DOR A;  5HFF A;  1L6O A;  3GDV A;  2DM8 A;  2KQF A;  3TMH A;  3NGH A;  2PKU A;  5E6P B;  2I4S A;  1OBY A;  1UM1 A;  1M5Z A;  1UJV A;  4NMV A;  3WKM A;  3SFJ A;  4JOE A;  1WI2 A;  5HFB A;  3BPU A;  2I6V A;  2PNT A;  2K1Z A;  5EYZ A;  2OZF A;  1WHD A;  1N6F A;  2H2C A;  1LCY A;  2AWW A;  2Z17 A;  3QDO A;  2HE2 A;  5G1E A;  5D13 A;  1UJU A;  2KOM A;  3DJ3 A;  3ID1 A;  2L4S A;  2EAQ A;  4K76 A;  1V62 A;  2F0A A;  2EDZ A;  2JIK A;  2EEH A;  1WFV A;  2H2B A;  4H11 A;  5HFD A;  1UHP A;  3NFK A;  2M10 A;  3GGE A;  1MFG A;  2DJT A;  4E35 A;  2VSP A;  4NNL A;  1R6J A;  3O5N A;  3VQG A;  3LNX A;  2OGP A;  1VCW A;  1UEQ A;  3OU0 A;  5A2P A;  1W9Q A;  2KG2 A;  2EDV A;  3MH4 A;  3GDU A;  1TP3 A;  2EGK A;  2QBW A;  1X5N A;  2H3M A;  5HFC A;  1V1T A;  2QKU A;  3JXT A;  3QIK A;  3VQF A;  3NFL A; 
#chains in the Genus database with same CATH topology
 1N99 A;  2AIN A;  2M0U A;  1VB7 A;  2M0T A;  2G2L A;  2H3L A;  1UFX A;  2I04 A;  4Z8J A;  5EZ0 A;  3R68 A;  4FLN A;  3CBZ A;  2MHO A;  2OSG A;  1N6D A;  2PDZ A;  2OQS A;  2EHR A;  5F67 A;  4NMR A;  4REY A;  3SHU A;  1QLC A;  2IWQ A;  1IU2 A;  2GEF A;  1N7F A;  5HF4 A;  2VZ5 A;  2QT5 A;  4EDJ A;  4IC6 A;  4NXR A;  2Q3G A;  4G69 A;  1U39 A;  3ID2 A;  2KJK A;  5HF1 A;  2EEJ A;  2D92 A;  2KJP A;  4NXP A;  1ZUB A;  2EGN A;  1VA8 A;  1WFG A;  2LA8 A;  4UU6 A;  2JRE A;  2DLS A;  4OEO A;  3MH6 A;  3O46 A;  2KJD A;  1IHJ A;  2ZPM A;  3GSL A;  1I16 A;  2D8I A;  1P1D A;  4O06 A;  2PKT A;  3QJM A;  3WKL A;  1TE0 A;  3RL7 A;  3TSV A;  2JWE A;  3TSW A;  4Q2P A;  4K75 A;  5GND A;  4K78 A;  3KDG A;  2HE4 A;  2R3Y A;  2HGA A;  2M0Z A;  4HOP A;  1FC6 A;  2PA1 A;  4NNM A;  4K72 A;  1Q3O A;  1WF7 A;  1XZ9 A;  4GVD A;  2KPL A;  3ID4 A;  1V5L A;  2BYG A;  3I4W A;  4JOF A;  1QAU A;  1UJD A;  4WYT A;  2JOA A;  5HFE A;  3GCN A;  3ZRT A;  4JL7 A;  1X45 A;  2KL1 A;  4JOH A;  1WH1 A;  2UZC A;  5FHT A;  2OMJ A;  3DIW A;  1GM1 A;  5ILB A;  2LC6 A;  2JIL A;  3TSZ A;  1U3B A;  1X6D A;  2YUY A;  4JJ0 A;  2YTW A;  4NXQ A;  2DB5 A;  5JXB A;  4GHN A;  5GLJ A;  5IL9 A;  2EGO A;  1UF1 A;  3QE1 A;  1OZI A;  3KZE A;  5HJ1 A;  2I0L A;  3ID3 A;  1TQ3 A;  5E22 A;  4P2A B;  1BFE A;  3SOE A;  4AMH A;  2KAW A;  1RGW A;  4JOP A;  2VSV A;  2OCS A;  1UIT A;  3EGG C;  1WF8 A;  1T2M A;  1Z86 A;  3AXA A;  2G5M B;  1NTE A;  3OTP A;  1RZX A;  1N7T A;  2W7R A;  1UEP A;  2FCF A;  2Q9V A;  3HVQ C;  2K20 A;  1SOT A;  3GDS A;  3NCV A;  2V90 A;  2FE5 A;  1U37 A;  4NMT A;  1N6E A;  2EJY A;  3R69 A;  5F3X A;  5E11 A;  1X5Q A;  1WI4 A;  3HPM A;  2KBS A;  3K82 A;  1FCF A;  2I1N A;  1QAV B;  4RI0 A;  1FC7 A;  1Q7X A;  2KV8 A;  2AWX A;  1WG6 A;  1K32 A;  2X7Z A;  1Y7N A;  3GCO A;  2LC7 A;  2RCZ A;  2DMZ A;  2KPK A;  3GAB A;  4JOK A;  4YDP A;  1VJ6 A;  4E34 A;  1W9O A;  2VRF A;  3I18 A;  4LMM A;  2YT7 A;  4PQW A;  2DC2 A;  1B8Q A;  3CBY A;  1UEZ A;  1WIF A;  3CC0 A;  2KOJ A;  2L4T A;  1ZOK A;  4JOJ A;  3KHF A;  4Q3H A;  3FY5 A;  4KFW A;  1Y8T A;  3R0H A;  2JIN A;  3QGL A;  2GZV A;  2DAZ A;  3STJ A;  4OAJ A;  5DTH A;  2CS5 A;  2KOH A;  2V1W A;  4JOG A;  3PDV A;  2DKR A;  2RRM A;  3GJ9 A;  2FNE A;  2EDP A;  1WHA A;  4GVC A;  4N6X A;  2IWN A;  2FN5 A;  2CSS A;  2EXG A;  4KFV A;  2ENO A;  3I1E A;  3EGH C;  1KWA A;  4WYU A;  3B76 A;  2R4H A;  2AWU A;  3CYY A;  3L4F D;  2EEG A;  1YBO A;  1IU0 A;  3CS0 A;  3QO6 A;  2EEI A;  1OBZ A;  2Z9I A;  2KA9 A;  1G9O A;  1Q3P A;  2OS6 A;  2YT8 A;  2KRG A;  2M0V A;  2KYL A;  2IWO A;  1BE9 A;  2QKV A;  1FC9 A;  1P1E A;  4NMQ A;  1GQ5 A;  1RY4 A;  4JOR A;  2VPH A;  1UM7 A;  5HET A;  2CSJ A;  4Q6H A;  4F8K A;  4MPA A;  5I7Z A;  1VAE A;  2ZPL A;  1PDR A;  1I92 A;  2L97 A;  3HPK A;  1KY9 A;  2DLU A;  3PS4 A;  3DJA A;  3RLE A;  1D5G A;  3PDZ A;  2JXO A;  3SHW A;  2LOB A;  5FB8 C;  2WL7 A;  1NF3 C;  3K1R A;  5H3J A;  4Q2O A;  2OPG A;  1WJL A;  2LUI A;  1UEW A;  3CH8 A;  2F5Y A;  5E21 A;  2MX6 A;  4FGM A;  2QKT A;  2VWR A;  1SOZ A;  4P0C A;  4R2Z A;  2O2T A;  3E17 A;  4NMS A;  4UU5 A;  4OEP A;  2IWP A;  4K6Y A;  1V5Q A;  1MFL A;  3SUZ A;  2E7K A;  2PZD A;  1V6B A;  1X8S A;  4NMP A;  5HEY A;  4YYX A;  5HDY A;  5HEB A;  1QAV A;  2D90 A;  3PV2 A;  1X5R A;  3DJ1 A;  2M3M A;  2YUB A;  5E1Y A;  5HED A;  3PV4 A;  3KZD A;  2P3W A;  4Z33 A;  3LNY A;  3QJN A;  4Q2Q A;  4XHV A;  2JSN A;  2I0I A;  4L8N A;  2EV8 A;  1W9E A;  2W4F A;  1OBX A;  3K50 A;  1N7E A;  4Q6S A;  1Z87 A;  1RGR A;  1U38 A;  2QG1 A;  4HOP B;  1TP5 A;  4Q2N A;  3RL8 A;  1KEF A;  5G1D A;  1MC7 A;  3MH7 A;  4E3B A;  2REY A;  3PV5 A;  5B6L A;  3CBX A;  4NMO A;  1GQ4 A;  3DOR A;  5HFF A;  1L6O A;  3GDV A;  2DM8 A;  2KQF A;  3TMH A;  3NGH A;  2PKU A;  5E6P B;  2I4S A;  1OBY A;  1UM1 A;  1M5Z A;  1UJV A;  4NMV A;  3WKM A;  5B42 A;  3SFJ A;  4JOE A;  1WI2 A;  5HFB A;  3BPU A;  2I6V A;  2PNT A;  2K1Z A;  5EYZ A;  2OZF A;  1WHD A;  1N6F A;  2H2C A;  1LCY A;  2AWW A;  2Z17 A;  3QDO A;  2HE2 A;  5G1E A;  5D13 A;  1UJU A;  1X9Z A;  2KOM A;  3DJ3 A;  3ID1 A;  2L4S A;  2EAQ A;  4K76 A;  1V62 A;  2F0A A;  2EDZ A;  2JIK A;  2EEH A;  1WFV A;  2H2B A;  4H11 A;  5HFD A;  1UHP A;  3NFK A;  2M10 A;  3GGE A;  1MFG A;  2DJT A;  4E35 A;  2VSP A;  4NNL A;  1R6J A;  3O5N A;  3VQG A;  3LNX A;  2OGP A;  1VCW A;  1UEQ A;  3KDK A;  3OU0 A;  5A2P A;  1W9Q A;  2KG2 A;  2EDV A;  4JJ3 A;  3MH4 A;  3GDU A;  1TP3 A;  2EGK A;  2QBW A;  1X5N A;  2H3M A;  5HFC A;  1V1T A;  2QKU A;  3JXT A;  3QIK A;  3VQF A;  3NFL A; 
#chains in the Genus database with same CATH homology
 1N99 A;  2AIN A;  2M0U A;  1VB7 A;  2M0T A;  2G2L A;  2H3L A;  1UFX A;  2I04 A;  4Z8J A;  5EZ0 A;  3R68 A;  4FLN A;  3CBZ A;  2MHO A;  2OSG A;  1N6D A;  2PDZ A;  2OQS A;  2EHR A;  5F67 A;  4NMR A;  4REY A;  3SHU A;  1QLC A;  2IWQ A;  1IU2 A;  2GEF A;  1N7F A;  5HF4 A;  2VZ5 A;  2QT5 A;  4EDJ A;  4IC6 A;  4NXR A;  2Q3G A;  4G69 A;  1U39 A;  3ID2 A;  2KJK A;  5HF1 A;  2EEJ A;  2D92 A;  2KJP A;  4NXP A;  1ZUB A;  2EGN A;  1VA8 A;  1WFG A;  2LA8 A;  4UU6 A;  2JRE A;  2DLS A;  4OEO A;  3MH6 A;  3O46 A;  2KJD A;  1IHJ A;  2ZPM A;  3GSL A;  1I16 A;  2D8I A;  1P1D A;  4O06 A;  2PKT A;  3QJM A;  3WKL A;  1TE0 A;  3RL7 A;  3TSV A;  2JWE A;  3TSW A;  4Q2P A;  4K75 A;  5GND A;  4K78 A;  3KDG A;  2HE4 A;  2R3Y A;  2HGA A;  2M0Z A;  4HOP A;  1FC6 A;  2PA1 A;  4NNM A;  4K72 A;  1Q3O A;  1WF7 A;  1XZ9 A;  4GVD A;  2KPL A;  3ID4 A;  1V5L A;  2BYG A;  3I4W A;  4JOF A;  1QAU A;  1UJD A;  4WYT A;  2JOA A;  5HFE A;  3GCN A;  3ZRT A;  4JL7 A;  1X45 A;  2KL1 A;  4JOH A;  1WH1 A;  2UZC A;  5FHT A;  2OMJ A;  3DIW A;  1GM1 A;  5ILB A;  2LC6 A;  2JIL A;  3TSZ A;  1U3B A;  1X6D A;  2YUY A;  4JJ0 A;  2YTW A;  4NXQ A;  2DB5 A;  5JXB A;  4GHN A;  5GLJ A;  5IL9 A;  2EGO A;  1UF1 A;  3QE1 A;  1OZI A;  3KZE A;  5HJ1 A;  2I0L A;  3ID3 A;  1TQ3 A;  5E22 A;  4P2A B;  1BFE A;  3SOE A;  4AMH A;  2KAW A;  1RGW A;  4JOP A;  2VSV A;  2OCS A;  1UIT A;  3EGG C;  1WF8 A;  1T2M A;  1Z86 A;  3AXA A;  2G5M B;  1NTE A;  3OTP A;  1RZX A;  1N7T A;  2W7R A;  1UEP A;  2FCF A;  2Q9V A;  3HVQ C;  2K20 A;  1SOT A;  3GDS A;  3NCV A;  2V90 A;  2FE5 A;  1U37 A;  4NMT A;  1N6E A;  2EJY A;  3R69 A;  5F3X A;  5E11 A;  1X5Q A;  1WI4 A;  3HPM A;  2KBS A;  3K82 A;  1FCF A;  2I1N A;  1QAV B;  4RI0 A;  1FC7 A;  1Q7X A;  2KV8 A;  2AWX A;  1WG6 A;  1K32 A;  2X7Z A;  1Y7N A;  3GCO A;  2LC7 A;  2RCZ A;  2DMZ A;  2KPK A;  3GAB A;  4JOK A;  4YDP A;  1VJ6 A;  4E34 A;  1W9O A;  2VRF A;  3I18 A;  4LMM A;  2YT7 A;  4PQW A;  2DC2 A;  1B8Q A;  3CBY A;  1UEZ A;  1WIF A;  3CC0 A;  2KOJ A;  2L4T A;  1ZOK A;  4JOJ A;  3KHF A;  4Q3H A;  3FY5 A;  4KFW A;  1Y8T A;  3R0H A;  2JIN A;  3QGL A;  2GZV A;  2DAZ A;  3STJ A;  4OAJ A;  5DTH A;  2CS5 A;  2KOH A;  2V1W A;  4JOG A;  3PDV A;  2DKR A;  2RRM A;  3GJ9 A;  2FNE A;  2EDP A;  1WHA A;  4GVC A;  4N6X A;  2IWN A;  2FN5 A;  2CSS A;  2EXG A;  4KFV A;  2ENO A;  3I1E A;  3EGH C;  1KWA A;  4WYU A;  3B76 A;  2R4H A;  2AWU A;  3CYY A;  3L4F D;  2EEG A;  1YBO A;  1IU0 A;  3CS0 A;  3QO6 A;  2EEI A;  1OBZ A;  2Z9I A;  2KA9 A;  1G9O A;  1Q3P A;  2OS6 A;  2YT8 A;  2KRG A;  2M0V A;  2KYL A;  2IWO A;  1BE9 A;  2QKV A;  1FC9 A;  1P1E A;  4NMQ A;  1GQ5 A;  1RY4 A;  4JOR A;  2VPH A;  1UM7 A;  5HET A;  2CSJ A;  4Q6H A;  4F8K A;  4MPA A;  5I7Z A;  1VAE A;  2ZPL A;  1PDR A;  1I92 A;  2L97 A;  3HPK A;  1KY9 A;  2DLU A;  3PS4 A;  3DJA A;  3RLE A;  1D5G A;  3PDZ A;  2JXO A;  3SHW A;  2LOB A;  5FB8 C;  2WL7 A;  1NF3 C;  3K1R A;  5H3J A;  4Q2O A;  2OPG A;  1WJL A;  2LUI A;  1UEW A;  3CH8 A;  2F5Y A;  5E21 A;  2MX6 A;  4FGM A;  2QKT A;  2VWR A;  1SOZ A;  4P0C A;  4R2Z A;  2O2T A;  3E17 A;  4NMS A;  4UU5 A;  4OEP A;  2IWP A;  4K6Y A;  1V5Q A;  1MFL A;  3SUZ A;  2E7K A;  2PZD A;  1V6B A;  1X8S A;  4NMP A;  5HEY A;  4YYX A;  5HDY A;  5HEB A;  1QAV A;  2D90 A;  3PV2 A;  1X5R A;  3DJ1 A;  2M3M A;  2YUB A;  5E1Y A;  5HED A;  3PV4 A;  3KZD A;  2P3W A;  4Z33 A;  3LNY A;  3QJN A;  4Q2Q A;  4XHV A;  2JSN A;  2I0I A;  4L8N A;  2EV8 A;  1W9E A;  2W4F A;  1OBX A;  3K50 A;  1N7E A;  4Q6S A;  1Z87 A;  1RGR A;  1U38 A;  2QG1 A;  4HOP B;  1TP5 A;  4Q2N A;  3RL8 A;  1KEF A;  5G1D A;  1MC7 A;  3MH7 A;  4E3B A;  2REY A;  3PV5 A;  5B6L A;  3CBX A;  4NMO A;  1GQ4 A;  3DOR A;  5HFF A;  1L6O A;  3GDV A;  2DM8 A;  2KQF A;  3TMH A;  3NGH A;  2PKU A;  5E6P B;  2I4S A;  1OBY A;  1UM1 A;  1M5Z A;  1UJV A;  4NMV A;  3WKM A;  5B42 A;  3SFJ A;  4JOE A;  1WI2 A;  5HFB A;  3BPU A;  2I6V A;  2PNT A;  2K1Z A;  5EYZ A;  2OZF A;  1WHD A;  1N6F A;  2H2C A;  1LCY A;  2AWW A;  2Z17 A;  3QDO A;  2HE2 A;  5G1E A;  5D13 A;  1UJU A;  1X9Z A;  2KOM A;  3DJ3 A;  3ID1 A;  2L4S A;  2EAQ A;  4K76 A;  1V62 A;  2F0A A;  2EDZ A;  2JIK A;  2EEH A;  1WFV A;  2H2B A;  4H11 A;  5HFD A;  1UHP A;  3NFK A;  2M10 A;  3GGE A;  1MFG A;  2DJT A;  4E35 A;  2VSP A;  4NNL A;  1R6J A;  3O5N A;  3VQG A;  3LNX A;  2OGP A;  1VCW A;  1UEQ A;  3KDK A;  3OU0 A;  5A2P A;  1W9Q A;  2KG2 A;  2EDV A;  4JJ3 A;  3MH4 A;  3GDU A;  1TP3 A;  2EGK A;  2QBW A;  1X5N A;  2H3M A;  5HFC A;  1V1T A;  2QKU A;  3JXT A;  3QIK A;  3VQF A;  3NFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...