2KQFA

Solution structure of mast205-pdz complexed with the c-terminus of a rabies virus g protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated serine/threonine-protein kinase 2
publication title 1H, 13C and 15N resonance assignments of the PDZ of Microtubule-associated serine/threonine kinase 205 (MAST205) in complex with the C-Terminal motif from the rabies virus glycoprotein
rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide binding protein
total genus 15
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kqfA00
3PV2A 1ZOKA 3K1RA 2PA1A 4GVCA 1BE9A 2I4SA 4JOPA 3FY5A 2I1NA 3TMHA 1Q7XA 2V90A 2G2LA 4OEPA 3AXAA 1Q3OA 1FC9A 1V62A 2KPLA 5B6LA 1P1DA 1W9EA 4JORA 3CC0A 5JXBA 4P0CA 2QBWA 3SFJA 2EEJA 1I92A 1BFEA 2PNTA 3NFLA 4E34A 1UEWA 4PQWA 3WKLA 2JINA 2Q9VA 3NGHA 2PKTA 1SOZA 2W4FA 2Z9IA 2BYGA 3CH8A 2GZVA 1VA8A 1VAEA 3GSLA 4OEOA 2REYA 4K75A 4N6XA 2KPKA 1N6EA 1XZ9A 3CBZA 5HFBA 2L4TA 2JILA 2M0ZA 2KL1A 1RZXA 2DLUA 4NMSA 1K32A 5H3JA 3PV5A 2KOJA 4JL7A 4K76A 2OZFA 3QE1A 4K6YA 4NMQA 2E7KA 1SOTA 2FNEA 3VQGA 2QKUA 4JOJA 1N7FA 1U39A 2EJYA 5E6PB 1WI2A 2DJTA 5HFFA 2AWWA 2Q3GA 1IU0A 2VPHA 4JOFA 2JWEA 2MHOA 2H3LA 4KFVA 1M5ZA 2R3YA 2JXOA 1UM7A 2VZ5A 1Q3PA 2D92A 3QJNA 3MH7A 3CBXA 5HFEA 1G9OA 1N99A 2YUBA 1KEFA 1LCYA 2O2TA 3CS0A 1TQ3A 2OPGA 3HVQC 2KOHA 1TE0A 2AINA 2DLSA 2R4HA 2VSVA 4NNLA 5E22A 2M0TA 1X5NA 3I1EA 2H2BA 3E17A 2I0LA 4NMRA 5HF4A 1X5QA 3RL7A 3PDVA 5G1EA 2QKVA 2UZCA 1UHPA 3HPKA 3BPUA 2WL7A 2JOAA 1WFVA 1D5GA 3OU0A 2IWNA 1UEPA 3DORA 2IWOA 2CSJA 1V5QA 2AWXA 2DC2A 4Q2QA 3DJ3A 4HOPA 2KYLA 3ID1A 2QT5A 2I04A 5F3XA 1UEQA 2KG2A 4YDPA 1VJ6A 2FN5A 2DB5A 2L97A 1V1TA 1KWAA 3EGHC 2KA9A 3PV4A 1QAVA 3QDOA 2PDZA 1TP5A 1N7TA 2KRGA 4XHVA 2DM8A 2EV8A 5EZ0A 4REYA 1RY4A 2ZPLA 1GM1A 4NXQA 2DMZA 2KJDA 3CYYA 1WG6A 2CS5A 2QKTA 3O5NA 3DJ1A 1X5RA 4NMVA 4WYTA 4Q6HA 3RLEA 5HEDA 1U38A 5EYZA 1WJLA 1NTEA 4YYXA 4UU5A 2G5MB 1UITA 1WI4A 3EGGC 2FCFA 4AMHA 3GDVA 1NF3C 4F8KA 4Z33A 2HGAA 1IHJA 2L4SA 2V1WA 1N6FA 1OZIA 1WF7A 3GCNA 3QGLA 1MC7A 1V6BA 2EEHA 1PDRA 1UM1A 1W9QA 1X8SA 1Y7NA 1R6JA 1RGWA 2D90A 4GHNA 2DAZA 1IU2A 1I16A 1MFGA 4H11A 3CBYA 3NFKA 2I0IA 2OMJA 3GJ9A 2F5YA 2F0AA 4UU6A 2OSGA 1GQ4A 1N6DA 2OCSA 3MH6A 3B76A 5HEBA 2OS6A 2KJPA 5E11A 1FCFA 3R69A 3QIKA 4JOKA 5HJ1A 4Q2PA 3KZEA 4NNMA 2EGNA 1FC6A 5FHTA 1L6OA 1U37A 2KAWA 2HE2A 1YBOA 4RI0A 1UFXA 4GVDA 4Q3HA 3SUZA 4MPAA 4NMTA 5A2PA 2JIKA 4NXPA 2EEIA 2QG1A 4G69A 4Q6SA 2DKRA 2X7ZA 1UEZA 2I6VA 2RCZA 2EDZA 4KFWA 2ENOA 1UJUA 3OTPA 2LUIA 1X45A 4FGMA 2PZDA 2JREA 1UJDA 3GDSA 4O06A 3SHUA 4Q2OA 2VWRA 4JOEA 2YT8A 3TSWA 2ZPMA 2OQSA 3SOEA 1WHAA 1ZUBA 2EGKA 2EDVA 5DTHA 2KQFA 1QAVB 2MX6A 4NMPA 1KY9A 5FB8C 2M0UA 1WFGA 5GLJA 3O46A 3WKMA 3ID2A 5E1YA 2K1ZA 5HEYA 2EAQA 2RRMA 2M3MA 2EGOA 3PS4A 2H2CA 2EHRA 3GCOA 1U3BA 3DIWA 4Q2NA 1OBZA 3ZRTA 2H3MA 3R68A 4K78A 5HFCA 2M0VA 1N7EA 1V5LA 1Z87A 3R0HA 1FC7A 2KJKA 5E21A 3DJAA 3STJA 4EDJA 1TP3A 1QLCA 2EDPA 1OBXA 1WIFA 4WYUA 4JOGA 3MH4A 1B8QA 1GQ5A 3RL8A 4NXRA 2OGPA 2VRFA 5HF1A 4P2AB 2PKUA 2Z17A 1P1EA 2VSPA 2EEGA 1W9OA 3GDUA 3KHFA 1X6DA 4E35A 2M10A 1UJVA 2KBSA 4K72A 1VCWA 2P3WA 3I4WA 3K82A 1WH1A 4JOHA 1OBYA 2D8IA 3TSVA 3ID4A 2EXGA 1VB7A 5HFDA 2LC6A 1Z86A 4Z8JA 3TSZA 2CSSA 3LNYA 3HPMA 4R2ZA 2LC7A 4IC6A 2LA8A 2YUYA 5GNDA 2KOMA 2YTWA 4E3BA 3SHWA 2HE4A 3KZDA 2IWQA 5D13A 5HETA 1WF8A 3K50A 1QAUA 1Y8TA 3QJMA 2YT7A 1RGRA 1WHDA 4LMMA 3QO6A 5I7ZA 3I18A 5F67A 3ID3A 1UF1A 2K20A 2IWPA 4L8NA 4OAJA 1T2MA 3VQFA 3PDZA 3JXTA 4HOPB 5HDYA 2FE5A 2AWUA 2KV8A 2W7RA 3LNXA 5G1DA 3GGEA 3L4FD 2LOBA 1MFLA 4NMOA
chains in the Genus database with same CATH superfamily
3PV2A 1ZOKA 3K1RA 2PA1A 4GVCA 1BE9A 2I4SA 4JOPA 3FY5A 2I1NA 3TMHA 1Q7XA 2V90A 2G2LA 4OEPA 3AXAA 1Q3OA 1FC9A 1V62A 2KPLA 5B6LA 1P1DA 1W9EA 4JORA 3CC0A 5JXBA 4P0CA 2QBWA 3SFJA 2EEJA 1I92A 1BFEA 2PNTA 3NFLA 4E34A 1UEWA 4PQWA 3WKLA 2JINA 2Q9VA 3NGHA 2PKTA 1SOZA 2W4FA 2Z9IA 2BYGA 3CH8A 2GZVA 1VA8A 1VAEA 3GSLA 4OEOA 2REYA 4K75A 4N6XA 2KPKA 1N6EA 1XZ9A 3CBZA 5HFBA 2L4TA 2JILA 2M0ZA 2KL1A 1RZXA 2DLUA 4NMSA 1K32A 5H3JA 3PV5A 2KOJA 4JL7A 4K76A 2OZFA 3QE1A 4K6YA 4NMQA 2E7KA 1SOTA 2FNEA 3VQGA 2QKUA 4JOJA 1N7FA 1U39A 2EJYA 5E6PB 1WI2A 2DJTA 5HFFA 2AWWA 2Q3GA 1IU0A 2VPHA 4JOFA 2JWEA 2MHOA 2H3LA 4KFVA 1M5ZA 2R3YA 2JXOA 1UM7A 2VZ5A 1Q3PA 2D92A 3QJNA 3MH7A 3CBXA 3NCVA 5HFEA 1G9OA 1N99A 2YUBA 1KEFA 1LCYA 2O2TA 3CS0A 1TQ3A 2OPGA 3HVQC 2KOHA 1TE0A 2AINA 2DLSA 2R4HA 2VSVA 4NNLA 5E22A 2M0TA 1X5NA 3I1EA 2H2BA 3E17A 2I0LA 4NMRA 5HF4A 1X5QA 3RL7A 3PDVA 5G1EA 2QKVA 2UZCA 1UHPA 3HPKA 3BPUA 2WL7A 2JOAA 1WFVA 1D5GA 3OU0A 2IWNA 1UEPA 3DORA 2IWOA 2CSJA 1V5QA 2AWXA 2DC2A 4Q2QA 3DJ3A 4HOPA 2KYLA 3ID1A 2QT5A 2I04A 5F3XA 1UEQA 2KG2A 4YDPA 1VJ6A 2FN5A 2DB5A 2L97A 1V1TA 1KWAA 3EGHC 2KA9A 3PV4A 1QAVA 3QDOA 2PDZA 1TP5A 1N7TA 2KRGA 4XHVA 2DM8A 2EV8A 5EZ0A 4REYA 1RY4A 2ZPLA 1GM1A 4NXQA 2DMZA 2KJDA 3CYYA 1WG6A 5ILBA 2CS5A 4FLNA 2QKTA 3O5NA 3DJ1A 1X5RA 4NMVA 4WYTA 4Q6HA 3RLEA 5HEDA 1U38A 5EYZA 1WJLA 1NTEA 4YYXA 4UU5A 2G5MB 1UITA 1WI4A 3EGGC 2FCFA 4AMHA 3GDVA 1NF3C 4F8KA 4Z33A 2HGAA 1IHJA 2L4SA 2V1WA 1N6FA 1OZIA 1WF7A 3GCNA 3QGLA 1MC7A 1V6BA 2EEHA 1X9ZA 1PDRA 1UM1A 1W9QA 1X8SA 5B42A 1Y7NA 1R6JA 1RGWA 2D90A 4GHNA 2DAZA 1IU2A 1I16A 1MFGA 4H11A 3CBYA 3NFKA 2I0IA 2OMJA 3GJ9A 2F5YA 2F0AA 4UU6A 2OSGA 1GQ4A 1N6DA 2OCSA 3MH6A 3B76A 5HEBA 2OS6A 2KJPA 5E11A 1FCFA 3R69A 3QIKA 4JOKA 5HJ1A 4Q2PA 3KZEA 4NNMA 2EGNA 1FC6A 5FHTA 1L6OA 1U37A 2KAWA 2HE2A 1YBOA 4RI0A 1UFXA 4GVDA 4Q3HA 3SUZA 4MPAA 4NMTA 5A2PA 2JIKA 4NXPA 2EEIA 2QG1A 4G69A 4Q6SA 2DKRA 2X7ZA 1UEZA 2I6VA 2RCZA 2EDZA 4KFWA 2ENOA 2GEFA 1UJUA 3OTPA 2LUIA 1X45A 4FGMA 2PZDA 2JREA 1UJDA 3GDSA 4O06A 3SHUA 4Q2OA 2VWRA 3KDGA 4JOEA 2YT8A 3TSWA 2ZPMA 2OQSA 3KDKA 3SOEA 1WHAA 1ZUBA 2EGKA 2EDVA 5DTHA 2KQFA 1QAVB 2MX6A 4NMPA 1KY9A 5FB8C 2M0UA 1WFGA 5GLJA 3O46A 3WKMA 3ID2A 5E1YA 2K1ZA 5HEYA 2EAQA 2RRMA 2M3MA 2EGOA 3PS4A 2H2CA 2EHRA 3GCOA 1U3BA 3DIWA 4Q2NA 1OBZA 3ZRTA 4JJ0A 2H3MA 3R68A 4K78A 5HFCA 2M0VA 1N7EA 1V5LA 1Z87A 3R0HA 1FC7A 2KJKA 5E21A 3DJAA 3STJA 4EDJA 1TP3A 1QLCA 2EDPA 1OBXA 1WIFA 4WYUA 4JOGA 3MH4A 1B8QA 1GQ5A 3RL8A 4NXRA 2OGPA 2VRFA 5HF1A 4P2AB 2PKUA 2Z17A 1P1EA 2VSPA 2EEGA 1W9OA 3GDUA 3KHFA 3GABA 1X6DA 4E35A 2M10A 1UJVA 2KBSA 4K72A 1VCWA 2P3WA 3I4WA 3K82A 1WH1A 4JOHA 1OBYA 2D8IA 2JSNA 3TSVA 3ID4A 2EXGA 1VB7A 5HFDA 2LC6A 1Z86A 5IL9A 4Z8JA 3TSZA 2CSSA 3LNYA 3HPMA 4R2ZA 2LC7A 4IC6A 2LA8A 2YUYA 5GNDA 2KOMA 2YTWA 4E3BA 4JJ3A 3SHWA 2HE4A 3KZDA 2IWQA 5D13A 5HETA 1WF8A 3K50A 1QAUA 1Y8TA 3QJMA 2YT7A 1RGRA 1WHDA 4LMMA 3QO6A 5I7ZA 3I18A 5F67A 3ID3A 1UF1A 2K20A 2IWPA 4L8NA 4OAJA 1T2MA 3VQFA 3PDZA 3JXTA 4HOPB 5HDYA 2FE5A 2AWUA 2KV8A 2W7RA 3LNXA 5G1DA 3GGEA 3L4FD 2LOBA 1MFLA 4NMOA
chains in the Genus database with same CATH topology
3PV2A 1ZOKA 3K1RA 2PA1A 4GVCA 1BE9A 2I4SA 4JOPA 3FY5A 2I1NA 3TMHA 1Q7XA 2V90A 2G2LA 4OEPA 3AXAA 1Q3OA 1FC9A 1V62A 2KPLA 5B6LA 1P1DA 1W9EA 4JORA 3CC0A 5JXBA 4P0CA 2QBWA 3SFJA 2EEJA 1I92A 1BFEA 2PNTA 3NFLA 4E34A 1UEWA 4PQWA 3WKLA 2JINA 2Q9VA 3NGHA 2PKTA 1SOZA 2W4FA 2Z9IA 2BYGA 3CH8A 2GZVA 1VA8A 1VAEA 3GSLA 4OEOA 2REYA 4K75A 4N6XA 2KPKA 1N6EA 1XZ9A 3CBZA 5HFBA 2L4TA 2JILA 2M0ZA 2KL1A 1RZXA 2DLUA 4NMSA 1K32A 5H3JA 3PV5A 2KOJA 4JL7A 4K76A 2OZFA 3QE1A 4K6YA 4NMQA 2E7KA 1SOTA 2FNEA 3VQGA 2QKUA 4JOJA 1N7FA 1U39A 2EJYA 5E6PB 1WI2A 2DJTA 5HFFA 2AWWA 2Q3GA 1IU0A 2VPHA 4JOFA 2JWEA 2MHOA 2H3LA 4KFVA 1M5ZA 2R3YA 2JXOA 1UM7A 2VZ5A 1Q3PA 2D92A 3QJNA 3MH7A 3CBXA 3NCVA 5HFEA 1G9OA 1N99A 2YUBA 1KEFA 1LCYA 2O2TA 3CS0A 1TQ3A 2OPGA 3HVQC 2KOHA 1TE0A 2AINA 2DLSA 2R4HA 2VSVA 4NNLA 5E22A 2M0TA 1X5NA 3I1EA 2H2BA 3E17A 2I0LA 4NMRA 5HF4A 1X5QA 3RL7A 3PDVA 5G1EA 2QKVA 2UZCA 1UHPA 3HPKA 3BPUA 2WL7A 2JOAA 1WFVA 1D5GA 3OU0A 2IWNA 1UEPA 3DORA 2IWOA 2CSJA 1V5QA 2AWXA 2DC2A 4Q2QA 3DJ3A 4HOPA 2KYLA 3ID1A 2QT5A 2I04A 5F3XA 1UEQA 2KG2A 4YDPA 1VJ6A 2FN5A 2DB5A 2L97A 1V1TA 1KWAA 3EGHC 2KA9A 3PV4A 1QAVA 3QDOA 2PDZA 1TP5A 1N7TA 2KRGA 4XHVA 2DM8A 2EV8A 5EZ0A 4REYA 1RY4A 2ZPLA 1GM1A 4NXQA 2DMZA 2KJDA 3CYYA 1WG6A 5ILBA 2CS5A 4FLNA 2QKTA 3O5NA 3DJ1A 1X5RA 4NMVA 4WYTA 4Q6HA 3RLEA 5HEDA 1U38A 5EYZA 1WJLA 1NTEA 4YYXA 4UU5A 2G5MB 1UITA 1WI4A 3EGGC 2FCFA 4AMHA 3GDVA 1NF3C 4F8KA 4Z33A 2HGAA 1IHJA 2L4SA 2V1WA 1N6FA 1OZIA 1WF7A 3GCNA 3QGLA 1MC7A 1V6BA 2EEHA 1X9ZA 1PDRA 1UM1A 1W9QA 1X8SA 5B42A 1Y7NA 1R6JA 1RGWA 2D90A 4GHNA 2DAZA 1IU2A 1I16A 1MFGA 4H11A 3CBYA 3NFKA 2I0IA 2OMJA 3GJ9A 2F5YA 2F0AA 4UU6A 2OSGA 1GQ4A 1N6DA 2OCSA 3MH6A 3B76A 5HEBA 2OS6A 2KJPA 5E11A 1FCFA 3R69A 3QIKA 4JOKA 5HJ1A 4Q2PA 3KZEA 4NNMA 2EGNA 1FC6A 5FHTA 1L6OA 1U37A 2KAWA 2HE2A 1YBOA 4RI0A 1UFXA 4GVDA 4Q3HA 3SUZA 4MPAA 4NMTA 5A2PA 2JIKA 4NXPA 2EEIA 2QG1A 4G69A 4Q6SA 2DKRA 2X7ZA 1UEZA 2I6VA 2RCZA 2EDZA 4KFWA 2ENOA 2GEFA 1UJUA 3OTPA 2LUIA 1X45A 4FGMA 2PZDA 2JREA 1UJDA 3GDSA 4O06A 3SHUA 4Q2OA 2VWRA 3KDGA 4JOEA 2YT8A 3TSWA 2ZPMA 2OQSA 3KDKA 3SOEA 1WHAA 1ZUBA 2EGKA 2EDVA 5DTHA 2KQFA 1QAVB 2MX6A 4NMPA 1KY9A 5FB8C 2M0UA 1WFGA 5GLJA 3O46A 3WKMA 3ID2A 5E1YA 2K1ZA 5HEYA 2EAQA 2RRMA 2M3MA 2EGOA 3PS4A 2H2CA 2EHRA 3GCOA 1U3BA 3DIWA 4Q2NA 1OBZA 3ZRTA 4JJ0A 2H3MA 3R68A 4K78A 5HFCA 2M0VA 1N7EA 1V5LA 1Z87A 3R0HA 1FC7A 2KJKA 5E21A 3DJAA 3STJA 4EDJA 1TP3A 1QLCA 2EDPA 1OBXA 1WIFA 4WYUA 4JOGA 3MH4A 1B8QA 1GQ5A 3RL8A 4NXRA 2OGPA 2VRFA 5HF1A 4P2AB 2PKUA 2Z17A 1P1EA 2VSPA 2EEGA 1W9OA 3GDUA 3KHFA 3GABA 1X6DA 4E35A 2M10A 1UJVA 2KBSA 4K72A 1VCWA 2P3WA 3I4WA 3K82A 1WH1A 4JOHA 1OBYA 2D8IA 2JSNA 3TSVA 3ID4A 2EXGA 1VB7A 5HFDA 2LC6A 1Z86A 5IL9A 4Z8JA 3TSZA 2CSSA 3LNYA 3HPMA 4R2ZA 2LC7A 4IC6A 2LA8A 2YUYA 5GNDA 2KOMA 2YTWA 4E3BA 4JJ3A 3SHWA 2HE4A 3KZDA 2IWQA 5D13A 5HETA 1WF8A 3K50A 1QAUA 1Y8TA 3QJMA 2YT7A 1RGRA 1WHDA 4LMMA 3QO6A 5I7ZA 3I18A 5F67A 3ID3A 1UF1A 2K20A 2IWPA 4L8NA 4OAJA 1T2MA 3VQFA 3PDZA 3JXTA 4HOPB 5HDYA 2FE5A 2AWUA 2KV8A 2W7RA 3LNXA 5G1DA 3GGEA 3L4FD 2LOBA 1MFLA 4NMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV2 A;  1ZOK A;  3K1R A;  2PA1 A;  4GVC A;  1BE9 A;  2I4S A;  4JOP A;  3FY5 A;  2I1N A;  3TMH A;  1Q7X A;  2V90 A;  2G2L A;  4OEP A;  3AXA A;  1Q3O A;  1FC9 A;  1V62 A;  2KPL A;  5B6L A;  1P1D A;  1W9E A;  4JOR A;  3CC0 A;  5JXB A;  4P0C A;  2QBW A;  3SFJ A;  2EEJ A;  1I92 A;  1BFE A;  2PNT A;  3NFL A;  4E34 A;  1UEW A;  4PQW A;  3WKL A;  2JIN A;  2Q9V A;  3NGH A;  2PKT A;  1SOZ A;  2W4F A;  2Z9I A;  2BYG A;  3CH8 A;  2GZV A;  1VA8 A;  1VAE A;  3GSL A;  4OEO A;  2REY A;  4K75 A;  4N6X A;  2KPK A;  1N6E A;  1XZ9 A;  3CBZ A;  5HFB A;  2L4T A;  2JIL A;  2M0Z A;  2KL1 A;  1RZX A;  2DLU A;  4NMS A;  1K32 A;  5H3J A;  3PV5 A;  2KOJ A;  4JL7 A;  4K76 A;  2OZF A;  3QE1 A;  4K6Y A;  4NMQ A;  2E7K A;  1SOT A;  2FNE A;  3VQG A;  2QKU A;  4JOJ A;  1N7F A;  1U39 A;  2EJY A;  5E6P B;  1WI2 A;  2DJT A;  5HFF A;  2AWW A;  2Q3G A;  1IU0 A;  2VPH A;  4JOF A;  2JWE A;  2MHO A;  2H3L A;  4KFV A;  1M5Z A;  2R3Y A;  2JXO A;  1UM7 A;  2VZ5 A;  1Q3P A;  2D92 A;  3QJN A;  3MH7 A;  3CBX A;  5HFE A;  1G9O A;  1N99 A;  2YUB A;  1KEF A;  1LCY A;  2O2T A;  3CS0 A;  1TQ3 A;  2OPG A;  3HVQ C;  2KOH A;  1TE0 A;  2AIN A;  2DLS A;  2R4H A;  2VSV A;  4NNL A;  5E22 A;  2M0T A;  1X5N A;  3I1E A;  2H2B A;  3E17 A;  2I0L A;  4NMR A;  5HF4 A;  1X5Q A;  3RL7 A;  3PDV A;  5G1E A;  2QKV A;  2UZC A;  1UHP A;  3HPK A;  3BPU A;  2WL7 A;  2JOA A;  1WFV A;  1D5G A;  3OU0 A;  2IWN A;  1UEP A;  3DOR A;  2IWO A;  2CSJ A;  1V5Q A;  2AWX A;  2DC2 A;  4Q2Q A;  3DJ3 A;  4HOP A;  2KYL A;  3ID1 A;  2QT5 A;  2I04 A;  5F3X A;  1UEQ A;  2KG2 A;  4YDP A;  1VJ6 A;  2FN5 A;  2DB5 A;  2L97 A;  1V1T A;  1KWA A;  3EGH C;  2KA9 A;  3PV4 A;  1QAV A;  3QDO A;  2PDZ A;  1TP5 A;  1N7T A;  2KRG A;  4XHV A;  2DM8 A;  2EV8 A;  5EZ0 A;  4REY A;  1RY4 A;  2ZPL A;  1GM1 A;  4NXQ A;  2DMZ A;  2KJD A;  3CYY A;  1WG6 A;  2CS5 A;  2QKT A;  3O5N A;  3DJ1 A;  1X5R A;  4NMV A;  4WYT A;  4Q6H A;  3RLE A;  5HED A;  1U38 A;  5EYZ A;  1WJL A;  1NTE A;  4YYX A;  4UU5 A;  2G5M B;  1UIT A;  1WI4 A;  3EGG C;  2FCF A;  4AMH A;  3GDV A;  1NF3 C;  4F8K A;  4Z33 A;  2HGA A;  1IHJ A;  2L4S A;  2V1W A;  1N6F A;  1OZI A;  1WF7 A;  3GCN A;  3QGL A;  1MC7 A;  1V6B A;  2EEH A;  1PDR A;  1UM1 A;  1W9Q A;  1X8S A;  1Y7N A;  1R6J A;  1RGW A;  2D90 A;  4GHN A;  2DAZ A;  1IU2 A;  1I16 A;  1MFG A;  4H11 A;  3CBY A;  3NFK A;  2I0I A;  2OMJ A;  3GJ9 A;  2F5Y A;  2F0A A;  4UU6 A;  2OSG A;  1GQ4 A;  1N6D A;  2OCS A;  3MH6 A;  3B76 A;  5HEB A;  2OS6 A;  2KJP A;  5E11 A;  1FCF A;  3R69 A;  3QIK A;  4JOK A;  5HJ1 A;  4Q2P A;  3KZE A;  4NNM A;  2EGN A;  1FC6 A;  5FHT A;  1L6O A;  1U37 A;  2KAW A;  2HE2 A;  1YBO A;  4RI0 A;  1UFX A;  4GVD A;  4Q3H A;  3SUZ A;  4MPA A;  4NMT A;  5A2P A;  2JIK A;  4NXP A;  2EEI A;  2QG1 A;  4G69 A;  4Q6S A;  2DKR A;  2X7Z A;  1UEZ A;  2I6V A;  2RCZ A;  2EDZ A;  4KFW A;  2ENO A;  1UJU A;  3OTP A;  2LUI A;  1X45 A;  4FGM A;  2PZD A;  2JRE A;  1UJD A;  3GDS A;  4O06 A;  3SHU A;  4Q2O A;  2VWR A;  4JOE A;  2YT8 A;  3TSW A;  2ZPM A;  2OQS A;  3SOE A;  1WHA A;  1ZUB A;  2EGK A;  2EDV A;  5DTH A;  2KQF A;  1QAV B;  2MX6 A;  4NMP A;  1KY9 A;  5FB8 C;  2M0U A;  1WFG A;  5GLJ A;  3O46 A;  3WKM A;  3ID2 A;  5E1Y A;  2K1Z A;  5HEY A;  2EAQ A;  2RRM A;  2M3M A;  2EGO A;  3PS4 A;  2H2C A;  2EHR A;  3GCO A;  1U3B A;  3DIW A;  4Q2N A;  1OBZ A;  3ZRT A;  2H3M A;  3R68 A;  4K78 A;  5HFC A;  2M0V A;  1N7E A;  1V5L A;  1Z87 A;  3R0H A;  1FC7 A;  2KJK A;  5E21 A;  3DJA A;  3STJ A;  4EDJ A;  1TP3 A;  1QLC A;  2EDP A;  1OBX A;  1WIF A;  4WYU A;  4JOG A;  3MH4 A;  1B8Q A;  1GQ5 A;  3RL8 A;  4NXR A;  2OGP A;  2VRF A;  5HF1 A;  4P2A B;  2PKU A;  2Z17 A;  1P1E A;  2VSP A;  2EEG A;  1W9O A;  3GDU A;  3KHF A;  1X6D A;  4E35 A;  2M10 A;  1UJV A;  2KBS A;  4K72 A;  1VCW A;  2P3W A;  3I4W A;  3K82 A;  1WH1 A;  4JOH A;  1OBY A;  2D8I A;  3TSV A;  3ID4 A;  2EXG A;  1VB7 A;  5HFD A;  2LC6 A;  1Z86 A;  4Z8J A;  3TSZ A;  2CSS A;  3LNY A;  3HPM A;  4R2Z A;  2LC7 A;  4IC6 A;  2LA8 A;  2YUY A;  5GND A;  2KOM A;  2YTW A;  4E3B A;  3SHW A;  2HE4 A;  3KZD A;  2IWQ A;  5D13 A;  5HET A;  1WF8 A;  3K50 A;  1QAU A;  1Y8T A;  3QJM A;  2YT7 A;  1RGR A;  1WHD A;  4LMM A;  3QO6 A;  5I7Z A;  3I18 A;  5F67 A;  3ID3 A;  1UF1 A;  2K20 A;  2IWP A;  4L8N A;  4OAJ A;  1T2M A;  3VQF A;  3PDZ A;  3JXT A;  4HOP B;  5HDY A;  2FE5 A;  2AWU A;  2KV8 A;  2W7R A;  3LNX A;  5G1D A;  3GGE A;  3L4F D;  2LOB A;  1MFL A;  4NMO A; 
#chains in the Genus database with same CATH topology
 3PV2 A;  1ZOK A;  3K1R A;  2PA1 A;  4GVC A;  1BE9 A;  2I4S A;  4JOP A;  3FY5 A;  2I1N A;  3TMH A;  1Q7X A;  2V90 A;  2G2L A;  4OEP A;  3AXA A;  1Q3O A;  1FC9 A;  1V62 A;  2KPL A;  5B6L A;  1P1D A;  1W9E A;  4JOR A;  3CC0 A;  5JXB A;  4P0C A;  2QBW A;  3SFJ A;  2EEJ A;  1I92 A;  1BFE A;  2PNT A;  3NFL A;  4E34 A;  1UEW A;  4PQW A;  3WKL A;  2JIN A;  2Q9V A;  3NGH A;  2PKT A;  1SOZ A;  2W4F A;  2Z9I A;  2BYG A;  3CH8 A;  2GZV A;  1VA8 A;  1VAE A;  3GSL A;  4OEO A;  2REY A;  4K75 A;  4N6X A;  2KPK A;  1N6E A;  1XZ9 A;  3CBZ A;  5HFB A;  2L4T A;  2JIL A;  2M0Z A;  2KL1 A;  1RZX A;  2DLU A;  4NMS A;  1K32 A;  5H3J A;  3PV5 A;  2KOJ A;  4JL7 A;  4K76 A;  2OZF A;  3QE1 A;  4K6Y A;  4NMQ A;  2E7K A;  1SOT A;  2FNE A;  3VQG A;  2QKU A;  4JOJ A;  1N7F A;  1U39 A;  2EJY A;  5E6P B;  1WI2 A;  2DJT A;  5HFF A;  2AWW A;  2Q3G A;  1IU0 A;  2VPH A;  4JOF A;  2JWE A;  2MHO A;  2H3L A;  4KFV A;  1M5Z A;  2R3Y A;  2JXO A;  1UM7 A;  2VZ5 A;  1Q3P A;  2D92 A;  3QJN A;  3MH7 A;  3CBX A;  3NCV A;  5HFE A;  1G9O A;  1N99 A;  2YUB A;  1KEF A;  1LCY A;  2O2T A;  3CS0 A;  1TQ3 A;  2OPG A;  3HVQ C;  2KOH A;  1TE0 A;  2AIN A;  2DLS A;  2R4H A;  2VSV A;  4NNL A;  5E22 A;  2M0T A;  1X5N A;  3I1E A;  2H2B A;  3E17 A;  2I0L A;  4NMR A;  5HF4 A;  1X5Q A;  3RL7 A;  3PDV A;  5G1E A;  2QKV A;  2UZC A;  1UHP A;  3HPK A;  3BPU A;  2WL7 A;  2JOA A;  1WFV A;  1D5G A;  3OU0 A;  2IWN A;  1UEP A;  3DOR A;  2IWO A;  2CSJ A;  1V5Q A;  2AWX A;  2DC2 A;  4Q2Q A;  3DJ3 A;  4HOP A;  2KYL A;  3ID1 A;  2QT5 A;  2I04 A;  5F3X A;  1UEQ A;  2KG2 A;  4YDP A;  1VJ6 A;  2FN5 A;  2DB5 A;  2L97 A;  1V1T A;  1KWA A;  3EGH C;  2KA9 A;  3PV4 A;  1QAV A;  3QDO A;  2PDZ A;  1TP5 A;  1N7T A;  2KRG A;  4XHV A;  2DM8 A;  2EV8 A;  5EZ0 A;  4REY A;  1RY4 A;  2ZPL A;  1GM1 A;  4NXQ A;  2DMZ A;  2KJD A;  3CYY A;  1WG6 A;  5ILB A;  2CS5 A;  4FLN A;  2QKT A;  3O5N A;  3DJ1 A;  1X5R A;  4NMV A;  4WYT A;  4Q6H A;  3RLE A;  5HED A;  1U38 A;  5EYZ A;  1WJL A;  1NTE A;  4YYX A;  4UU5 A;  2G5M B;  1UIT A;  1WI4 A;  3EGG C;  2FCF A;  4AMH A;  3GDV A;  1NF3 C;  4F8K A;  4Z33 A;  2HGA A;  1IHJ A;  2L4S A;  2V1W A;  1N6F A;  1OZI A;  1WF7 A;  3GCN A;  3QGL A;  1MC7 A;  1V6B A;  2EEH A;  1X9Z A;  1PDR A;  1UM1 A;  1W9Q A;  1X8S A;  5B42 A;  1Y7N A;  1R6J A;  1RGW A;  2D90 A;  4GHN A;  2DAZ A;  1IU2 A;  1I16 A;  1MFG A;  4H11 A;  3CBY A;  3NFK A;  2I0I A;  2OMJ A;  3GJ9 A;  2F5Y A;  2F0A A;  4UU6 A;  2OSG A;  1GQ4 A;  1N6D A;  2OCS A;  3MH6 A;  3B76 A;  5HEB A;  2OS6 A;  2KJP A;  5E11 A;  1FCF A;  3R69 A;  3QIK A;  4JOK A;  5HJ1 A;  4Q2P A;  3KZE A;  4NNM A;  2EGN A;  1FC6 A;  5FHT A;  1L6O A;  1U37 A;  2KAW A;  2HE2 A;  1YBO A;  4RI0 A;  1UFX A;  4GVD A;  4Q3H A;  3SUZ A;  4MPA A;  4NMT A;  5A2P A;  2JIK A;  4NXP A;  2EEI A;  2QG1 A;  4G69 A;  4Q6S A;  2DKR A;  2X7Z A;  1UEZ A;  2I6V A;  2RCZ A;  2EDZ A;  4KFW A;  2ENO A;  2GEF A;  1UJU A;  3OTP A;  2LUI A;  1X45 A;  4FGM A;  2PZD A;  2JRE A;  1UJD A;  3GDS A;  4O06 A;  3SHU A;  4Q2O A;  2VWR A;  3KDG A;  4JOE A;  2YT8 A;  3TSW A;  2ZPM A;  2OQS A;  3KDK A;  3SOE A;  1WHA A;  1ZUB A;  2EGK A;  2EDV A;  5DTH A;  2KQF A;  1QAV B;  2MX6 A;  4NMP A;  1KY9 A;  5FB8 C;  2M0U A;  1WFG A;  5GLJ A;  3O46 A;  3WKM A;  3ID2 A;  5E1Y A;  2K1Z A;  5HEY A;  2EAQ A;  2RRM A;  2M3M A;  2EGO A;  3PS4 A;  2H2C A;  2EHR A;  3GCO A;  1U3B A;  3DIW A;  4Q2N A;  1OBZ A;  3ZRT A;  4JJ0 A;  2H3M A;  3R68 A;  4K78 A;  5HFC A;  2M0V A;  1N7E A;  1V5L A;  1Z87 A;  3R0H A;  1FC7 A;  2KJK A;  5E21 A;  3DJA A;  3STJ A;  4EDJ A;  1TP3 A;  1QLC A;  2EDP A;  1OBX A;  1WIF A;  4WYU A;  4JOG A;  3MH4 A;  1B8Q A;  1GQ5 A;  3RL8 A;  4NXR A;  2OGP A;  2VRF A;  5HF1 A;  4P2A B;  2PKU A;  2Z17 A;  1P1E A;  2VSP A;  2EEG A;  1W9O A;  3GDU A;  3KHF A;  3GAB A;  1X6D A;  4E35 A;  2M10 A;  1UJV A;  2KBS A;  4K72 A;  1VCW A;  2P3W A;  3I4W A;  3K82 A;  1WH1 A;  4JOH A;  1OBY A;  2D8I A;  2JSN A;  3TSV A;  3ID4 A;  2EXG A;  1VB7 A;  5HFD A;  2LC6 A;  1Z86 A;  5IL9 A;  4Z8J A;  3TSZ A;  2CSS A;  3LNY A;  3HPM A;  4R2Z A;  2LC7 A;  4IC6 A;  2LA8 A;  2YUY A;  5GND A;  2KOM A;  2YTW A;  4E3B A;  4JJ3 A;  3SHW A;  2HE4 A;  3KZD A;  2IWQ A;  5D13 A;  5HET A;  1WF8 A;  3K50 A;  1QAU A;  1Y8T A;  3QJM A;  2YT7 A;  1RGR A;  1WHD A;  4LMM A;  3QO6 A;  5I7Z A;  3I18 A;  5F67 A;  3ID3 A;  1UF1 A;  2K20 A;  2IWP A;  4L8N A;  4OAJ A;  1T2M A;  3VQF A;  3PDZ A;  3JXT A;  4HOP B;  5HDY A;  2FE5 A;  2AWU A;  2KV8 A;  2W7R A;  3LNX A;  5G1D A;  3GGE A;  3L4F D;  2LOB A;  1MFL A;  4NMO A; 
#chains in the Genus database with same CATH homology
 3PV2 A;  1ZOK A;  3K1R A;  2PA1 A;  4GVC A;  1BE9 A;  2I4S A;  4JOP A;  3FY5 A;  2I1N A;  3TMH A;  1Q7X A;  2V90 A;  2G2L A;  4OEP A;  3AXA A;  1Q3O A;  1FC9 A;  1V62 A;  2KPL A;  5B6L A;  1P1D A;  1W9E A;  4JOR A;  3CC0 A;  5JXB A;  4P0C A;  2QBW A;  3SFJ A;  2EEJ A;  1I92 A;  1BFE A;  2PNT A;  3NFL A;  4E34 A;  1UEW A;  4PQW A;  3WKL A;  2JIN A;  2Q9V A;  3NGH A;  2PKT A;  1SOZ A;  2W4F A;  2Z9I A;  2BYG A;  3CH8 A;  2GZV A;  1VA8 A;  1VAE A;  3GSL A;  4OEO A;  2REY A;  4K75 A;  4N6X A;  2KPK A;  1N6E A;  1XZ9 A;  3CBZ A;  5HFB A;  2L4T A;  2JIL A;  2M0Z A;  2KL1 A;  1RZX A;  2DLU A;  4NMS A;  1K32 A;  5H3J A;  3PV5 A;  2KOJ A;  4JL7 A;  4K76 A;  2OZF A;  3QE1 A;  4K6Y A;  4NMQ A;  2E7K A;  1SOT A;  2FNE A;  3VQG A;  2QKU A;  4JOJ A;  1N7F A;  1U39 A;  2EJY A;  5E6P B;  1WI2 A;  2DJT A;  5HFF A;  2AWW A;  2Q3G A;  1IU0 A;  2VPH A;  4JOF A;  2JWE A;  2MHO A;  2H3L A;  4KFV A;  1M5Z A;  2R3Y A;  2JXO A;  1UM7 A;  2VZ5 A;  1Q3P A;  2D92 A;  3QJN A;  3MH7 A;  3CBX A;  3NCV A;  5HFE A;  1G9O A;  1N99 A;  2YUB A;  1KEF A;  1LCY A;  2O2T A;  3CS0 A;  1TQ3 A;  2OPG A;  3HVQ C;  2KOH A;  1TE0 A;  2AIN A;  2DLS A;  2R4H A;  2VSV A;  4NNL A;  5E22 A;  2M0T A;  1X5N A;  3I1E A;  2H2B A;  3E17 A;  2I0L A;  4NMR A;  5HF4 A;  1X5Q A;  3RL7 A;  3PDV A;  5G1E A;  2QKV A;  2UZC A;  1UHP A;  3HPK A;  3BPU A;  2WL7 A;  2JOA A;  1WFV A;  1D5G A;  3OU0 A;  2IWN A;  1UEP A;  3DOR A;  2IWO A;  2CSJ A;  1V5Q A;  2AWX A;  2DC2 A;  4Q2Q A;  3DJ3 A;  4HOP A;  2KYL A;  3ID1 A;  2QT5 A;  2I04 A;  5F3X A;  1UEQ A;  2KG2 A;  4YDP A;  1VJ6 A;  2FN5 A;  2DB5 A;  2L97 A;  1V1T A;  1KWA A;  3EGH C;  2KA9 A;  3PV4 A;  1QAV A;  3QDO A;  2PDZ A;  1TP5 A;  1N7T A;  2KRG A;  4XHV A;  2DM8 A;  2EV8 A;  5EZ0 A;  4REY A;  1RY4 A;  2ZPL A;  1GM1 A;  4NXQ A;  2DMZ A;  2KJD A;  3CYY A;  1WG6 A;  5ILB A;  2CS5 A;  4FLN A;  2QKT A;  3O5N A;  3DJ1 A;  1X5R A;  4NMV A;  4WYT A;  4Q6H A;  3RLE A;  5HED A;  1U38 A;  5EYZ A;  1WJL A;  1NTE A;  4YYX A;  4UU5 A;  2G5M B;  1UIT A;  1WI4 A;  3EGG C;  2FCF A;  4AMH A;  3GDV A;  1NF3 C;  4F8K A;  4Z33 A;  2HGA A;  1IHJ A;  2L4S A;  2V1W A;  1N6F A;  1OZI A;  1WF7 A;  3GCN A;  3QGL A;  1MC7 A;  1V6B A;  2EEH A;  1X9Z A;  1PDR A;  1UM1 A;  1W9Q A;  1X8S A;  5B42 A;  1Y7N A;  1R6J A;  1RGW A;  2D90 A;  4GHN A;  2DAZ A;  1IU2 A;  1I16 A;  1MFG A;  4H11 A;  3CBY A;  3NFK A;  2I0I A;  2OMJ A;  3GJ9 A;  2F5Y A;  2F0A A;  4UU6 A;  2OSG A;  1GQ4 A;  1N6D A;  2OCS A;  3MH6 A;  3B76 A;  5HEB A;  2OS6 A;  2KJP A;  5E11 A;  1FCF A;  3R69 A;  3QIK A;  4JOK A;  5HJ1 A;  4Q2P A;  3KZE A;  4NNM A;  2EGN A;  1FC6 A;  5FHT A;  1L6O A;  1U37 A;  2KAW A;  2HE2 A;  1YBO A;  4RI0 A;  1UFX A;  4GVD A;  4Q3H A;  3SUZ A;  4MPA A;  4NMT A;  5A2P A;  2JIK A;  4NXP A;  2EEI A;  2QG1 A;  4G69 A;  4Q6S A;  2DKR A;  2X7Z A;  1UEZ A;  2I6V A;  2RCZ A;  2EDZ A;  4KFW A;  2ENO A;  2GEF A;  1UJU A;  3OTP A;  2LUI A;  1X45 A;  4FGM A;  2PZD A;  2JRE A;  1UJD A;  3GDS A;  4O06 A;  3SHU A;  4Q2O A;  2VWR A;  3KDG A;  4JOE A;  2YT8 A;  3TSW A;  2ZPM A;  2OQS A;  3KDK A;  3SOE A;  1WHA A;  1ZUB A;  2EGK A;  2EDV A;  5DTH A;  2KQF A;  1QAV B;  2MX6 A;  4NMP A;  1KY9 A;  5FB8 C;  2M0U A;  1WFG A;  5GLJ A;  3O46 A;  3WKM A;  3ID2 A;  5E1Y A;  2K1Z A;  5HEY A;  2EAQ A;  2RRM A;  2M3M A;  2EGO A;  3PS4 A;  2H2C A;  2EHR A;  3GCO A;  1U3B A;  3DIW A;  4Q2N A;  1OBZ A;  3ZRT A;  4JJ0 A;  2H3M A;  3R68 A;  4K78 A;  5HFC A;  2M0V A;  1N7E A;  1V5L A;  1Z87 A;  3R0H A;  1FC7 A;  2KJK A;  5E21 A;  3DJA A;  3STJ A;  4EDJ A;  1TP3 A;  1QLC A;  2EDP A;  1OBX A;  1WIF A;  4WYU A;  4JOG A;  3MH4 A;  1B8Q A;  1GQ5 A;  3RL8 A;  4NXR A;  2OGP A;  2VRF A;  5HF1 A;  4P2A B;  2PKU A;  2Z17 A;  1P1E A;  2VSP A;  2EEG A;  1W9O A;  3GDU A;  3KHF A;  3GAB A;  1X6D A;  4E35 A;  2M10 A;  1UJV A;  2KBS A;  4K72 A;  1VCW A;  2P3W A;  3I4W A;  3K82 A;  1WH1 A;  4JOH A;  1OBY A;  2D8I A;  2JSN A;  3TSV A;  3ID4 A;  2EXG A;  1VB7 A;  5HFD A;  2LC6 A;  1Z86 A;  5IL9 A;  4Z8J A;  3TSZ A;  2CSS A;  3LNY A;  3HPM A;  4R2Z A;  2LC7 A;  4IC6 A;  2LA8 A;  2YUY A;  5GND A;  2KOM A;  2YTW A;  4E3B A;  4JJ3 A;  3SHW A;  2HE4 A;  3KZD A;  2IWQ A;  5D13 A;  5HET A;  1WF8 A;  3K50 A;  1QAU A;  1Y8T A;  3QJM A;  2YT7 A;  1RGR A;  1WHD A;  4LMM A;  3QO6 A;  5I7Z A;  3I18 A;  5F67 A;  3ID3 A;  1UF1 A;  2K20 A;  2IWP A;  4L8N A;  4OAJ A;  1T2M A;  3VQF A;  3PDZ A;  3JXT A;  4HOP B;  5HDY A;  2FE5 A;  2AWU A;  2KV8 A;  2W7R A;  3LNX A;  5G1D A;  3GGE A;  3L4F D;  2LOB A;  1MFL A;  4NMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...