2G2LA

Crystal structure of the second pdz domain of sap97 in complex with a glur-a c-terminal peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synapse-associated protein 97
publication title Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2g2lA00
3RL8A 5F3XA 4Q6SA 1N6EA 3O46A 1UJDA 2DKRA 1VA8A 4NMOA 1X5QA 2EV8A 4Z33A 2EEIA 1SOTA 2E7KA 1VCWA 1X6DA 2AWWA 2OSGA 2I0LA 1UEWA 2EDVA 2QKVA 3PV5A 3DJ1A 2H3MA 2Z9IA 2EXGA 1KEFA 4FGMA 1MC7A 5HFFA 2VZ5A 3GCNA 2I1NA 3OTPA 4MPAA 1N7EA 4NMSA 3DIWA 2M3MA 2PKUA 2YUYA 1UITA 2H2BA 4F8KA 2D8IA 5I7ZA 2KOHA 1IU0A 2HE4A 1PDRA 5HDYA 4JOHA 3ID2A 2D92A 1Z87A 4G69A 1GQ4A 2DC2A 2DJTA 3ID3A 4KFVA 5E21A 1FCFA 2I6VA 4E35A 3NFKA 5HEDA 1TQ3A 2HGAA 1WIFA 3PV2A 1WFGA 2JINA 4JORA 3TSZA 1K32A 5HFBA 3ID1A 3K50A 2K20A 3EGGC 2KA9A 4NNLA 2YTWA 1QLCA 1V62A 1Z86A 1OBXA 1TP3A 5HFEA 3CBZA 3BPUA 2KAWA 4HOPB 2CSSA 5HJ1A 2JREA 2ZPMA 1WF8A 2IWNA 3LNXA 2LC7A 3KHFA 1UJVA 4OEOA 2OGPA 2DAZA 2EGNA 4JOKA 2O2TA 1UHPA 1G9OA 2YT8A 3HPKA 4Q2QA 2F0AA 3EGHC 4EDJA 2Q3GA 1ZUBA 3R69A 3DJ3A 1XZ9A 2EDPA 4N6XA 1WJLA 2R3YA 2Q9VA 3FY5A 1N99A 2W4FA 3TMHA 5E22A 1P1DA 2K1ZA 2AWXA 1MFLA 2DLUA 2G5MB 2EGKA 4NXQA 5GNDA 1WFVA 3TSWA 2QBWA 4E34A 3CC0A 1N7FA 2BYGA 2IWPA 1W9EA 1BE9A 2EEJA 3GJ9A 2OMJA 3PS4A 1GM1A 4Q2OA 4Q3HA 3ZRTA 2GZVA 3GCOA 3KZEA 3ID4A 1RGRA 1LCYA 1UEPA 5HFDA 2EAQA 3JXTA 2PDZA 1VAEA 5E6PB 3TSVA 5HEBA 1GQ5A 1X5NA 2OPGA 3QJNA 3SHUA 1UJUA 1FC6A 1NTEA 3B76A 2DMZA 2FCFA 2QT5A 1TP5A 2M0ZA 4Q6HA 3DJAA 4K72A 4LMMA 4YDPA 2PNTA 1L6OA 3QO6A 1X5RA 4HOPA 2UZCA 5G1EA 4Q2NA 4NXPA 5EZ0A 1B8QA 2CS5A 2HE2A 2VRFA 4NNMA 4NMQA 1QAUA 2W7RA 4JL7A 3K1RA 5HF4A 4K78A 4AMHA 1N6DA 5E1YA 2M0TA 1RY4A 4H11A 4OEPA 2P3WA 3MH7A 2R4HA 4WYUA 2M0UA 3RLEA 2RCZA 4E3BA 1VJ6A 1WI4A 3I1EA 1Q7XA 1WG6A 1ZOKA 3AXAA 1WHAA 3PDZA 3GDUA 3L4FD 1WH1A 1P1EA 1RGWA 4P2AB 3DORA 5A2PA 3MH6A 2YUBA 3CYYA 5DTHA 3GDSA 1UF1A 2H2CA 1TE0A 2QKTA 4OAJA 4YYXA 2KL1A 3QGLA 2FNEA 2WL7A 3KZDA 3SHWA 3OU0A 2JOAA 1WHDA 2G2LA 2I0IA 3NFLA 1X45A 4Z8JA 2EDZA 3HVQC 2L4TA 2KJKA 2OZFA 1V5LA 1IU2A 4JOPA 3STJA 2PZDA 4JOEA 3R68A 2KV8A 1FC7A 2EJYA 4KFWA 3SFJA 2EGOA 2L97A 2VSVA 4NXRA 1SOZA 2V90A 2RRMA 2CSJA 2KPKA 3VQFA 3CH8A 2QKUA 1M5ZA 1Y8TA 1BFEA 1X8SA 5F67A 1IHJA 2JILA 1VB7A 4NMRA 1N7TA 3PDVA 4K75A 4UU6A 5HEYA 3QDOA 2KRGA 2DLSA 4JOFA 2AINA 2DB5A 2EHRA 2FE5A 2MHOA 3E17A 2I04A 2IWQA 1T2MA 3RL7A 1QAVB 3QE1A 2JWEA 1U37A 1MFGA 1U39A 2FN5A 4NMTA 4GHNA 1Q3OA 3MH4A 5JXBA 4Q2PA 2ENOA 4REYA 3GGEA 2KJDA 3PV4A 5G1DA 2KOMA 2KOJA 3I4WA 1N6FA 4XHVA 1NF3C 2V1WA 2OS6A 2LA8A 2KG2A 2Z17A 1V5QA 3HPMA 4NMPA 2KQFA 1D5GA 3QJMA 3SUZA 1U3BA 4RI0A 1RZXA 1UM1A 3R0HA 5FB8C 4UU5A 3GSLA 5B6LA 5D13A 2D90A 5E11A 2LC6A 4R2ZA 2KBSA 2X7ZA 2YT7A 2H3LA 1KY9A 1KWAA 2LUIA 4JOGA 1I16A 4GVCA 5GLJA 3CS0A 3K82A 1Y7NA 1WF7A 3WKMA 2EEHA 3O5NA 1OBZA 3SOEA 2L4SA 3CBXA 4K6YA 2VSPA 2VWRA 4PQWA 2KJPA 2I4SA 5H3JA 4O06A 1OBYA 4WYTA 3LNYA 1YBOA 2QG1A 3NGHA 5HETA 1UEQA 2OCSA 2VPHA 1WI2A 2OQSA 1Q3PA 2KYLA 1OZIA 4IC6A 2F5YA 5HFCA 2KPLA 5HF1A 4GVDA 3I18A 3GDVA 1UEZA 1QAVA 3WKLA 2M0VA 3QIKA 3CBYA 1U38A 1I92A 2EEGA 2REYA 2MX6A 4P0CA 1V1TA 2M10A 1V6BA 2JXOA 1W9QA 1R6JA 2AWUA 2PKTA 4JOJA 3VQGA 1W9OA 1UM7A 5FHTA 1FC9A 1UFXA 2IWOA 2LOBA 2ZPLA 2DM8A 4K76A 5EYZA 4NMVA 2PA1A 2JIKA 4L8NA
chains in the Genus database with same CATH superfamily
3RL8A 5F3XA 4Q6SA 1N6EA 3O46A 1UJDA 2DKRA 1VA8A 4NMOA 1X5QA 2EV8A 4Z33A 2EEIA 1SOTA 2E7KA 1VCWA 1X6DA 2AWWA 2OSGA 2I0LA 1UEWA 2EDVA 2QKVA 3PV5A 3DJ1A 2H3MA 2Z9IA 2EXGA 1KEFA 4FGMA 1MC7A 5HFFA 2VZ5A 3GCNA 2I1NA 3OTPA 4MPAA 1N7EA 4NMSA 3DIWA 2M3MA 2PKUA 2YUYA 1UITA 2H2BA 4F8KA 2D8IA 5I7ZA 2KOHA 1IU0A 2HE4A 1PDRA 5HDYA 4JOHA 3ID2A 2D92A 1Z87A 4G69A 1GQ4A 2DC2A 2DJTA 3ID3A 4KFVA 5E21A 1FCFA 2I6VA 4E35A 3NFKA 5HEDA 1TQ3A 2HGAA 1WIFA 3PV2A 1WFGA 2JSNA 2JINA 4JORA 3TSZA 1K32A 5HFBA 3ID1A 3K50A 2K20A 3EGGC 2KA9A 4NNLA 2YTWA 1QLCA 1V62A 1Z86A 1OBXA 1TP3A 5HFEA 3CBZA 3BPUA 2KAWA 4HOPB 2CSSA 5HJ1A 2JREA 2ZPMA 1WF8A 2IWNA 3LNXA 2LC7A 3KHFA 1UJVA 4OEOA 2OGPA 2DAZA 2EGNA 4JOKA 2O2TA 1UHPA 1G9OA 2YT8A 3HPKA 4Q2QA 2F0AA 3EGHC 4EDJA 2Q3GA 1ZUBA 3R69A 3DJ3A 5B42A 1XZ9A 2EDPA 5IL9A 4N6XA 1WJLA 2R3YA 2Q9VA 3FY5A 1N99A 2W4FA 3TMHA 5E22A 1P1DA 2K1ZA 2AWXA 1MFLA 2DLUA 2G5MB 2EGKA 4NXQA 5GNDA 1WFVA 3TSWA 2QBWA 4E34A 3CC0A 1N7FA 2BYGA 2IWPA 1W9EA 1BE9A 2EEJA 3GJ9A 2OMJA 3PS4A 1GM1A 4Q2OA 4Q3HA 3ZRTA 2GZVA 3GCOA 3KZEA 3ID4A 1RGRA 1LCYA 1UEPA 5HFDA 2EAQA 3JXTA 2PDZA 1VAEA 5E6PB 3TSVA 5HEBA 1GQ5A 1X5NA 2OPGA 3QJNA 3SHUA 1UJUA 1FC6A 1NTEA 3B76A 2DMZA 2FCFA 2QT5A 1TP5A 2M0ZA 4Q6HA 3DJAA 4K72A 4LMMA 4YDPA 2PNTA 1L6OA 3QO6A 1X5RA 4HOPA 2UZCA 5G1EA 4Q2NA 4NXPA 5EZ0A 1B8QA 2CS5A 2HE2A 2VRFA 4NNMA 4NMQA 1QAUA 2W7RA 4JL7A 3K1RA 5HF4A 4K78A 4AMHA 1N6DA 5E1YA 2M0TA 1RY4A 4H11A 4OEPA 3KDGA 2P3WA 3MH7A 2R4HA 4WYUA 2M0UA 3RLEA 2RCZA 4E3BA 1VJ6A 3GABA 1WI4A 3I1EA 1Q7XA 1WG6A 1ZOKA 3AXAA 1WHAA 3PDZA 3GDUA 3L4FD 1WH1A 1P1EA 1RGWA 4P2AB 3DORA 5A2PA 3MH6A 2YUBA 3CYYA 5DTHA 3GDSA 1UF1A 2H2CA 1TE0A 2QKTA 4OAJA 4JJ0A 4YYXA 2KL1A 3QGLA 2FNEA 2WL7A 3KZDA 3SHWA 3OU0A 2JOAA 1WHDA 2G2LA 2I0IA 3NFLA 1X45A 4Z8JA 2EDZA 3HVQC 2L4TA 2KJKA 2OZFA 1V5LA 1IU2A 4JOPA 3STJA 2PZDA 4JOEA 3R68A 2KV8A 1FC7A 2EJYA 4KFWA 3SFJA 2EGOA 2L97A 2VSVA 4NXRA 1SOZA 2V90A 2RRMA 2CSJA 2KPKA 3VQFA 3CH8A 2QKUA 1M5ZA 1Y8TA 1BFEA 1X8SA 5F67A 1IHJA 2JILA 1VB7A 4NMRA 1N7TA 3PDVA 4K75A 4UU6A 5HEYA 3QDOA 2KRGA 2DLSA 4JOFA 2AINA 2DB5A 2EHRA 2FE5A 2MHOA 3E17A 2I04A 2IWQA 1T2MA 3RL7A 1QAVB 3QE1A 2JWEA 1U37A 1MFGA 1U39A 2FN5A 4NMTA 4GHNA 1Q3OA 3MH4A 5JXBA 4Q2PA 2ENOA 4JJ3A 4REYA 3GGEA 2KJDA 3PV4A 5G1DA 2KOMA 2KOJA 3I4WA 1N6FA 4XHVA 1NF3C 2V1WA 2OS6A 2LA8A 2KG2A 3KDKA 2Z17A 1V5QA 3HPMA 4NMPA 2KQFA 1D5GA 3QJMA 3SUZA 1U3BA 2GEFA 4RI0A 1RZXA 1UM1A 3R0HA 5FB8C 4UU5A 3NCVA 3GSLA 5B6LA 5D13A 2D90A 5E11A 2LC6A 4R2ZA 2KBSA 2X7ZA 2YT7A 5ILBA 2H3LA 1KY9A 1KWAA 2LUIA 4JOGA 1I16A 4GVCA 5GLJA 3CS0A 3K82A 1Y7NA 1WF7A 3WKMA 2EEHA 3O5NA 1OBZA 3SOEA 2L4SA 3CBXA 4K6YA 2VSPA 2VWRA 4PQWA 2KJPA 2I4SA 5H3JA 4O06A 1OBYA 4WYTA 3LNYA 1YBOA 2QG1A 3NGHA 5HETA 1UEQA 2OCSA 2VPHA 1WI2A 2OQSA 1Q3PA 2KYLA 1OZIA 4IC6A 2F5YA 4FLNA 5HFCA 2KPLA 5HF1A 4GVDA 3I18A 3GDVA 1X9ZA 1UEZA 1QAVA 3WKLA 2M0VA 3QIKA 3CBYA 1U38A 1I92A 2EEGA 2REYA 2MX6A 4P0CA 1V1TA 2M10A 1V6BA 2JXOA 1W9QA 1R6JA 2AWUA 2PKTA 4JOJA 3VQGA 1W9OA 1UM7A 5FHTA 1FC9A 1UFXA 2IWOA 2LOBA 2ZPLA 2DM8A 4K76A 5EYZA 4NMVA 2PA1A 2JIKA 4L8NA
chains in the Genus database with same CATH topology
3RL8A 5F3XA 4Q6SA 1N6EA 3O46A 1UJDA 2DKRA 1VA8A 4NMOA 1X5QA 2EV8A 4Z33A 2EEIA 1SOTA 2E7KA 1VCWA 1X6DA 2AWWA 2OSGA 2I0LA 1UEWA 2EDVA 2QKVA 3PV5A 3DJ1A 2H3MA 2Z9IA 2EXGA 1KEFA 4FGMA 1MC7A 5HFFA 2VZ5A 3GCNA 2I1NA 3OTPA 4MPAA 1N7EA 4NMSA 3DIWA 2M3MA 2PKUA 2YUYA 1UITA 2H2BA 4F8KA 2D8IA 5I7ZA 2KOHA 1IU0A 2HE4A 1PDRA 5HDYA 4JOHA 3ID2A 2D92A 1Z87A 4G69A 1GQ4A 2DC2A 2DJTA 3ID3A 4KFVA 5E21A 1FCFA 2I6VA 4E35A 3NFKA 5HEDA 1TQ3A 2HGAA 1WIFA 3PV2A 1WFGA 2JSNA 2JINA 4JORA 3TSZA 1K32A 5HFBA 3ID1A 3K50A 2K20A 3EGGC 2KA9A 4NNLA 2YTWA 1QLCA 1V62A 1Z86A 1OBXA 1TP3A 5HFEA 3CBZA 3BPUA 2KAWA 4HOPB 2CSSA 5HJ1A 2JREA 2ZPMA 1WF8A 2IWNA 3LNXA 2LC7A 3KHFA 1UJVA 4OEOA 2OGPA 2DAZA 2EGNA 4JOKA 2O2TA 1UHPA 1G9OA 2YT8A 3HPKA 4Q2QA 2F0AA 3EGHC 4EDJA 2Q3GA 1ZUBA 3R69A 3DJ3A 5B42A 1XZ9A 2EDPA 5IL9A 4N6XA 1WJLA 2R3YA 2Q9VA 3FY5A 1N99A 2W4FA 3TMHA 5E22A 1P1DA 2K1ZA 2AWXA 1MFLA 2DLUA 2G5MB 2EGKA 4NXQA 5GNDA 1WFVA 3TSWA 2QBWA 4E34A 3CC0A 1N7FA 2BYGA 2IWPA 1W9EA 1BE9A 2EEJA 3GJ9A 2OMJA 3PS4A 1GM1A 4Q2OA 4Q3HA 3ZRTA 2GZVA 3GCOA 3KZEA 3ID4A 1RGRA 1LCYA 1UEPA 5HFDA 2EAQA 3JXTA 2PDZA 1VAEA 5E6PB 3TSVA 5HEBA 1GQ5A 1X5NA 2OPGA 3QJNA 3SHUA 1UJUA 1FC6A 1NTEA 3B76A 2DMZA 2FCFA 2QT5A 1TP5A 2M0ZA 4Q6HA 3DJAA 4K72A 4LMMA 4YDPA 2PNTA 1L6OA 3QO6A 1X5RA 4HOPA 2UZCA 5G1EA 4Q2NA 4NXPA 5EZ0A 1B8QA 2CS5A 2HE2A 2VRFA 4NNMA 4NMQA 1QAUA 2W7RA 4JL7A 3K1RA 5HF4A 4K78A 4AMHA 1N6DA 5E1YA 2M0TA 1RY4A 4H11A 4OEPA 3KDGA 2P3WA 3MH7A 2R4HA 4WYUA 2M0UA 3RLEA 2RCZA 4E3BA 1VJ6A 3GABA 1WI4A 3I1EA 1Q7XA 1WG6A 1ZOKA 3AXAA 1WHAA 3PDZA 3GDUA 3L4FD 1WH1A 1P1EA 1RGWA 4P2AB 3DORA 5A2PA 3MH6A 2YUBA 3CYYA 5DTHA 3GDSA 1UF1A 2H2CA 1TE0A 2QKTA 4OAJA 4JJ0A 4YYXA 2KL1A 3QGLA 2FNEA 2WL7A 3KZDA 3SHWA 3OU0A 2JOAA 1WHDA 2G2LA 2I0IA 3NFLA 1X45A 4Z8JA 2EDZA 3HVQC 2L4TA 2KJKA 2OZFA 1V5LA 1IU2A 4JOPA 3STJA 2PZDA 4JOEA 3R68A 2KV8A 1FC7A 2EJYA 4KFWA 3SFJA 2EGOA 2L97A 2VSVA 4NXRA 1SOZA 2V90A 2RRMA 2CSJA 2KPKA 3VQFA 3CH8A 2QKUA 1M5ZA 1Y8TA 1BFEA 1X8SA 5F67A 1IHJA 2JILA 1VB7A 4NMRA 1N7TA 3PDVA 4K75A 4UU6A 5HEYA 3QDOA 2KRGA 2DLSA 4JOFA 2AINA 2DB5A 2EHRA 2FE5A 2MHOA 3E17A 2I04A 2IWQA 1T2MA 3RL7A 1QAVB 3QE1A 2JWEA 1U37A 1MFGA 1U39A 2FN5A 4NMTA 4GHNA 1Q3OA 3MH4A 5JXBA 4Q2PA 2ENOA 4JJ3A 4REYA 3GGEA 2KJDA 3PV4A 5G1DA 2KOMA 2KOJA 3I4WA 1N6FA 4XHVA 1NF3C 2V1WA 2OS6A 2LA8A 2KG2A 3KDKA 2Z17A 1V5QA 3HPMA 4NMPA 2KQFA 1D5GA 3QJMA 3SUZA 1U3BA 2GEFA 4RI0A 1RZXA 1UM1A 3R0HA 5FB8C 4UU5A 3NCVA 3GSLA 5B6LA 5D13A 2D90A 5E11A 2LC6A 4R2ZA 2KBSA 2X7ZA 2YT7A 5ILBA 2H3LA 1KY9A 1KWAA 2LUIA 4JOGA 1I16A 4GVCA 5GLJA 3CS0A 3K82A 1Y7NA 1WF7A 3WKMA 2EEHA 3O5NA 1OBZA 3SOEA 2L4SA 3CBXA 4K6YA 2VSPA 2VWRA 4PQWA 2KJPA 2I4SA 5H3JA 4O06A 1OBYA 4WYTA 3LNYA 1YBOA 2QG1A 3NGHA 5HETA 1UEQA 2OCSA 2VPHA 1WI2A 2OQSA 1Q3PA 2KYLA 1OZIA 4IC6A 2F5YA 4FLNA 5HFCA 2KPLA 5HF1A 4GVDA 3I18A 3GDVA 1X9ZA 1UEZA 1QAVA 3WKLA 2M0VA 3QIKA 3CBYA 1U38A 1I92A 2EEGA 2REYA 2MX6A 4P0CA 1V1TA 2M10A 1V6BA 2JXOA 1W9QA 1R6JA 2AWUA 2PKTA 4JOJA 3VQGA 1W9OA 1UM7A 5FHTA 1FC9A 1UFXA 2IWOA 2LOBA 2ZPLA 2DM8A 4K76A 5EYZA 4NMVA 2PA1A 2JIKA 4L8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL8 A;  5F3X A;  4Q6S A;  1N6E A;  3O46 A;  1UJD A;  2DKR A;  1VA8 A;  4NMO A;  1X5Q A;  2EV8 A;  4Z33 A;  2EEI A;  1SOT A;  2E7K A;  1VCW A;  1X6D A;  2AWW A;  2OSG A;  2I0L A;  1UEW A;  2EDV A;  2QKV A;  3PV5 A;  3DJ1 A;  2H3M A;  2Z9I A;  2EXG A;  1KEF A;  4FGM A;  1MC7 A;  5HFF A;  2VZ5 A;  3GCN A;  2I1N A;  3OTP A;  4MPA A;  1N7E A;  4NMS A;  3DIW A;  2M3M A;  2PKU A;  2YUY A;  1UIT A;  2H2B A;  4F8K A;  2D8I A;  5I7Z A;  2KOH A;  1IU0 A;  2HE4 A;  1PDR A;  5HDY A;  4JOH A;  3ID2 A;  2D92 A;  1Z87 A;  4G69 A;  1GQ4 A;  2DC2 A;  2DJT A;  3ID3 A;  4KFV A;  5E21 A;  1FCF A;  2I6V A;  4E35 A;  3NFK A;  5HED A;  1TQ3 A;  2HGA A;  1WIF A;  3PV2 A;  1WFG A;  2JIN A;  4JOR A;  3TSZ A;  1K32 A;  5HFB A;  3ID1 A;  3K50 A;  2K20 A;  3EGG C;  2KA9 A;  4NNL A;  2YTW A;  1QLC A;  1V62 A;  1Z86 A;  1OBX A;  1TP3 A;  5HFE A;  3CBZ A;  3BPU A;  2KAW A;  4HOP B;  2CSS A;  5HJ1 A;  2JRE A;  2ZPM A;  1WF8 A;  2IWN A;  3LNX A;  2LC7 A;  3KHF A;  1UJV A;  4OEO A;  2OGP A;  2DAZ A;  2EGN A;  4JOK A;  2O2T A;  1UHP A;  1G9O A;  2YT8 A;  3HPK A;  4Q2Q A;  2F0A A;  3EGH C;  4EDJ A;  2Q3G A;  1ZUB A;  3R69 A;  3DJ3 A;  1XZ9 A;  2EDP A;  4N6X A;  1WJL A;  2R3Y A;  2Q9V A;  3FY5 A;  1N99 A;  2W4F A;  3TMH A;  5E22 A;  1P1D A;  2K1Z A;  2AWX A;  1MFL A;  2DLU A;  2G5M B;  2EGK A;  4NXQ A;  5GND A;  1WFV A;  3TSW A;  2QBW A;  4E34 A;  3CC0 A;  1N7F A;  2BYG A;  2IWP A;  1W9E A;  1BE9 A;  2EEJ A;  3GJ9 A;  2OMJ A;  3PS4 A;  1GM1 A;  4Q2O A;  4Q3H A;  3ZRT A;  2GZV A;  3GCO A;  3KZE A;  3ID4 A;  1RGR A;  1LCY A;  1UEP A;  5HFD A;  2EAQ A;  3JXT A;  2PDZ A;  1VAE A;  5E6P B;  3TSV A;  5HEB A;  1GQ5 A;  1X5N A;  2OPG A;  3QJN A;  3SHU A;  1UJU A;  1FC6 A;  1NTE A;  3B76 A;  2DMZ A;  2FCF A;  2QT5 A;  1TP5 A;  2M0Z A;  4Q6H A;  3DJA A;  4K72 A;  4LMM A;  4YDP A;  2PNT A;  1L6O A;  3QO6 A;  1X5R A;  4HOP A;  2UZC A;  5G1E A;  4Q2N A;  4NXP A;  5EZ0 A;  1B8Q A;  2CS5 A;  2HE2 A;  2VRF A;  4NNM A;  4NMQ A;  1QAU A;  2W7R A;  4JL7 A;  3K1R A;  5HF4 A;  4K78 A;  4AMH A;  1N6D A;  5E1Y A;  2M0T A;  1RY4 A;  4H11 A;  4OEP A;  2P3W A;  3MH7 A;  2R4H A;  4WYU A;  2M0U A;  3RLE A;  2RCZ A;  4E3B A;  1VJ6 A;  1WI4 A;  3I1E A;  1Q7X A;  1WG6 A;  1ZOK A;  3AXA A;  1WHA A;  3PDZ A;  3GDU A;  3L4F D;  1WH1 A;  1P1E A;  1RGW A;  4P2A B;  3DOR A;  5A2P A;  3MH6 A;  2YUB A;  3CYY A;  5DTH A;  3GDS A;  1UF1 A;  2H2C A;  1TE0 A;  2QKT A;  4OAJ A;  4YYX A;  2KL1 A;  3QGL A;  2FNE A;  2WL7 A;  3KZD A;  3SHW A;  3OU0 A;  2JOA A;  1WHD A;  2G2L A;  2I0I A;  3NFL A;  1X45 A;  4Z8J A;  2EDZ A;  3HVQ C;  2L4T A;  2KJK A;  2OZF A;  1V5L A;  1IU2 A;  4JOP A;  3STJ A;  2PZD A;  4JOE A;  3R68 A;  2KV8 A;  1FC7 A;  2EJY A;  4KFW A;  3SFJ A;  2EGO A;  2L97 A;  2VSV A;  4NXR A;  1SOZ A;  2V90 A;  2RRM A;  2CSJ A;  2KPK A;  3VQF A;  3CH8 A;  2QKU A;  1M5Z A;  1Y8T A;  1BFE A;  1X8S A;  5F67 A;  1IHJ A;  2JIL A;  1VB7 A;  4NMR A;  1N7T A;  3PDV A;  4K75 A;  4UU6 A;  5HEY A;  3QDO A;  2KRG A;  2DLS A;  4JOF A;  2AIN A;  2DB5 A;  2EHR A;  2FE5 A;  2MHO A;  3E17 A;  2I04 A;  2IWQ A;  1T2M A;  3RL7 A;  1QAV B;  3QE1 A;  2JWE A;  1U37 A;  1MFG A;  1U39 A;  2FN5 A;  4NMT A;  4GHN A;  1Q3O A;  3MH4 A;  5JXB A;  4Q2P A;  2ENO A;  4REY A;  3GGE A;  2KJD A;  3PV4 A;  5G1D A;  2KOM A;  2KOJ A;  3I4W A;  1N6F A;  4XHV A;  1NF3 C;  2V1W A;  2OS6 A;  2LA8 A;  2KG2 A;  2Z17 A;  1V5Q A;  3HPM A;  4NMP A;  2KQF A;  1D5G A;  3QJM A;  3SUZ A;  1U3B A;  4RI0 A;  1RZX A;  1UM1 A;  3R0H A;  5FB8 C;  4UU5 A;  3GSL A;  5B6L A;  5D13 A;  2D90 A;  5E11 A;  2LC6 A;  4R2Z A;  2KBS A;  2X7Z A;  2YT7 A;  2H3L A;  1KY9 A;  1KWA A;  2LUI A;  4JOG A;  1I16 A;  4GVC A;  5GLJ A;  3CS0 A;  3K82 A;  1Y7N A;  1WF7 A;  3WKM A;  2EEH A;  3O5N A;  1OBZ A;  3SOE A;  2L4S A;  3CBX A;  4K6Y A;  2VSP A;  2VWR A;  4PQW A;  2KJP A;  2I4S A;  5H3J A;  4O06 A;  1OBY A;  4WYT A;  3LNY A;  1YBO A;  2QG1 A;  3NGH A;  5HET A;  1UEQ A;  2OCS A;  2VPH A;  1WI2 A;  2OQS A;  1Q3P A;  2KYL A;  1OZI A;  4IC6 A;  2F5Y A;  5HFC A;  2KPL A;  5HF1 A;  4GVD A;  3I18 A;  3GDV A;  1UEZ A;  1QAV A;  3WKL A;  2M0V A;  3QIK A;  3CBY A;  1U38 A;  1I92 A;  2EEG A;  2REY A;  2MX6 A;  4P0C A;  1V1T A;  2M10 A;  1V6B A;  2JXO A;  1W9Q A;  1R6J A;  2AWU A;  2PKT A;  4JOJ A;  3VQG A;  1W9O A;  1UM7 A;  5FHT A;  1FC9 A;  1UFX A;  2IWO A;  2LOB A;  2ZPL A;  2DM8 A;  4K76 A;  5EYZ A;  4NMV A;  2PA1 A;  2JIK A;  4L8N A; 
#chains in the Genus database with same CATH topology
 3RL8 A;  5F3X A;  4Q6S A;  1N6E A;  3O46 A;  1UJD A;  2DKR A;  1VA8 A;  4NMO A;  1X5Q A;  2EV8 A;  4Z33 A;  2EEI A;  1SOT A;  2E7K A;  1VCW A;  1X6D A;  2AWW A;  2OSG A;  2I0L A;  1UEW A;  2EDV A;  2QKV A;  3PV5 A;  3DJ1 A;  2H3M A;  2Z9I A;  2EXG A;  1KEF A;  4FGM A;  1MC7 A;  5HFF A;  2VZ5 A;  3GCN A;  2I1N A;  3OTP A;  4MPA A;  1N7E A;  4NMS A;  3DIW A;  2M3M A;  2PKU A;  2YUY A;  1UIT A;  2H2B A;  4F8K A;  2D8I A;  5I7Z A;  2KOH A;  1IU0 A;  2HE4 A;  1PDR A;  5HDY A;  4JOH A;  3ID2 A;  2D92 A;  1Z87 A;  4G69 A;  1GQ4 A;  2DC2 A;  2DJT A;  3ID3 A;  4KFV A;  5E21 A;  1FCF A;  2I6V A;  4E35 A;  3NFK A;  5HED A;  1TQ3 A;  2HGA A;  1WIF A;  3PV2 A;  1WFG A;  2JSN A;  2JIN A;  4JOR A;  3TSZ A;  1K32 A;  5HFB A;  3ID1 A;  3K50 A;  2K20 A;  3EGG C;  2KA9 A;  4NNL A;  2YTW A;  1QLC A;  1V62 A;  1Z86 A;  1OBX A;  1TP3 A;  5HFE A;  3CBZ A;  3BPU A;  2KAW A;  4HOP B;  2CSS A;  5HJ1 A;  2JRE A;  2ZPM A;  1WF8 A;  2IWN A;  3LNX A;  2LC7 A;  3KHF A;  1UJV A;  4OEO A;  2OGP A;  2DAZ A;  2EGN A;  4JOK A;  2O2T A;  1UHP A;  1G9O A;  2YT8 A;  3HPK A;  4Q2Q A;  2F0A A;  3EGH C;  4EDJ A;  2Q3G A;  1ZUB A;  3R69 A;  3DJ3 A;  5B42 A;  1XZ9 A;  2EDP A;  5IL9 A;  4N6X A;  1WJL A;  2R3Y A;  2Q9V A;  3FY5 A;  1N99 A;  2W4F A;  3TMH A;  5E22 A;  1P1D A;  2K1Z A;  2AWX A;  1MFL A;  2DLU A;  2G5M B;  2EGK A;  4NXQ A;  5GND A;  1WFV A;  3TSW A;  2QBW A;  4E34 A;  3CC0 A;  1N7F A;  2BYG A;  2IWP A;  1W9E A;  1BE9 A;  2EEJ A;  3GJ9 A;  2OMJ A;  3PS4 A;  1GM1 A;  4Q2O A;  4Q3H A;  3ZRT A;  2GZV A;  3GCO A;  3KZE A;  3ID4 A;  1RGR A;  1LCY A;  1UEP A;  5HFD A;  2EAQ A;  3JXT A;  2PDZ A;  1VAE A;  5E6P B;  3TSV A;  5HEB A;  1GQ5 A;  1X5N A;  2OPG A;  3QJN A;  3SHU A;  1UJU A;  1FC6 A;  1NTE A;  3B76 A;  2DMZ A;  2FCF A;  2QT5 A;  1TP5 A;  2M0Z A;  4Q6H A;  3DJA A;  4K72 A;  4LMM A;  4YDP A;  2PNT A;  1L6O A;  3QO6 A;  1X5R A;  4HOP A;  2UZC A;  5G1E A;  4Q2N A;  4NXP A;  5EZ0 A;  1B8Q A;  2CS5 A;  2HE2 A;  2VRF A;  4NNM A;  4NMQ A;  1QAU A;  2W7R A;  4JL7 A;  3K1R A;  5HF4 A;  4K78 A;  4AMH A;  1N6D A;  5E1Y A;  2M0T A;  1RY4 A;  4H11 A;  4OEP A;  3KDG A;  2P3W A;  3MH7 A;  2R4H A;  4WYU A;  2M0U A;  3RLE A;  2RCZ A;  4E3B A;  1VJ6 A;  3GAB A;  1WI4 A;  3I1E A;  1Q7X A;  1WG6 A;  1ZOK A;  3AXA A;  1WHA A;  3PDZ A;  3GDU A;  3L4F D;  1WH1 A;  1P1E A;  1RGW A;  4P2A B;  3DOR A;  5A2P A;  3MH6 A;  2YUB A;  3CYY A;  5DTH A;  3GDS A;  1UF1 A;  2H2C A;  1TE0 A;  2QKT A;  4OAJ A;  4JJ0 A;  4YYX A;  2KL1 A;  3QGL A;  2FNE A;  2WL7 A;  3KZD A;  3SHW A;  3OU0 A;  2JOA A;  1WHD A;  2G2L A;  2I0I A;  3NFL A;  1X45 A;  4Z8J A;  2EDZ A;  3HVQ C;  2L4T A;  2KJK A;  2OZF A;  1V5L A;  1IU2 A;  4JOP A;  3STJ A;  2PZD A;  4JOE A;  3R68 A;  2KV8 A;  1FC7 A;  2EJY A;  4KFW A;  3SFJ A;  2EGO A;  2L97 A;  2VSV A;  4NXR A;  1SOZ A;  2V90 A;  2RRM A;  2CSJ A;  2KPK A;  3VQF A;  3CH8 A;  2QKU A;  1M5Z A;  1Y8T A;  1BFE A;  1X8S A;  5F67 A;  1IHJ A;  2JIL A;  1VB7 A;  4NMR A;  1N7T A;  3PDV A;  4K75 A;  4UU6 A;  5HEY A;  3QDO A;  2KRG A;  2DLS A;  4JOF A;  2AIN A;  2DB5 A;  2EHR A;  2FE5 A;  2MHO A;  3E17 A;  2I04 A;  2IWQ A;  1T2M A;  3RL7 A;  1QAV B;  3QE1 A;  2JWE A;  1U37 A;  1MFG A;  1U39 A;  2FN5 A;  4NMT A;  4GHN A;  1Q3O A;  3MH4 A;  5JXB A;  4Q2P A;  2ENO A;  4JJ3 A;  4REY A;  3GGE A;  2KJD A;  3PV4 A;  5G1D A;  2KOM A;  2KOJ A;  3I4W A;  1N6F A;  4XHV A;  1NF3 C;  2V1W A;  2OS6 A;  2LA8 A;  2KG2 A;  3KDK A;  2Z17 A;  1V5Q A;  3HPM A;  4NMP A;  2KQF A;  1D5G A;  3QJM A;  3SUZ A;  1U3B A;  2GEF A;  4RI0 A;  1RZX A;  1UM1 A;  3R0H A;  5FB8 C;  4UU5 A;  3NCV A;  3GSL A;  5B6L A;  5D13 A;  2D90 A;  5E11 A;  2LC6 A;  4R2Z A;  2KBS A;  2X7Z A;  2YT7 A;  5ILB A;  2H3L A;  1KY9 A;  1KWA A;  2LUI A;  4JOG A;  1I16 A;  4GVC A;  5GLJ A;  3CS0 A;  3K82 A;  1Y7N A;  1WF7 A;  3WKM A;  2EEH A;  3O5N A;  1OBZ A;  3SOE A;  2L4S A;  3CBX A;  4K6Y A;  2VSP A;  2VWR A;  4PQW A;  2KJP A;  2I4S A;  5H3J A;  4O06 A;  1OBY A;  4WYT A;  3LNY A;  1YBO A;  2QG1 A;  3NGH A;  5HET A;  1UEQ A;  2OCS A;  2VPH A;  1WI2 A;  2OQS A;  1Q3P A;  2KYL A;  1OZI A;  4IC6 A;  2F5Y A;  4FLN A;  5HFC A;  2KPL A;  5HF1 A;  4GVD A;  3I18 A;  3GDV A;  1X9Z A;  1UEZ A;  1QAV A;  3WKL A;  2M0V A;  3QIK A;  3CBY A;  1U38 A;  1I92 A;  2EEG A;  2REY A;  2MX6 A;  4P0C A;  1V1T A;  2M10 A;  1V6B A;  2JXO A;  1W9Q A;  1R6J A;  2AWU A;  2PKT A;  4JOJ A;  3VQG A;  1W9O A;  1UM7 A;  5FHT A;  1FC9 A;  1UFX A;  2IWO A;  2LOB A;  2ZPL A;  2DM8 A;  4K76 A;  5EYZ A;  4NMV A;  2PA1 A;  2JIK A;  4L8N A; 
#chains in the Genus database with same CATH homology
 3RL8 A;  5F3X A;  4Q6S A;  1N6E A;  3O46 A;  1UJD A;  2DKR A;  1VA8 A;  4NMO A;  1X5Q A;  2EV8 A;  4Z33 A;  2EEI A;  1SOT A;  2E7K A;  1VCW A;  1X6D A;  2AWW A;  2OSG A;  2I0L A;  1UEW A;  2EDV A;  2QKV A;  3PV5 A;  3DJ1 A;  2H3M A;  2Z9I A;  2EXG A;  1KEF A;  4FGM A;  1MC7 A;  5HFF A;  2VZ5 A;  3GCN A;  2I1N A;  3OTP A;  4MPA A;  1N7E A;  4NMS A;  3DIW A;  2M3M A;  2PKU A;  2YUY A;  1UIT A;  2H2B A;  4F8K A;  2D8I A;  5I7Z A;  2KOH A;  1IU0 A;  2HE4 A;  1PDR A;  5HDY A;  4JOH A;  3ID2 A;  2D92 A;  1Z87 A;  4G69 A;  1GQ4 A;  2DC2 A;  2DJT A;  3ID3 A;  4KFV A;  5E21 A;  1FCF A;  2I6V A;  4E35 A;  3NFK A;  5HED A;  1TQ3 A;  2HGA A;  1WIF A;  3PV2 A;  1WFG A;  2JSN A;  2JIN A;  4JOR A;  3TSZ A;  1K32 A;  5HFB A;  3ID1 A;  3K50 A;  2K20 A;  3EGG C;  2KA9 A;  4NNL A;  2YTW A;  1QLC A;  1V62 A;  1Z86 A;  1OBX A;  1TP3 A;  5HFE A;  3CBZ A;  3BPU A;  2KAW A;  4HOP B;  2CSS A;  5HJ1 A;  2JRE A;  2ZPM A;  1WF8 A;  2IWN A;  3LNX A;  2LC7 A;  3KHF A;  1UJV A;  4OEO A;  2OGP A;  2DAZ A;  2EGN A;  4JOK A;  2O2T A;  1UHP A;  1G9O A;  2YT8 A;  3HPK A;  4Q2Q A;  2F0A A;  3EGH C;  4EDJ A;  2Q3G A;  1ZUB A;  3R69 A;  3DJ3 A;  5B42 A;  1XZ9 A;  2EDP A;  5IL9 A;  4N6X A;  1WJL A;  2R3Y A;  2Q9V A;  3FY5 A;  1N99 A;  2W4F A;  3TMH A;  5E22 A;  1P1D A;  2K1Z A;  2AWX A;  1MFL A;  2DLU A;  2G5M B;  2EGK A;  4NXQ A;  5GND A;  1WFV A;  3TSW A;  2QBW A;  4E34 A;  3CC0 A;  1N7F A;  2BYG A;  2IWP A;  1W9E A;  1BE9 A;  2EEJ A;  3GJ9 A;  2OMJ A;  3PS4 A;  1GM1 A;  4Q2O A;  4Q3H A;  3ZRT A;  2GZV A;  3GCO A;  3KZE A;  3ID4 A;  1RGR A;  1LCY A;  1UEP A;  5HFD A;  2EAQ A;  3JXT A;  2PDZ A;  1VAE A;  5E6P B;  3TSV A;  5HEB A;  1GQ5 A;  1X5N A;  2OPG A;  3QJN A;  3SHU A;  1UJU A;  1FC6 A;  1NTE A;  3B76 A;  2DMZ A;  2FCF A;  2QT5 A;  1TP5 A;  2M0Z A;  4Q6H A;  3DJA A;  4K72 A;  4LMM A;  4YDP A;  2PNT A;  1L6O A;  3QO6 A;  1X5R A;  4HOP A;  2UZC A;  5G1E A;  4Q2N A;  4NXP A;  5EZ0 A;  1B8Q A;  2CS5 A;  2HE2 A;  2VRF A;  4NNM A;  4NMQ A;  1QAU A;  2W7R A;  4JL7 A;  3K1R A;  5HF4 A;  4K78 A;  4AMH A;  1N6D A;  5E1Y A;  2M0T A;  1RY4 A;  4H11 A;  4OEP A;  3KDG A;  2P3W A;  3MH7 A;  2R4H A;  4WYU A;  2M0U A;  3RLE A;  2RCZ A;  4E3B A;  1VJ6 A;  3GAB A;  1WI4 A;  3I1E A;  1Q7X A;  1WG6 A;  1ZOK A;  3AXA A;  1WHA A;  3PDZ A;  3GDU A;  3L4F D;  1WH1 A;  1P1E A;  1RGW A;  4P2A B;  3DOR A;  5A2P A;  3MH6 A;  2YUB A;  3CYY A;  5DTH A;  3GDS A;  1UF1 A;  2H2C A;  1TE0 A;  2QKT A;  4OAJ A;  4JJ0 A;  4YYX A;  2KL1 A;  3QGL A;  2FNE A;  2WL7 A;  3KZD A;  3SHW A;  3OU0 A;  2JOA A;  1WHD A;  2G2L A;  2I0I A;  3NFL A;  1X45 A;  4Z8J A;  2EDZ A;  3HVQ C;  2L4T A;  2KJK A;  2OZF A;  1V5L A;  1IU2 A;  4JOP A;  3STJ A;  2PZD A;  4JOE A;  3R68 A;  2KV8 A;  1FC7 A;  2EJY A;  4KFW A;  3SFJ A;  2EGO A;  2L97 A;  2VSV A;  4NXR A;  1SOZ A;  2V90 A;  2RRM A;  2CSJ A;  2KPK A;  3VQF A;  3CH8 A;  2QKU A;  1M5Z A;  1Y8T A;  1BFE A;  1X8S A;  5F67 A;  1IHJ A;  2JIL A;  1VB7 A;  4NMR A;  1N7T A;  3PDV A;  4K75 A;  4UU6 A;  5HEY A;  3QDO A;  2KRG A;  2DLS A;  4JOF A;  2AIN A;  2DB5 A;  2EHR A;  2FE5 A;  2MHO A;  3E17 A;  2I04 A;  2IWQ A;  1T2M A;  3RL7 A;  1QAV B;  3QE1 A;  2JWE A;  1U37 A;  1MFG A;  1U39 A;  2FN5 A;  4NMT A;  4GHN A;  1Q3O A;  3MH4 A;  5JXB A;  4Q2P A;  2ENO A;  4JJ3 A;  4REY A;  3GGE A;  2KJD A;  3PV4 A;  5G1D A;  2KOM A;  2KOJ A;  3I4W A;  1N6F A;  4XHV A;  1NF3 C;  2V1W A;  2OS6 A;  2LA8 A;  2KG2 A;  3KDK A;  2Z17 A;  1V5Q A;  3HPM A;  4NMP A;  2KQF A;  1D5G A;  3QJM A;  3SUZ A;  1U3B A;  2GEF A;  4RI0 A;  1RZX A;  1UM1 A;  3R0H A;  5FB8 C;  4UU5 A;  3NCV A;  3GSL A;  5B6L A;  5D13 A;  2D90 A;  5E11 A;  2LC6 A;  4R2Z A;  2KBS A;  2X7Z A;  2YT7 A;  5ILB A;  2H3L A;  1KY9 A;  1KWA A;  2LUI A;  4JOG A;  1I16 A;  4GVC A;  5GLJ A;  3CS0 A;  3K82 A;  1Y7N A;  1WF7 A;  3WKM A;  2EEH A;  3O5N A;  1OBZ A;  3SOE A;  2L4S A;  3CBX A;  4K6Y A;  2VSP A;  2VWR A;  4PQW A;  2KJP A;  2I4S A;  5H3J A;  4O06 A;  1OBY A;  4WYT A;  3LNY A;  1YBO A;  2QG1 A;  3NGH A;  5HET A;  1UEQ A;  2OCS A;  2VPH A;  1WI2 A;  2OQS A;  1Q3P A;  2KYL A;  1OZI A;  4IC6 A;  2F5Y A;  4FLN A;  5HFC A;  2KPL A;  5HF1 A;  4GVD A;  3I18 A;  3GDV A;  1X9Z A;  1UEZ A;  1QAV A;  3WKL A;  2M0V A;  3QIK A;  3CBY A;  1U38 A;  1I92 A;  2EEG A;  2REY A;  2MX6 A;  4P0C A;  1V1T A;  2M10 A;  1V6B A;  2JXO A;  1W9Q A;  1R6J A;  2AWU A;  2PKT A;  4JOJ A;  3VQG A;  1W9O A;  1UM7 A;  5FHT A;  1FC9 A;  1UFX A;  2IWO A;  2LOB A;  2ZPL A;  2DM8 A;  4K76 A;  5EYZ A;  4NMV A;  2PA1 A;  2JIK A;  4L8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...