2I1NA

Crystal structure of the 1st pdz domain of human dlg3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPEETSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Discs, large homolog 3
publication title Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i1nA00
2QG1A 1OBXA 2L4SA 3I4WA 4GHNA 4Q6HA 1K32A 4JOEA 1XZ9A 2O2TA 2JXOA 3O46A 4Q2QA 1OZIA 1P1DA 1QAUA 1M5ZA 1Z86A 1N6EA 1VA8A 1FC6A 3GDSA 5GLJA 2LA8A 3MH6A 3QDOA 4KFVA 1RGRA 2IWOA 5H3JA 3EGHC 5JXBA 2OZFA 1UJUA 4E3BA 4JOJA 2Q9VA 2EEHA 1Y7NA 2KPKA 1YBOA 1FCFA 2EJYA 2JREA 5E11A 3QO6A 1U37A 1NF3C 1Q7XA 4GVDA 4JL7A 1WI4A 4K75A 5FB8C 1WHDA 3SUZA 2L4TA 3ID4A 2OS6A 1VJ6A 2EGKA 3KZDA 4NXRA 3GGEA 4JOFA 2R4HA 2KOJA 4PQWA 3VQGA 2CSSA 2JOAA 2D90A 2VZ5A 3OU0A 4NMTA 2JWEA 1UITA 2RCZA 2KOMA 1TP3A 2EV8A 3WKMA 1G9OA 3GDUA 1NTEA 1RGWA 4REYA 3MH4A 3R0HA 1WFVA 2WL7A 2IWQA 3GSLA 4NXPA 1UJDA 2KRGA 4UU5A 4G69A 2EEIA 2VSPA 2G5MB 3WKLA 3TSZA 4P0CA 3K1RA 4IC6A 1KY9A 2EDVA 1GQ4A 1RY4A 3BPUA 4K76A 2EAQA 1X5NA 1WFGA 5D13A 1UM1A 1ZUBA 4WYTA 2M3MA 3HPMA 2H2CA 1N99A 2IWPA 1I92A 2PKUA 4Z8JA 3CBYA 1I16A 4OAJA 3MH7A 5HF1A 3PS4A 2KPLA 2V1WA 2DLUA 1V6BA 2DKRA 2EDPA 2I04A 4E34A 1X5RA 1WH1A 3HPKA 4NMSA 5HEDA 5EYZA 5F67A 2G2LA 5HFFA 2CS5A 2LC6A 3ZRTA 2MX6A 2KL1A 2FCFA 4FGMA 1UF1A 4RI0A 4Q2OA 1D5GA 4Q2NA 2OSGA 1LCYA 1X6DA 1UHPA 2KJKA 5G1DA 5GNDA 3GCNA 1B8QA 5DTHA 3RLEA 1X45A 2ENOA 3ID2A 3SHUA 3B76A 5HDYA 3R69A 4LMMA 2HE2A 1X5QA 3CH8A 1FC9A 5HFDA 2FNEA 2AWWA 1UEWA 3R68A 3JXTA 2DMZA 5FHTA 1ZOKA 2D8IA 2CSJA 2KBSA 3PV4A 3I18A 3LNXA 3CBZA 5HEYA 2KA9A 2ZPLA 4R2ZA 1Q3OA 1UM7A 2QT5A 1W9OA 4JOKA 1OBYA 1Y8TA 2M0TA 2BYGA 2YUBA 2YUYA 3ID1A 2DLSA 5HFCA 2F0AA 4P2AB 1VCWA 4NMQA 4HOPA 3AXAA 5HEBA 4O06A 2YT8A 1QLCA 2OCSA 1W9EA 2AINA 2H2BA 4XHVA 2I0LA 3KZEA 4EDJA 1MFGA 2M0UA 2OMJA 1IU0A 2LUIA 2LC7A 4NNLA 4WYUA 3STJA 1WG6A 1WF7A 1V62A 2VRFA 3CBXA 1WIFA 1GM1A 3QIKA 5G1EA 2EEJA 2QKTA 2I4SA 3PDZA 3SOEA 5HFBA 1N7FA 1SOZA 1Q3PA 2FE5A 2KYLA 2RRMA 2I0IA 3DIWA 2IWNA 2K1ZA 4OEOA 2FN5A 4L8NA 2W4FA 5HF4A 2ZPMA 4H11A 4Q2PA 2AWUA 2EGNA 4K6YA 1V5LA 5EZ0A 1TQ3A 1BFEA 1V5QA 1P1EA 2UZCA 2YT7A 4JOGA 3DJ1A 3NGHA 3CC0A 2DM8A 3PV2A 4K78A 1IU2A 1N7EA 1QAVA 3CYYA 5HETA 3O5NA 3GDVA 2X7ZA 1R6JA 3KHFA 1PDRA 1WHAA 1V1TA 3QGLA 2JIKA 2QKVA 2VSVA 1TE0A 3DORA 1WJLA 2OPGA 3GJ9A 4NMRA 2E7KA 2EHRA 1Z87A 3TSVA 2HE4A 2KJDA 3QJNA 1N7TA 4AMHA 1WI2A 1QAVB 2JILA 5A2PA 3E17A 3ID3A 1U38A 2P3WA 1U39A 2H3LA 4UU6A 2PA1A 1MFLA 2M10A 4JOPA 2M0ZA 3NFLA 2JINA 2PZDA 4Q6SA 2REYA 1N6DA 4GVCA 3SFJA 4OEPA 3DJAA 3CS0A 2EDZA 2DJTA 3PDVA 5E6PB 2PDZA 2D92A 2QKUA 2F5YA 3EGGC 3RL7A 2EXGA 1U3BA 1L6OA 1UJVA 2LOBA 2I1NA 4YDPA 2KOHA 2Q3GA 2KAWA 2DB5A 2OQSA 2YTWA 1KEFA 1VAEA 5E22A 4JORA 2H3MA 1UEQA 2L97A 2DC2A 4KFWA 2HGAA 3GCOA 1OBZA 2DAZA 2I6VA 2K20A 4MPAA 2KQFA 3L4FD 3QE1A 1GQ5A 3QJMA 4NNMA 1BE9A 4Z33A 1RZXA 2V90A 3I1EA 4HOPB 5I7ZA 1W9QA 2PKTA 3HVQC 4JOHA 4E35A 3VQFA 3LNYA 2KJPA 1N6FA 5F3XA 2KV8A 2GZVA 4YYXA 3PV5A 3NFKA 2EGOA 4NMVA 3RL8A 1UEZA 1KWAA 5HJ1A 1WF8A 2PNTA 3SHWA 3FY5A 2Z17A 2M0VA 4K72A 1IHJA 2OGPA 1VB7A 2QBWA 2Z9IA 1MC7A 1UFXA 1X8SA 2AWXA 2EEGA 3TMHA 5HFEA 3K50A 4NXQA 1SOTA 3K82A 2W7RA 5B6LA 1T2MA 3TSWA 5E1YA 4NMOA 2VPHA 1TP5A 1UEPA 2VWRA 4N6XA 4Q3HA 5E21A 1FC7A 4NMPA 3OTPA 2KG2A 2MHOA 4F8KA 3DJ3A 2R3YA
chains in the Genus database with same CATH superfamily
2QG1A 1OBXA 2L4SA 3I4WA 4GHNA 4Q6HA 1K32A 4JOEA 1XZ9A 2O2TA 2JXOA 3O46A 4Q2QA 1OZIA 1P1DA 1QAUA 1M5ZA 1Z86A 1N6EA 1VA8A 1FC6A 3GDSA 5GLJA 2LA8A 3MH6A 3QDOA 4KFVA 1RGRA 2IWOA 5H3JA 1X9ZA 3EGHC 5JXBA 2OZFA 4JJ0A 1UJUA 4E3BA 4JOJA 2Q9VA 2EEHA 1Y7NA 2KPKA 1YBOA 1FCFA 2EJYA 2JREA 5E11A 3QO6A 1U37A 1NF3C 1Q7XA 4GVDA 4JL7A 1WI4A 4K75A 5FB8C 1WHDA 3SUZA 2L4TA 3ID4A 2OS6A 1VJ6A 2EGKA 3KZDA 4NXRA 2GEFA 3GGEA 4JOFA 2R4HA 2KOJA 4PQWA 3VQGA 2CSSA 2JOAA 2D90A 2VZ5A 3OU0A 4NMTA 2JWEA 1UITA 2RCZA 2KOMA 1TP3A 2EV8A 3WKMA 1G9OA 3GDUA 4FLNA 1NTEA 1RGWA 4REYA 3MH4A 3R0HA 1WFVA 2WL7A 2IWQA 3GSLA 4NXPA 1UJDA 2KRGA 4UU5A 4G69A 2EEIA 2VSPA 2G5MB 3WKLA 3TSZA 4P0CA 3K1RA 4IC6A 1KY9A 2EDVA 1GQ4A 1RY4A 3BPUA 4K76A 2EAQA 1X5NA 5ILBA 1WFGA 5D13A 1UM1A 1ZUBA 4WYTA 2M3MA 3HPMA 2H2CA 1N99A 2IWPA 1I92A 2PKUA 4Z8JA 3CBYA 1I16A 4OAJA 3MH7A 5HF1A 3PS4A 2KPLA 2V1WA 2DLUA 1V6BA 2DKRA 2EDPA 2I04A 4E34A 1X5RA 1WH1A 3HPKA 4NMSA 5HEDA 5EYZA 5F67A 2G2LA 5HFFA 2CS5A 2LC6A 3ZRTA 2MX6A 2KL1A 2FCFA 4FGMA 1UF1A 4RI0A 4Q2OA 1D5GA 4Q2NA 2OSGA 1LCYA 1X6DA 1UHPA 2KJKA 5G1DA 5GNDA 3GCNA 1B8QA 5DTHA 3RLEA 1X45A 2ENOA 3ID2A 3SHUA 5IL9A 3B76A 5HDYA 3R69A 4LMMA 2HE2A 1X5QA 3CH8A 1FC9A 5HFDA 2FNEA 2AWWA 1UEWA 3R68A 3JXTA 2DMZA 5FHTA 1ZOKA 2D8IA 2CSJA 2KBSA 3PV4A 3I18A 3LNXA 3CBZA 5HEYA 2KA9A 2ZPLA 4R2ZA 1Q3OA 1UM7A 2QT5A 1W9OA 4JOKA 1OBYA 1Y8TA 2M0TA 5B42A 2BYGA 2YUBA 2YUYA 3ID1A 2JSNA 2DLSA 5HFCA 2F0AA 4P2AB 1VCWA 4NMQA 4HOPA 3AXAA 5HEBA 4O06A 2YT8A 1QLCA 2OCSA 1W9EA 2AINA 2H2BA 4XHVA 2I0LA 3KZEA 4EDJA 1MFGA 2M0UA 2OMJA 1IU0A 2LUIA 2LC7A 4NNLA 4WYUA 3STJA 1WG6A 1WF7A 1V62A 2VRFA 3CBXA 1WIFA 1GM1A 3QIKA 5G1EA 2EEJA 2QKTA 2I4SA 3PDZA 3SOEA 5HFBA 1N7FA 1SOZA 1Q3PA 2FE5A 2KYLA 2RRMA 2I0IA 3DIWA 3KDKA 2IWNA 2K1ZA 4OEOA 2FN5A 4L8NA 2W4FA 5HF4A 2ZPMA 4H11A 3NCVA 4Q2PA 2AWUA 2EGNA 4K6YA 1V5LA 5EZ0A 1TQ3A 1BFEA 1V5QA 1P1EA 2UZCA 2YT7A 4JOGA 3DJ1A 3NGHA 3CC0A 2DM8A 3PV2A 4K78A 1IU2A 1N7EA 1QAVA 3CYYA 5HETA 3O5NA 3GDVA 2X7ZA 1R6JA 3KHFA 1PDRA 1WHAA 1V1TA 3QGLA 2JIKA 2QKVA 2VSVA 1TE0A 3DORA 1WJLA 2OPGA 3GJ9A 4NMRA 2E7KA 2EHRA 1Z87A 3TSVA 2HE4A 2KJDA 3QJNA 1N7TA 4AMHA 1WI2A 1QAVB 2JILA 5A2PA 3E17A 3ID3A 1U38A 2P3WA 1U39A 2H3LA 4UU6A 2PA1A 1MFLA 2M10A 4JOPA 2M0ZA 3NFLA 2JINA 2PZDA 4Q6SA 2REYA 1N6DA 4GVCA 3SFJA 4OEPA 3DJAA 3CS0A 2EDZA 2DJTA 3PDVA 5E6PB 2PDZA 2D92A 2QKUA 2F5YA 3EGGC 3RL7A 3KDGA 2EXGA 1U3BA 1L6OA 1UJVA 2LOBA 2I1NA 4YDPA 2KOHA 2Q3GA 2KAWA 2DB5A 2OQSA 4JJ3A 2YTWA 1KEFA 1VAEA 5E22A 4JORA 2H3MA 1UEQA 2L97A 2DC2A 4KFWA 2HGAA 3GCOA 1OBZA 2DAZA 2I6VA 2K20A 4MPAA 2KQFA 3L4FD 3QE1A 1GQ5A 3QJMA 4NNMA 1BE9A 4Z33A 1RZXA 2V90A 3I1EA 4HOPB 5I7ZA 1W9QA 2PKTA 3HVQC 4JOHA 4E35A 3VQFA 3LNYA 2KJPA 1N6FA 5F3XA 2KV8A 2GZVA 4YYXA 3PV5A 3NFKA 2EGOA 4NMVA 3RL8A 1UEZA 1KWAA 5HJ1A 1WF8A 2PNTA 3SHWA 3FY5A 2Z17A 2M0VA 4K72A 1IHJA 2OGPA 1VB7A 2QBWA 2Z9IA 1MC7A 1UFXA 1X8SA 2AWXA 2EEGA 3TMHA 5HFEA 3K50A 4NXQA 1SOTA 3K82A 2W7RA 5B6LA 1T2MA 3TSWA 5E1YA 4NMOA 2VPHA 1TP5A 1UEPA 3GABA 2VWRA 4N6XA 4Q3HA 5E21A 1FC7A 4NMPA 3OTPA 2KG2A 2MHOA 4F8KA 3DJ3A 2R3YA
chains in the Genus database with same CATH topology
2QG1A 1OBXA 2L4SA 3I4WA 4GHNA 4Q6HA 1K32A 4JOEA 1XZ9A 2O2TA 2JXOA 3O46A 4Q2QA 1OZIA 1P1DA 1QAUA 1M5ZA 1Z86A 1N6EA 1VA8A 1FC6A 3GDSA 5GLJA 2LA8A 3MH6A 3QDOA 4KFVA 1RGRA 2IWOA 5H3JA 1X9ZA 3EGHC 5JXBA 2OZFA 4JJ0A 1UJUA 4E3BA 4JOJA 2Q9VA 2EEHA 1Y7NA 2KPKA 1YBOA 1FCFA 2EJYA 2JREA 5E11A 3QO6A 1U37A 1NF3C 1Q7XA 4GVDA 4JL7A 1WI4A 4K75A 5FB8C 1WHDA 3SUZA 2L4TA 3ID4A 2OS6A 1VJ6A 2EGKA 3KZDA 4NXRA 2GEFA 3GGEA 4JOFA 2R4HA 2KOJA 4PQWA 3VQGA 2CSSA 2JOAA 2D90A 2VZ5A 3OU0A 4NMTA 2JWEA 1UITA 2RCZA 2KOMA 1TP3A 2EV8A 3WKMA 1G9OA 3GDUA 4FLNA 1NTEA 1RGWA 4REYA 3MH4A 3R0HA 1WFVA 2WL7A 2IWQA 3GSLA 4NXPA 1UJDA 2KRGA 4UU5A 4G69A 2EEIA 2VSPA 2G5MB 3WKLA 3TSZA 4P0CA 3K1RA 4IC6A 1KY9A 2EDVA 1GQ4A 1RY4A 3BPUA 4K76A 2EAQA 1X5NA 5ILBA 1WFGA 5D13A 1UM1A 1ZUBA 4WYTA 2M3MA 3HPMA 2H2CA 1N99A 2IWPA 1I92A 2PKUA 4Z8JA 3CBYA 1I16A 4OAJA 3MH7A 5HF1A 3PS4A 2KPLA 2V1WA 2DLUA 1V6BA 2DKRA 2EDPA 2I04A 4E34A 1X5RA 1WH1A 3HPKA 4NMSA 5HEDA 5EYZA 5F67A 2G2LA 5HFFA 2CS5A 2LC6A 3ZRTA 2MX6A 2KL1A 2FCFA 4FGMA 1UF1A 4RI0A 4Q2OA 1D5GA 4Q2NA 2OSGA 1LCYA 1X6DA 1UHPA 2KJKA 5G1DA 5GNDA 3GCNA 1B8QA 5DTHA 3RLEA 1X45A 2ENOA 3ID2A 3SHUA 5IL9A 3B76A 5HDYA 3R69A 4LMMA 2HE2A 1X5QA 3CH8A 1FC9A 5HFDA 2FNEA 2AWWA 1UEWA 3R68A 3JXTA 2DMZA 5FHTA 1ZOKA 2D8IA 2CSJA 2KBSA 3PV4A 3I18A 3LNXA 3CBZA 5HEYA 2KA9A 2ZPLA 4R2ZA 1Q3OA 1UM7A 2QT5A 1W9OA 4JOKA 1OBYA 1Y8TA 2M0TA 5B42A 2BYGA 2YUBA 2YUYA 3ID1A 2JSNA 2DLSA 5HFCA 2F0AA 4P2AB 1VCWA 4NMQA 4HOPA 3AXAA 5HEBA 4O06A 2YT8A 1QLCA 2OCSA 1W9EA 2AINA 2H2BA 4XHVA 2I0LA 3KZEA 4EDJA 1MFGA 2M0UA 2OMJA 1IU0A 2LUIA 2LC7A 4NNLA 4WYUA 3STJA 1WG6A 1WF7A 1V62A 2VRFA 3CBXA 1WIFA 1GM1A 3QIKA 5G1EA 2EEJA 2QKTA 2I4SA 3PDZA 3SOEA 5HFBA 1N7FA 1SOZA 1Q3PA 2FE5A 2KYLA 2RRMA 2I0IA 3DIWA 3KDKA 2IWNA 2K1ZA 4OEOA 2FN5A 4L8NA 2W4FA 5HF4A 2ZPMA 4H11A 3NCVA 4Q2PA 2AWUA 2EGNA 4K6YA 1V5LA 5EZ0A 1TQ3A 1BFEA 1V5QA 1P1EA 2UZCA 2YT7A 4JOGA 3DJ1A 3NGHA 3CC0A 2DM8A 3PV2A 4K78A 1IU2A 1N7EA 1QAVA 3CYYA 5HETA 3O5NA 3GDVA 2X7ZA 1R6JA 3KHFA 1PDRA 1WHAA 1V1TA 3QGLA 2JIKA 2QKVA 2VSVA 1TE0A 3DORA 1WJLA 2OPGA 3GJ9A 4NMRA 2E7KA 2EHRA 1Z87A 3TSVA 2HE4A 2KJDA 3QJNA 1N7TA 4AMHA 1WI2A 1QAVB 2JILA 5A2PA 3E17A 3ID3A 1U38A 2P3WA 1U39A 2H3LA 4UU6A 2PA1A 1MFLA 2M10A 4JOPA 2M0ZA 3NFLA 2JINA 2PZDA 4Q6SA 2REYA 1N6DA 4GVCA 3SFJA 4OEPA 3DJAA 3CS0A 2EDZA 2DJTA 3PDVA 5E6PB 2PDZA 2D92A 2QKUA 2F5YA 3EGGC 3RL7A 3KDGA 2EXGA 1U3BA 1L6OA 1UJVA 2LOBA 2I1NA 4YDPA 2KOHA 2Q3GA 2KAWA 2DB5A 2OQSA 4JJ3A 2YTWA 1KEFA 1VAEA 5E22A 4JORA 2H3MA 1UEQA 2L97A 2DC2A 4KFWA 2HGAA 3GCOA 1OBZA 2DAZA 2I6VA 2K20A 4MPAA 2KQFA 3L4FD 3QE1A 1GQ5A 3QJMA 4NNMA 1BE9A 4Z33A 1RZXA 2V90A 3I1EA 4HOPB 5I7ZA 1W9QA 2PKTA 3HVQC 4JOHA 4E35A 3VQFA 3LNYA 2KJPA 1N6FA 5F3XA 2KV8A 2GZVA 4YYXA 3PV5A 3NFKA 2EGOA 4NMVA 3RL8A 1UEZA 1KWAA 5HJ1A 1WF8A 2PNTA 3SHWA 3FY5A 2Z17A 2M0VA 4K72A 1IHJA 2OGPA 1VB7A 2QBWA 2Z9IA 1MC7A 1UFXA 1X8SA 2AWXA 2EEGA 3TMHA 5HFEA 3K50A 4NXQA 1SOTA 3K82A 2W7RA 5B6LA 1T2MA 3TSWA 5E1YA 4NMOA 2VPHA 1TP5A 1UEPA 3GABA 2VWRA 4N6XA 4Q3HA 5E21A 1FC7A 4NMPA 3OTPA 2KG2A 2MHOA 4F8KA 3DJ3A 2R3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QG1 A;  1OBX A;  2L4S A;  3I4W A;  4GHN A;  4Q6H A;  1K32 A;  4JOE A;  1XZ9 A;  2O2T A;  2JXO A;  3O46 A;  4Q2Q A;  1OZI A;  1P1D A;  1QAU A;  1M5Z A;  1Z86 A;  1N6E A;  1VA8 A;  1FC6 A;  3GDS A;  5GLJ A;  2LA8 A;  3MH6 A;  3QDO A;  4KFV A;  1RGR A;  2IWO A;  5H3J A;  3EGH C;  5JXB A;  2OZF A;  1UJU A;  4E3B A;  4JOJ A;  2Q9V A;  2EEH A;  1Y7N A;  2KPK A;  1YBO A;  1FCF A;  2EJY A;  2JRE A;  5E11 A;  3QO6 A;  1U37 A;  1NF3 C;  1Q7X A;  4GVD A;  4JL7 A;  1WI4 A;  4K75 A;  5FB8 C;  1WHD A;  3SUZ A;  2L4T A;  3ID4 A;  2OS6 A;  1VJ6 A;  2EGK A;  3KZD A;  4NXR A;  3GGE A;  4JOF A;  2R4H A;  2KOJ A;  4PQW A;  3VQG A;  2CSS A;  2JOA A;  2D90 A;  2VZ5 A;  3OU0 A;  4NMT A;  2JWE A;  1UIT A;  2RCZ A;  2KOM A;  1TP3 A;  2EV8 A;  3WKM A;  1G9O A;  3GDU A;  1NTE A;  1RGW A;  4REY A;  3MH4 A;  3R0H A;  1WFV A;  2WL7 A;  2IWQ A;  3GSL A;  4NXP A;  1UJD A;  2KRG A;  4UU5 A;  4G69 A;  2EEI A;  2VSP A;  2G5M B;  3WKL A;  3TSZ A;  4P0C A;  3K1R A;  4IC6 A;  1KY9 A;  2EDV A;  1GQ4 A;  1RY4 A;  3BPU A;  4K76 A;  2EAQ A;  1X5N A;  1WFG A;  5D13 A;  1UM1 A;  1ZUB A;  4WYT A;  2M3M A;  3HPM A;  2H2C A;  1N99 A;  2IWP A;  1I92 A;  2PKU A;  4Z8J A;  3CBY A;  1I16 A;  4OAJ A;  3MH7 A;  5HF1 A;  3PS4 A;  2KPL A;  2V1W A;  2DLU A;  1V6B A;  2DKR A;  2EDP A;  2I04 A;  4E34 A;  1X5R A;  1WH1 A;  3HPK A;  4NMS A;  5HED A;  5EYZ A;  5F67 A;  2G2L A;  5HFF A;  2CS5 A;  2LC6 A;  3ZRT A;  2MX6 A;  2KL1 A;  2FCF A;  4FGM A;  1UF1 A;  4RI0 A;  4Q2O A;  1D5G A;  4Q2N A;  2OSG A;  1LCY A;  1X6D A;  1UHP A;  2KJK A;  5G1D A;  5GND A;  3GCN A;  1B8Q A;  5DTH A;  3RLE A;  1X45 A;  2ENO A;  3ID2 A;  3SHU A;  3B76 A;  5HDY A;  3R69 A;  4LMM A;  2HE2 A;  1X5Q A;  3CH8 A;  1FC9 A;  5HFD A;  2FNE A;  2AWW A;  1UEW A;  3R68 A;  3JXT A;  2DMZ A;  5FHT A;  1ZOK A;  2D8I A;  2CSJ A;  2KBS A;  3PV4 A;  3I18 A;  3LNX A;  3CBZ A;  5HEY A;  2KA9 A;  2ZPL A;  4R2Z A;  1Q3O A;  1UM7 A;  2QT5 A;  1W9O A;  4JOK A;  1OBY A;  1Y8T A;  2M0T A;  2BYG A;  2YUB A;  2YUY A;  3ID1 A;  2DLS A;  5HFC A;  2F0A A;  4P2A B;  1VCW A;  4NMQ A;  4HOP A;  3AXA A;  5HEB A;  4O06 A;  2YT8 A;  1QLC A;  2OCS A;  1W9E A;  2AIN A;  2H2B A;  4XHV A;  2I0L A;  3KZE A;  4EDJ A;  1MFG A;  2M0U A;  2OMJ A;  1IU0 A;  2LUI A;  2LC7 A;  4NNL A;  4WYU A;  3STJ A;  1WG6 A;  1WF7 A;  1V62 A;  2VRF A;  3CBX A;  1WIF A;  1GM1 A;  3QIK A;  5G1E A;  2EEJ A;  2QKT A;  2I4S A;  3PDZ A;  3SOE A;  5HFB A;  1N7F A;  1SOZ A;  1Q3P A;  2FE5 A;  2KYL A;  2RRM A;  2I0I A;  3DIW A;  2IWN A;  2K1Z A;  4OEO A;  2FN5 A;  4L8N A;  2W4F A;  5HF4 A;  2ZPM A;  4H11 A;  4Q2P A;  2AWU A;  2EGN A;  4K6Y A;  1V5L A;  5EZ0 A;  1TQ3 A;  1BFE A;  1V5Q A;  1P1E A;  2UZC A;  2YT7 A;  4JOG A;  3DJ1 A;  3NGH A;  3CC0 A;  2DM8 A;  3PV2 A;  4K78 A;  1IU2 A;  1N7E A;  1QAV A;  3CYY A;  5HET A;  3O5N A;  3GDV A;  2X7Z A;  1R6J A;  3KHF A;  1PDR A;  1WHA A;  1V1T A;  3QGL A;  2JIK A;  2QKV A;  2VSV A;  1TE0 A;  3DOR A;  1WJL A;  2OPG A;  3GJ9 A;  4NMR A;  2E7K A;  2EHR A;  1Z87 A;  3TSV A;  2HE4 A;  2KJD A;  3QJN A;  1N7T A;  4AMH A;  1WI2 A;  1QAV B;  2JIL A;  5A2P A;  3E17 A;  3ID3 A;  1U38 A;  2P3W A;  1U39 A;  2H3L A;  4UU6 A;  2PA1 A;  1MFL A;  2M10 A;  4JOP A;  2M0Z A;  3NFL A;  2JIN A;  2PZD A;  4Q6S A;  2REY A;  1N6D A;  4GVC A;  3SFJ A;  4OEP A;  3DJA A;  3CS0 A;  2EDZ A;  2DJT A;  3PDV A;  5E6P B;  2PDZ A;  2D92 A;  2QKU A;  2F5Y A;  3EGG C;  3RL7 A;  2EXG A;  1U3B A;  1L6O A;  1UJV A;  2LOB A;  2I1N A;  4YDP A;  2KOH A;  2Q3G A;  2KAW A;  2DB5 A;  2OQS A;  2YTW A;  1KEF A;  1VAE A;  5E22 A;  4JOR A;  2H3M A;  1UEQ A;  2L97 A;  2DC2 A;  4KFW A;  2HGA A;  3GCO A;  1OBZ A;  2DAZ A;  2I6V A;  2K20 A;  4MPA A;  2KQF A;  3L4F D;  3QE1 A;  1GQ5 A;  3QJM A;  4NNM A;  1BE9 A;  4Z33 A;  1RZX A;  2V90 A;  3I1E A;  4HOP B;  5I7Z A;  1W9Q A;  2PKT A;  3HVQ C;  4JOH A;  4E35 A;  3VQF A;  3LNY A;  2KJP A;  1N6F A;  5F3X A;  2KV8 A;  2GZV A;  4YYX A;  3PV5 A;  3NFK A;  2EGO A;  4NMV A;  3RL8 A;  1UEZ A;  1KWA A;  5HJ1 A;  1WF8 A;  2PNT A;  3SHW A;  3FY5 A;  2Z17 A;  2M0V A;  4K72 A;  1IHJ A;  2OGP A;  1VB7 A;  2QBW A;  2Z9I A;  1MC7 A;  1UFX A;  1X8S A;  2AWX A;  2EEG A;  3TMH A;  5HFE A;  3K50 A;  4NXQ A;  1SOT A;  3K82 A;  2W7R A;  5B6L A;  1T2M A;  3TSW A;  5E1Y A;  4NMO A;  2VPH A;  1TP5 A;  1UEP A;  2VWR A;  4N6X A;  4Q3H A;  5E21 A;  1FC7 A;  4NMP A;  3OTP A;  2KG2 A;  2MHO A;  4F8K A;  3DJ3 A;  2R3Y A; 
#chains in the Genus database with same CATH topology
 2QG1 A;  1OBX A;  2L4S A;  3I4W A;  4GHN A;  4Q6H A;  1K32 A;  4JOE A;  1XZ9 A;  2O2T A;  2JXO A;  3O46 A;  4Q2Q A;  1OZI A;  1P1D A;  1QAU A;  1M5Z A;  1Z86 A;  1N6E A;  1VA8 A;  1FC6 A;  3GDS A;  5GLJ A;  2LA8 A;  3MH6 A;  3QDO A;  4KFV A;  1RGR A;  2IWO A;  5H3J A;  1X9Z A;  3EGH C;  5JXB A;  2OZF A;  4JJ0 A;  1UJU A;  4E3B A;  4JOJ A;  2Q9V A;  2EEH A;  1Y7N A;  2KPK A;  1YBO A;  1FCF A;  2EJY A;  2JRE A;  5E11 A;  3QO6 A;  1U37 A;  1NF3 C;  1Q7X A;  4GVD A;  4JL7 A;  1WI4 A;  4K75 A;  5FB8 C;  1WHD A;  3SUZ A;  2L4T A;  3ID4 A;  2OS6 A;  1VJ6 A;  2EGK A;  3KZD A;  4NXR A;  2GEF A;  3GGE A;  4JOF A;  2R4H A;  2KOJ A;  4PQW A;  3VQG A;  2CSS A;  2JOA A;  2D90 A;  2VZ5 A;  3OU0 A;  4NMT A;  2JWE A;  1UIT A;  2RCZ A;  2KOM A;  1TP3 A;  2EV8 A;  3WKM A;  1G9O A;  3GDU A;  4FLN A;  1NTE A;  1RGW A;  4REY A;  3MH4 A;  3R0H A;  1WFV A;  2WL7 A;  2IWQ A;  3GSL A;  4NXP A;  1UJD A;  2KRG A;  4UU5 A;  4G69 A;  2EEI A;  2VSP A;  2G5M B;  3WKL A;  3TSZ A;  4P0C A;  3K1R A;  4IC6 A;  1KY9 A;  2EDV A;  1GQ4 A;  1RY4 A;  3BPU A;  4K76 A;  2EAQ A;  1X5N A;  5ILB A;  1WFG A;  5D13 A;  1UM1 A;  1ZUB A;  4WYT A;  2M3M A;  3HPM A;  2H2C A;  1N99 A;  2IWP A;  1I92 A;  2PKU A;  4Z8J A;  3CBY A;  1I16 A;  4OAJ A;  3MH7 A;  5HF1 A;  3PS4 A;  2KPL A;  2V1W A;  2DLU A;  1V6B A;  2DKR A;  2EDP A;  2I04 A;  4E34 A;  1X5R A;  1WH1 A;  3HPK A;  4NMS A;  5HED A;  5EYZ A;  5F67 A;  2G2L A;  5HFF A;  2CS5 A;  2LC6 A;  3ZRT A;  2MX6 A;  2KL1 A;  2FCF A;  4FGM A;  1UF1 A;  4RI0 A;  4Q2O A;  1D5G A;  4Q2N A;  2OSG A;  1LCY A;  1X6D A;  1UHP A;  2KJK A;  5G1D A;  5GND A;  3GCN A;  1B8Q A;  5DTH A;  3RLE A;  1X45 A;  2ENO A;  3ID2 A;  3SHU A;  5IL9 A;  3B76 A;  5HDY A;  3R69 A;  4LMM A;  2HE2 A;  1X5Q A;  3CH8 A;  1FC9 A;  5HFD A;  2FNE A;  2AWW A;  1UEW A;  3R68 A;  3JXT A;  2DMZ A;  5FHT A;  1ZOK A;  2D8I A;  2CSJ A;  2KBS A;  3PV4 A;  3I18 A;  3LNX A;  3CBZ A;  5HEY A;  2KA9 A;  2ZPL A;  4R2Z A;  1Q3O A;  1UM7 A;  2QT5 A;  1W9O A;  4JOK A;  1OBY A;  1Y8T A;  2M0T A;  5B42 A;  2BYG A;  2YUB A;  2YUY A;  3ID1 A;  2JSN A;  2DLS A;  5HFC A;  2F0A A;  4P2A B;  1VCW A;  4NMQ A;  4HOP A;  3AXA A;  5HEB A;  4O06 A;  2YT8 A;  1QLC A;  2OCS A;  1W9E A;  2AIN A;  2H2B A;  4XHV A;  2I0L A;  3KZE A;  4EDJ A;  1MFG A;  2M0U A;  2OMJ A;  1IU0 A;  2LUI A;  2LC7 A;  4NNL A;  4WYU A;  3STJ A;  1WG6 A;  1WF7 A;  1V62 A;  2VRF A;  3CBX A;  1WIF A;  1GM1 A;  3QIK A;  5G1E A;  2EEJ A;  2QKT A;  2I4S A;  3PDZ A;  3SOE A;  5HFB A;  1N7F A;  1SOZ A;  1Q3P A;  2FE5 A;  2KYL A;  2RRM A;  2I0I A;  3DIW A;  3KDK A;  2IWN A;  2K1Z A;  4OEO A;  2FN5 A;  4L8N A;  2W4F A;  5HF4 A;  2ZPM A;  4H11 A;  3NCV A;  4Q2P A;  2AWU A;  2EGN A;  4K6Y A;  1V5L A;  5EZ0 A;  1TQ3 A;  1BFE A;  1V5Q A;  1P1E A;  2UZC A;  2YT7 A;  4JOG A;  3DJ1 A;  3NGH A;  3CC0 A;  2DM8 A;  3PV2 A;  4K78 A;  1IU2 A;  1N7E A;  1QAV A;  3CYY A;  5HET A;  3O5N A;  3GDV A;  2X7Z A;  1R6J A;  3KHF A;  1PDR A;  1WHA A;  1V1T A;  3QGL A;  2JIK A;  2QKV A;  2VSV A;  1TE0 A;  3DOR A;  1WJL A;  2OPG A;  3GJ9 A;  4NMR A;  2E7K A;  2EHR A;  1Z87 A;  3TSV A;  2HE4 A;  2KJD A;  3QJN A;  1N7T A;  4AMH A;  1WI2 A;  1QAV B;  2JIL A;  5A2P A;  3E17 A;  3ID3 A;  1U38 A;  2P3W A;  1U39 A;  2H3L A;  4UU6 A;  2PA1 A;  1MFL A;  2M10 A;  4JOP A;  2M0Z A;  3NFL A;  2JIN A;  2PZD A;  4Q6S A;  2REY A;  1N6D A;  4GVC A;  3SFJ A;  4OEP A;  3DJA A;  3CS0 A;  2EDZ A;  2DJT A;  3PDV A;  5E6P B;  2PDZ A;  2D92 A;  2QKU A;  2F5Y A;  3EGG C;  3RL7 A;  3KDG A;  2EXG A;  1U3B A;  1L6O A;  1UJV A;  2LOB A;  2I1N A;  4YDP A;  2KOH A;  2Q3G A;  2KAW A;  2DB5 A;  2OQS A;  4JJ3 A;  2YTW A;  1KEF A;  1VAE A;  5E22 A;  4JOR A;  2H3M A;  1UEQ A;  2L97 A;  2DC2 A;  4KFW A;  2HGA A;  3GCO A;  1OBZ A;  2DAZ A;  2I6V A;  2K20 A;  4MPA A;  2KQF A;  3L4F D;  3QE1 A;  1GQ5 A;  3QJM A;  4NNM A;  1BE9 A;  4Z33 A;  1RZX A;  2V90 A;  3I1E A;  4HOP B;  5I7Z A;  1W9Q A;  2PKT A;  3HVQ C;  4JOH A;  4E35 A;  3VQF A;  3LNY A;  2KJP A;  1N6F A;  5F3X A;  2KV8 A;  2GZV A;  4YYX A;  3PV5 A;  3NFK A;  2EGO A;  4NMV A;  3RL8 A;  1UEZ A;  1KWA A;  5HJ1 A;  1WF8 A;  2PNT A;  3SHW A;  3FY5 A;  2Z17 A;  2M0V A;  4K72 A;  1IHJ A;  2OGP A;  1VB7 A;  2QBW A;  2Z9I A;  1MC7 A;  1UFX A;  1X8S A;  2AWX A;  2EEG A;  3TMH A;  5HFE A;  3K50 A;  4NXQ A;  1SOT A;  3K82 A;  2W7R A;  5B6L A;  1T2M A;  3TSW A;  5E1Y A;  4NMO A;  2VPH A;  1TP5 A;  1UEP A;  3GAB A;  2VWR A;  4N6X A;  4Q3H A;  5E21 A;  1FC7 A;  4NMP A;  3OTP A;  2KG2 A;  2MHO A;  4F8K A;  3DJ3 A;  2R3Y A; 
#chains in the Genus database with same CATH homology
 2QG1 A;  1OBX A;  2L4S A;  3I4W A;  4GHN A;  4Q6H A;  1K32 A;  4JOE A;  1XZ9 A;  2O2T A;  2JXO A;  3O46 A;  4Q2Q A;  1OZI A;  1P1D A;  1QAU A;  1M5Z A;  1Z86 A;  1N6E A;  1VA8 A;  1FC6 A;  3GDS A;  5GLJ A;  2LA8 A;  3MH6 A;  3QDO A;  4KFV A;  1RGR A;  2IWO A;  5H3J A;  1X9Z A;  3EGH C;  5JXB A;  2OZF A;  4JJ0 A;  1UJU A;  4E3B A;  4JOJ A;  2Q9V A;  2EEH A;  1Y7N A;  2KPK A;  1YBO A;  1FCF A;  2EJY A;  2JRE A;  5E11 A;  3QO6 A;  1U37 A;  1NF3 C;  1Q7X A;  4GVD A;  4JL7 A;  1WI4 A;  4K75 A;  5FB8 C;  1WHD A;  3SUZ A;  2L4T A;  3ID4 A;  2OS6 A;  1VJ6 A;  2EGK A;  3KZD A;  4NXR A;  2GEF A;  3GGE A;  4JOF A;  2R4H A;  2KOJ A;  4PQW A;  3VQG A;  2CSS A;  2JOA A;  2D90 A;  2VZ5 A;  3OU0 A;  4NMT A;  2JWE A;  1UIT A;  2RCZ A;  2KOM A;  1TP3 A;  2EV8 A;  3WKM A;  1G9O A;  3GDU A;  4FLN A;  1NTE A;  1RGW A;  4REY A;  3MH4 A;  3R0H A;  1WFV A;  2WL7 A;  2IWQ A;  3GSL A;  4NXP A;  1UJD A;  2KRG A;  4UU5 A;  4G69 A;  2EEI A;  2VSP A;  2G5M B;  3WKL A;  3TSZ A;  4P0C A;  3K1R A;  4IC6 A;  1KY9 A;  2EDV A;  1GQ4 A;  1RY4 A;  3BPU A;  4K76 A;  2EAQ A;  1X5N A;  5ILB A;  1WFG A;  5D13 A;  1UM1 A;  1ZUB A;  4WYT A;  2M3M A;  3HPM A;  2H2C A;  1N99 A;  2IWP A;  1I92 A;  2PKU A;  4Z8J A;  3CBY A;  1I16 A;  4OAJ A;  3MH7 A;  5HF1 A;  3PS4 A;  2KPL A;  2V1W A;  2DLU A;  1V6B A;  2DKR A;  2EDP A;  2I04 A;  4E34 A;  1X5R A;  1WH1 A;  3HPK A;  4NMS A;  5HED A;  5EYZ A;  5F67 A;  2G2L A;  5HFF A;  2CS5 A;  2LC6 A;  3ZRT A;  2MX6 A;  2KL1 A;  2FCF A;  4FGM A;  1UF1 A;  4RI0 A;  4Q2O A;  1D5G A;  4Q2N A;  2OSG A;  1LCY A;  1X6D A;  1UHP A;  2KJK A;  5G1D A;  5GND A;  3GCN A;  1B8Q A;  5DTH A;  3RLE A;  1X45 A;  2ENO A;  3ID2 A;  3SHU A;  5IL9 A;  3B76 A;  5HDY A;  3R69 A;  4LMM A;  2HE2 A;  1X5Q A;  3CH8 A;  1FC9 A;  5HFD A;  2FNE A;  2AWW A;  1UEW A;  3R68 A;  3JXT A;  2DMZ A;  5FHT A;  1ZOK A;  2D8I A;  2CSJ A;  2KBS A;  3PV4 A;  3I18 A;  3LNX A;  3CBZ A;  5HEY A;  2KA9 A;  2ZPL A;  4R2Z A;  1Q3O A;  1UM7 A;  2QT5 A;  1W9O A;  4JOK A;  1OBY A;  1Y8T A;  2M0T A;  5B42 A;  2BYG A;  2YUB A;  2YUY A;  3ID1 A;  2JSN A;  2DLS A;  5HFC A;  2F0A A;  4P2A B;  1VCW A;  4NMQ A;  4HOP A;  3AXA A;  5HEB A;  4O06 A;  2YT8 A;  1QLC A;  2OCS A;  1W9E A;  2AIN A;  2H2B A;  4XHV A;  2I0L A;  3KZE A;  4EDJ A;  1MFG A;  2M0U A;  2OMJ A;  1IU0 A;  2LUI A;  2LC7 A;  4NNL A;  4WYU A;  3STJ A;  1WG6 A;  1WF7 A;  1V62 A;  2VRF A;  3CBX A;  1WIF A;  1GM1 A;  3QIK A;  5G1E A;  2EEJ A;  2QKT A;  2I4S A;  3PDZ A;  3SOE A;  5HFB A;  1N7F A;  1SOZ A;  1Q3P A;  2FE5 A;  2KYL A;  2RRM A;  2I0I A;  3DIW A;  3KDK A;  2IWN A;  2K1Z A;  4OEO A;  2FN5 A;  4L8N A;  2W4F A;  5HF4 A;  2ZPM A;  4H11 A;  3NCV A;  4Q2P A;  2AWU A;  2EGN A;  4K6Y A;  1V5L A;  5EZ0 A;  1TQ3 A;  1BFE A;  1V5Q A;  1P1E A;  2UZC A;  2YT7 A;  4JOG A;  3DJ1 A;  3NGH A;  3CC0 A;  2DM8 A;  3PV2 A;  4K78 A;  1IU2 A;  1N7E A;  1QAV A;  3CYY A;  5HET A;  3O5N A;  3GDV A;  2X7Z A;  1R6J A;  3KHF A;  1PDR A;  1WHA A;  1V1T A;  3QGL A;  2JIK A;  2QKV A;  2VSV A;  1TE0 A;  3DOR A;  1WJL A;  2OPG A;  3GJ9 A;  4NMR A;  2E7K A;  2EHR A;  1Z87 A;  3TSV A;  2HE4 A;  2KJD A;  3QJN A;  1N7T A;  4AMH A;  1WI2 A;  1QAV B;  2JIL A;  5A2P A;  3E17 A;  3ID3 A;  1U38 A;  2P3W A;  1U39 A;  2H3L A;  4UU6 A;  2PA1 A;  1MFL A;  2M10 A;  4JOP A;  2M0Z A;  3NFL A;  2JIN A;  2PZD A;  4Q6S A;  2REY A;  1N6D A;  4GVC A;  3SFJ A;  4OEP A;  3DJA A;  3CS0 A;  2EDZ A;  2DJT A;  3PDV A;  5E6P B;  2PDZ A;  2D92 A;  2QKU A;  2F5Y A;  3EGG C;  3RL7 A;  3KDG A;  2EXG A;  1U3B A;  1L6O A;  1UJV A;  2LOB A;  2I1N A;  4YDP A;  2KOH A;  2Q3G A;  2KAW A;  2DB5 A;  2OQS A;  4JJ3 A;  2YTW A;  1KEF A;  1VAE A;  5E22 A;  4JOR A;  2H3M A;  1UEQ A;  2L97 A;  2DC2 A;  4KFW A;  2HGA A;  3GCO A;  1OBZ A;  2DAZ A;  2I6V A;  2K20 A;  4MPA A;  2KQF A;  3L4F D;  3QE1 A;  1GQ5 A;  3QJM A;  4NNM A;  1BE9 A;  4Z33 A;  1RZX A;  2V90 A;  3I1E A;  4HOP B;  5I7Z A;  1W9Q A;  2PKT A;  3HVQ C;  4JOH A;  4E35 A;  3VQF A;  3LNY A;  2KJP A;  1N6F A;  5F3X A;  2KV8 A;  2GZV A;  4YYX A;  3PV5 A;  3NFK A;  2EGO A;  4NMV A;  3RL8 A;  1UEZ A;  1KWA A;  5HJ1 A;  1WF8 A;  2PNT A;  3SHW A;  3FY5 A;  2Z17 A;  2M0V A;  4K72 A;  1IHJ A;  2OGP A;  1VB7 A;  2QBW A;  2Z9I A;  1MC7 A;  1UFX A;  1X8S A;  2AWX A;  2EEG A;  3TMH A;  5HFE A;  3K50 A;  4NXQ A;  1SOT A;  3K82 A;  2W7R A;  5B6L A;  1T2M A;  3TSW A;  5E1Y A;  4NMO A;  2VPH A;  1TP5 A;  1UEP A;  3GAB A;  2VWR A;  4N6X A;  4Q3H A;  5E21 A;  1FC7 A;  4NMP A;  3OTP A;  2KG2 A;  2MHO A;  4F8K A;  3DJ3 A;  2R3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...