2JINA

Crystal structure of pdz domain of synaptojanin-2 binding protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
SMRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPTOJANIN-2 BINDING PROTEIN
publication title Crystal Structure of Pdz Domain of Synaptojanin-2 Binding Protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2jinA00
1QAUA 1P1DA 2JWEA 5EZ0A 2KOJA 2FE5A 1I16A 3DJAA 2VPHA 4NMVA 1OBZA 3CYYA 2D90A 3I1EA 4NNLA 2M0TA 3GDSA 1VB7A 2FN5A 2KL1A 3MH6A 2YT7A 3NFLA 1VA8A 5DTHA 3O46A 2VRFA 4KFWA 5EYZA 4UU6A 1UFXA 2OZFA 1K32A 2QKVA 3HPKA 2DKRA 2JILA 4K78A 4REYA 1OZIA 3NGHA 1BFEA 4GVCA 1WF8A 1X45A 1V6BA 2DB5A 1X6DA 2L97A 3PV5A 4OEOA 4YYXA 1N6EA 1X5RA 2AWUA 2KJDA 2L4TA 3ID4A 1VCWA 1FC7A 4HOPA 4JORA 1R6JA 1GQ4A 1UHPA 4NXRA 3OU0A 3RL8A 2H3MA 1VJ6A 2RRMA 2KJKA 2OQSA 3O5NA 5E21A 1SOTA 1PDRA 2WL7A 4JOHA 2KOMA 2EDZA 2V90A 1UITA 2LUIA 2JREA 1WHDA 1Y8TA 1MC7A 2KPLA 3DIWA 3SOEA 2H3LA 1V1TA 2KYLA 2QT5A 3ZRTA 2RCZA 1TQ3A 2I0LA 1OBXA 3KZEA 3ID2A 3TSWA 1W9QA 3HPMA 4K76A 1GQ5A 4NNMA 4F8KA 1UM7A 4JL7A 4WYTA 1N7TA 3RL7A 4FGMA 4IC6A 2EEHA 1D5GA 2KPKA 3VQGA 2KA9A 4NMTA 2Q3GA 4E34A 3CC0A 4JOPA 1V62A 4NMRA 2LC6A 3R69A 2LOBA 2V1WA 2M0ZA 2PNTA 2P3WA 2CS5A 2KG2A 3DJ1A 4KFVA 2LC7A 2Z9IA 1UM1A 1FC6A 4JOGA 2BYGA 4N6XA 5F3XA 3K1RA 1WFVA 3PV2A 3GGEA 2YUYA 5FB8C 4JOEA 1BE9A 2YUBA 1XZ9A 1X5NA 4Z8JA 1ZOKA 1UEQA 2HE4A 2EJYA 2MHOA 1U39A 2VSVA 3KHFA 1KWAA 3GDUA 3SHWA 1Q7XA 3CBYA 4NXQA 2EXGA 1LCYA 1N99A 1N6DA 1I92A 1RGRA 4H11A 4NXPA 5HF1A 3AXAA 2F0AA 5HJ1A 3I18A 2EEGA 4YDPA 2FNEA 1WG6A 1FCFA 1ZUBA 3GDVA 3TSVA 2I0IA 2YT8A 5HFDA 1KEFA 1WI2A 2YTWA 2EEJA 1IHJA 2OPGA 1GM1A 3MH7A 3CBZA 3GCOA 2DLSA 3VQFA 5JXBA 2VSPA 3LNXA 5B6LA 3EGGC 2IWOA 2G5MB 2DJTA 2Z17A 2PDZA 4Q2NA 1B8QA 3SHUA 1QAVA 2I4SA 2QKUA 1W9OA 4L8NA 2PA1A 4Z33A 2EDVA 4Q3HA 2JOAA 5E11A 1SOZA 1WF7A 4JOJA 2EHRA 3CBXA 1YBOA 5HEDA 3GJ9A 4WYUA 2PKTA 1WH1A 3SFJA 1UF1A 4K75A 1G9OA 2H2BA 5HEYA 5HFBA 1P1EA 3KZDA 3L4FD 2HGAA 1TP5A 4Q2PA 3PDVA 2PZDA 1M5ZA 3K50A 2EV8A 4AMHA 5E6PB 3R68A 2DAZA 1UJVA 2IWPA 2OGPA 2M10A 3SUZA 1W9EA 2OSGA 2M3MA 2I6VA 5I7ZA 4P0CA 1UJDA 2KJPA 4Q6SA 2OMJA 1WJLA 4UU5A 2CSJA 4EDJA 1OBYA 5D13A 3FY5A 1Q3OA 4JOFA 2R3YA 3QJNA 1NF3C 1N6FA 2X7ZA 2EEIA 3TSZA 3QIKA 3STJA 5GNDA 5HETA 2D8IA 4LMMA 3LNYA 3MH4A 4NMSA 3DJ3A 1TE0A 4K72A 2QG1A 1UEPA 1Y7NA 2D92A 4PQWA 5HFCA 1VAEA 3R0HA 1UEZA 1WIFA 4Q2OA 4R2ZA 2UZCA 2HE2A 2AINA 1Z86A 3ID3A 2EAQA 3PS4A 4NMPA 3BPUA 4GHNA 2JINA 3QE1A 3GSLA 1WHAA 1IU2A 2AWWA 2JXOA 2DC2A 2KBSA 4HOPB 1T2MA 1V5LA 4P2AB 1NTEA 1UEWA 3QGLA 2L4SA 2CSSA 2DMZA 1TP3A 2KAWA 3CS0A 3EGHC 4MPAA 5E1YA 2M0UA 1QAVB 2ENOA 2DM8A 2E7KA 3PV4A 4NMOA 4O06A 4GVDA 2KQFA 2QBWA 4OEPA 2IWQA 2R4HA 2K20A 4E3BA 3JXTA 1RGWA 2M0VA 3NFKA 1WFGA 2FCFA 3B76A 3GCNA 5HEBA 1X5QA 2H2CA 2EDPA 1QLCA 2W4FA 1U38A 3QDOA 1U3BA 4OAJA 3WKLA 4K6YA 5F67A 2KV8A 3WKMA 1RY4A 2I1NA 2GZVA 2REYA 5HFFA 5HDYA 2OCSA 4JOKA 3E17A 1N7EA 3I4WA 2EGNA 2O2TA 1N7FA 3QJMA 1L6OA 3OTPA 2VZ5A 5H3JA 4Q6HA 5FHTA 4G69A 2JIKA 2Q9VA 4XHVA 5HFEA 2OS6A 5HF4A 1Z87A 2LA8A 5A2PA 2AWXA 2K1ZA 2IWNA 5GLJA 2F5YA 2MX6A 3QO6A 5E22A 2QKTA 3TMHA 2ZPMA 4E35A 2G2LA 1MFLA 4Q2QA 3ID1A 2EGKA 2KOHA 3CH8A 1X8SA 3RLEA 1Q3PA 2DLUA 3PDZA 1WI4A 2I04A 2VWRA 5G1EA 3K82A 4RI0A 2ZPLA 2EGOA 5G1DA 1KY9A 1U37A 2W7RA 1RZXA 1V5QA 1UJUA 4NMQA 2PKUA 1MFGA 3HVQC 2KRGA 3DORA 1IU0A 1FC9A
chains in the Genus database with same CATH superfamily
1QAUA 1P1DA 2JWEA 5EZ0A 2KOJA 2FE5A 1I16A 3DJAA 2VPHA 4NMVA 1OBZA 3CYYA 2D90A 3I1EA 4NNLA 2M0TA 3GDSA 1VB7A 2FN5A 2KL1A 3MH6A 2YT7A 3NFLA 1VA8A 5DTHA 3O46A 2VRFA 4KFWA 5EYZA 4UU6A 1UFXA 2OZFA 1K32A 2QKVA 3HPKA 2DKRA 2JILA 4K78A 4REYA 1OZIA 1X9ZA 3NGHA 1BFEA 4GVCA 1WF8A 1X45A 1V6BA 2DB5A 1X6DA 2L97A 3PV5A 4OEOA 4YYXA 1N6EA 1X5RA 2AWUA 2KJDA 2L4TA 3ID4A 1VCWA 1FC7A 4HOPA 4JORA 1R6JA 1GQ4A 1UHPA 4NXRA 3OU0A 3RL8A 2H3MA 1VJ6A 2RRMA 2KJKA 2OQSA 3O5NA 5E21A 1SOTA 1PDRA 2WL7A 4JOHA 2KOMA 2EDZA 2V90A 1UITA 2LUIA 2JREA 1WHDA 1Y8TA 3KDGA 1MC7A 2KPLA 3DIWA 3SOEA 2H3LA 1V1TA 2KYLA 2QT5A 3ZRTA 2RCZA 1TQ3A 2I0LA 1OBXA 3KZEA 3ID2A 3TSWA 1W9QA 3HPMA 4K76A 1GQ5A 4NNMA 4F8KA 1UM7A 4JL7A 4WYTA 1N7TA 3RL7A 4FGMA 4IC6A 2EEHA 1D5GA 2KPKA 3VQGA 2KA9A 3GABA 4NMTA 2Q3GA 4E34A 3CC0A 4JOPA 1V62A 4NMRA 2LC6A 3R69A 2LOBA 2V1WA 2M0ZA 2PNTA 2P3WA 2CS5A 2KG2A 3DJ1A 4KFVA 2LC7A 2Z9IA 3KDKA 1UM1A 1FC6A 4JOGA 2BYGA 4N6XA 5F3XA 3K1RA 1WFVA 3PV2A 3GGEA 2YUYA 5FB8C 4JOEA 1BE9A 2YUBA 1XZ9A 1X5NA 4Z8JA 1ZOKA 1UEQA 2GEFA 2EJYA 2HE4A 2MHOA 1U39A 2VSVA 3KHFA 1KWAA 3GDUA 3SHWA 1Q7XA 3CBYA 4NXQA 2EXGA 1LCYA 1N99A 1N6DA 1I92A 1RGRA 4H11A 4NXPA 5HF1A 3AXAA 2F0AA 5HJ1A 3I18A 2EEGA 4YDPA 2FNEA 1WG6A 1FCFA 1ZUBA 3GDVA 3TSVA 2I0IA 2YT8A 5HFDA 1KEFA 1WI2A 2YTWA 2EEJA 1IHJA 2OPGA 1GM1A 3MH7A 3CBZA 3GCOA 2DLSA 3VQFA 3NCVA 5JXBA 2VSPA 3LNXA 5B6LA 3EGGC 2IWOA 2G5MB 2DJTA 2Z17A 2PDZA 4Q2NA 1B8QA 3SHUA 1QAVA 2I4SA 2QKUA 1W9OA 4L8NA 2PA1A 4Z33A 2EDVA 4Q3HA 2JOAA 5E11A 1SOZA 1WF7A 4JOJA 2EHRA 3CBXA 1YBOA 5HEDA 3GJ9A 4WYUA 2PKTA 1WH1A 3SFJA 1UF1A 4K75A 1G9OA 2H2BA 5HEYA 5HFBA 1P1EA 3KZDA 3L4FD 2HGAA 1TP5A 4Q2PA 3PDVA 2PZDA 1M5ZA 3K50A 2EV8A 4AMHA 5B42A 5E6PB 3R68A 2DAZA 1UJVA 2IWPA 2OGPA 2M10A 3SUZA 1W9EA 2OSGA 2M3MA 2I6VA 5I7ZA 4P0CA 1UJDA 2KJPA 4Q6SA 2OMJA 1WJLA 4UU5A 2CSJA 4EDJA 1OBYA 5D13A 3FY5A 1Q3OA 4JOFA 2R3YA 3QJNA 1NF3C 1N6FA 2X7ZA 2EEIA 3TSZA 3QIKA 3STJA 5GNDA 5HETA 2D8IA 4LMMA 3LNYA 3MH4A 4NMSA 3DJ3A 1TE0A 4K72A 2QG1A 1UEPA 1Y7NA 2D92A 4PQWA 5HFCA 1VAEA 3R0HA 1UEZA 1WIFA 4Q2OA 4R2ZA 2UZCA 2HE2A 5ILBA 2AINA 1Z86A 3ID3A 2EAQA 3PS4A 4NMPA 3BPUA 4GHNA 2JINA 3QE1A 3GSLA 1WHAA 1IU2A 2AWWA 2JXOA 2DC2A 2KBSA 4HOPB 1T2MA 1V5LA 4P2AB 1NTEA 1UEWA 3QGLA 2L4SA 2CSSA 2DMZA 1TP3A 2KAWA 3CS0A 3EGHC 4MPAA 5E1YA 2M0UA 1QAVB 2ENOA 2DM8A 2E7KA 3PV4A 4NMOA 4O06A 4GVDA 2KQFA 2QBWA 4OEPA 2IWQA 2R4HA 5IL9A 2K20A 4FLNA 4E3BA 3JXTA 1RGWA 2M0VA 2JSNA 3NFKA 1WFGA 2FCFA 3B76A 3GCNA 5HEBA 1X5QA 2H2CA 2EDPA 1QLCA 2W4FA 4JJ0A 1U38A 3QDOA 1U3BA 4OAJA 3WKLA 4K6YA 5F67A 2KV8A 3WKMA 1RY4A 2I1NA 2GZVA 2REYA 5HFFA 5HDYA 2OCSA 4JOKA 3E17A 1N7EA 3I4WA 2EGNA 2O2TA 1N7FA 3QJMA 1L6OA 3OTPA 2VZ5A 5H3JA 4Q6HA 5FHTA 4G69A 4JJ3A 2JIKA 2Q9VA 4XHVA 5HFEA 2OS6A 5HF4A 1Z87A 2LA8A 5A2PA 2AWXA 2K1ZA 2IWNA 5GLJA 2F5YA 2MX6A 3QO6A 5E22A 2QKTA 3TMHA 2ZPMA 4E35A 2G2LA 1MFLA 4Q2QA 3ID1A 2EGKA 2KOHA 3CH8A 1X8SA 3RLEA 1Q3PA 2DLUA 3PDZA 1WI4A 2I04A 2VWRA 5G1EA 3K82A 4RI0A 2ZPLA 2EGOA 5G1DA 1KY9A 1U37A 2W7RA 1RZXA 1V5QA 1UJUA 4NMQA 2PKUA 1MFGA 3HVQC 2KRGA 3DORA 1IU0A 1FC9A
chains in the Genus database with same CATH topology
1QAUA 1P1DA 2JWEA 5EZ0A 2KOJA 2FE5A 1I16A 3DJAA 2VPHA 4NMVA 1OBZA 3CYYA 2D90A 3I1EA 4NNLA 2M0TA 3GDSA 1VB7A 2FN5A 2KL1A 3MH6A 2YT7A 3NFLA 1VA8A 5DTHA 3O46A 2VRFA 4KFWA 5EYZA 4UU6A 1UFXA 2OZFA 1K32A 2QKVA 3HPKA 2DKRA 2JILA 4K78A 4REYA 1OZIA 1X9ZA 3NGHA 1BFEA 4GVCA 1WF8A 1X45A 1V6BA 2DB5A 1X6DA 2L97A 3PV5A 4OEOA 4YYXA 1N6EA 1X5RA 2AWUA 2KJDA 2L4TA 3ID4A 1VCWA 1FC7A 4HOPA 4JORA 1R6JA 1GQ4A 1UHPA 4NXRA 3OU0A 3RL8A 2H3MA 1VJ6A 2RRMA 2KJKA 2OQSA 3O5NA 5E21A 1SOTA 1PDRA 2WL7A 4JOHA 2KOMA 2EDZA 2V90A 1UITA 2LUIA 2JREA 1WHDA 1Y8TA 3KDGA 1MC7A 2KPLA 3DIWA 3SOEA 2H3LA 1V1TA 2KYLA 2QT5A 3ZRTA 2RCZA 1TQ3A 2I0LA 1OBXA 3KZEA 3ID2A 3TSWA 1W9QA 3HPMA 4K76A 1GQ5A 4NNMA 4F8KA 1UM7A 4JL7A 4WYTA 1N7TA 3RL7A 4FGMA 4IC6A 2EEHA 1D5GA 2KPKA 3VQGA 2KA9A 3GABA 4NMTA 2Q3GA 4E34A 3CC0A 4JOPA 1V62A 4NMRA 2LC6A 3R69A 2LOBA 2V1WA 2M0ZA 2PNTA 2P3WA 2CS5A 2KG2A 3DJ1A 4KFVA 2LC7A 2Z9IA 3KDKA 1UM1A 1FC6A 4JOGA 2BYGA 4N6XA 5F3XA 3K1RA 1WFVA 3PV2A 3GGEA 2YUYA 5FB8C 4JOEA 1BE9A 2YUBA 1XZ9A 1X5NA 4Z8JA 1ZOKA 1UEQA 2GEFA 2EJYA 2HE4A 2MHOA 1U39A 2VSVA 3KHFA 1KWAA 3GDUA 3SHWA 1Q7XA 3CBYA 4NXQA 2EXGA 1LCYA 1N99A 1N6DA 1I92A 1RGRA 4H11A 4NXPA 5HF1A 3AXAA 2F0AA 5HJ1A 3I18A 2EEGA 4YDPA 2FNEA 1WG6A 1FCFA 1ZUBA 3GDVA 3TSVA 2I0IA 2YT8A 5HFDA 1KEFA 1WI2A 2YTWA 2EEJA 1IHJA 2OPGA 1GM1A 3MH7A 3CBZA 3GCOA 2DLSA 3VQFA 3NCVA 5JXBA 2VSPA 3LNXA 5B6LA 3EGGC 2IWOA 2G5MB 2DJTA 2Z17A 2PDZA 4Q2NA 1B8QA 3SHUA 1QAVA 2I4SA 2QKUA 1W9OA 4L8NA 2PA1A 4Z33A 2EDVA 4Q3HA 2JOAA 5E11A 1SOZA 1WF7A 4JOJA 2EHRA 3CBXA 1YBOA 5HEDA 3GJ9A 4WYUA 2PKTA 1WH1A 3SFJA 1UF1A 4K75A 1G9OA 2H2BA 5HEYA 5HFBA 1P1EA 3KZDA 3L4FD 2HGAA 1TP5A 4Q2PA 3PDVA 2PZDA 1M5ZA 3K50A 2EV8A 4AMHA 5B42A 5E6PB 3R68A 2DAZA 1UJVA 2IWPA 2OGPA 2M10A 3SUZA 1W9EA 2OSGA 2M3MA 2I6VA 5I7ZA 4P0CA 1UJDA 2KJPA 4Q6SA 2OMJA 1WJLA 4UU5A 2CSJA 4EDJA 1OBYA 5D13A 3FY5A 1Q3OA 4JOFA 2R3YA 3QJNA 1NF3C 1N6FA 2X7ZA 2EEIA 3TSZA 3QIKA 3STJA 5GNDA 5HETA 2D8IA 4LMMA 3LNYA 3MH4A 4NMSA 3DJ3A 1TE0A 4K72A 2QG1A 1UEPA 1Y7NA 2D92A 4PQWA 5HFCA 1VAEA 3R0HA 1UEZA 1WIFA 4Q2OA 4R2ZA 2UZCA 2HE2A 5ILBA 2AINA 1Z86A 3ID3A 2EAQA 3PS4A 4NMPA 3BPUA 4GHNA 2JINA 3QE1A 3GSLA 1WHAA 1IU2A 2AWWA 2JXOA 2DC2A 2KBSA 4HOPB 1T2MA 1V5LA 4P2AB 1NTEA 1UEWA 3QGLA 2L4SA 2CSSA 2DMZA 1TP3A 2KAWA 3CS0A 3EGHC 4MPAA 5E1YA 2M0UA 1QAVB 2ENOA 2DM8A 2E7KA 3PV4A 4NMOA 4O06A 4GVDA 2KQFA 2QBWA 4OEPA 2IWQA 2R4HA 5IL9A 2K20A 4FLNA 4E3BA 3JXTA 1RGWA 2M0VA 2JSNA 3NFKA 1WFGA 2FCFA 3B76A 3GCNA 5HEBA 1X5QA 2H2CA 2EDPA 1QLCA 2W4FA 4JJ0A 1U38A 3QDOA 1U3BA 4OAJA 3WKLA 4K6YA 5F67A 2KV8A 3WKMA 1RY4A 2I1NA 2GZVA 2REYA 5HFFA 5HDYA 2OCSA 4JOKA 3E17A 1N7EA 3I4WA 2EGNA 2O2TA 1N7FA 3QJMA 1L6OA 3OTPA 2VZ5A 5H3JA 4Q6HA 5FHTA 4G69A 4JJ3A 2JIKA 2Q9VA 4XHVA 5HFEA 2OS6A 5HF4A 1Z87A 2LA8A 5A2PA 2AWXA 2K1ZA 2IWNA 5GLJA 2F5YA 2MX6A 3QO6A 5E22A 2QKTA 3TMHA 2ZPMA 4E35A 2G2LA 1MFLA 4Q2QA 3ID1A 2EGKA 2KOHA 3CH8A 1X8SA 3RLEA 1Q3PA 2DLUA 3PDZA 1WI4A 2I04A 2VWRA 5G1EA 3K82A 4RI0A 2ZPLA 2EGOA 5G1DA 1KY9A 1U37A 2W7RA 1RZXA 1V5QA 1UJUA 4NMQA 2PKUA 1MFGA 3HVQC 2KRGA 3DORA 1IU0A 1FC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAU A;  1P1D A;  2JWE A;  5EZ0 A;  2KOJ A;  2FE5 A;  1I16 A;  3DJA A;  2VPH A;  4NMV A;  1OBZ A;  3CYY A;  2D90 A;  3I1E A;  4NNL A;  2M0T A;  3GDS A;  1VB7 A;  2FN5 A;  2KL1 A;  3MH6 A;  2YT7 A;  3NFL A;  1VA8 A;  5DTH A;  3O46 A;  2VRF A;  4KFW A;  5EYZ A;  4UU6 A;  1UFX A;  2OZF A;  1K32 A;  2QKV A;  3HPK A;  2DKR A;  2JIL A;  4K78 A;  4REY A;  1OZI A;  3NGH A;  1BFE A;  4GVC A;  1WF8 A;  1X45 A;  1V6B A;  2DB5 A;  1X6D A;  2L97 A;  3PV5 A;  4OEO A;  4YYX A;  1N6E A;  1X5R A;  2AWU A;  2KJD A;  2L4T A;  3ID4 A;  1VCW A;  1FC7 A;  4HOP A;  4JOR A;  1R6J A;  1GQ4 A;  1UHP A;  4NXR A;  3OU0 A;  3RL8 A;  2H3M A;  1VJ6 A;  2RRM A;  2KJK A;  2OQS A;  3O5N A;  5E21 A;  1SOT A;  1PDR A;  2WL7 A;  4JOH A;  2KOM A;  2EDZ A;  2V90 A;  1UIT A;  2LUI A;  2JRE A;  1WHD A;  1Y8T A;  1MC7 A;  2KPL A;  3DIW A;  3SOE A;  2H3L A;  1V1T A;  2KYL A;  2QT5 A;  3ZRT A;  2RCZ A;  1TQ3 A;  2I0L A;  1OBX A;  3KZE A;  3ID2 A;  3TSW A;  1W9Q A;  3HPM A;  4K76 A;  1GQ5 A;  4NNM A;  4F8K A;  1UM7 A;  4JL7 A;  4WYT A;  1N7T A;  3RL7 A;  4FGM A;  4IC6 A;  2EEH A;  1D5G A;  2KPK A;  3VQG A;  2KA9 A;  4NMT A;  2Q3G A;  4E34 A;  3CC0 A;  4JOP A;  1V62 A;  4NMR A;  2LC6 A;  3R69 A;  2LOB A;  2V1W A;  2M0Z A;  2PNT A;  2P3W A;  2CS5 A;  2KG2 A;  3DJ1 A;  4KFV A;  2LC7 A;  2Z9I A;  1UM1 A;  1FC6 A;  4JOG A;  2BYG A;  4N6X A;  5F3X A;  3K1R A;  1WFV A;  3PV2 A;  3GGE A;  2YUY A;  5FB8 C;  4JOE A;  1BE9 A;  2YUB A;  1XZ9 A;  1X5N A;  4Z8J A;  1ZOK A;  1UEQ A;  2HE4 A;  2EJY A;  2MHO A;  1U39 A;  2VSV A;  3KHF A;  1KWA A;  3GDU A;  3SHW A;  1Q7X A;  3CBY A;  4NXQ A;  2EXG A;  1LCY A;  1N99 A;  1N6D A;  1I92 A;  1RGR A;  4H11 A;  4NXP A;  5HF1 A;  3AXA A;  2F0A A;  5HJ1 A;  3I18 A;  2EEG A;  4YDP A;  2FNE A;  1WG6 A;  1FCF A;  1ZUB A;  3GDV A;  3TSV A;  2I0I A;  2YT8 A;  5HFD A;  1KEF A;  1WI2 A;  2YTW A;  2EEJ A;  1IHJ A;  2OPG A;  1GM1 A;  3MH7 A;  3CBZ A;  3GCO A;  2DLS A;  3VQF A;  5JXB A;  2VSP A;  3LNX A;  5B6L A;  3EGG C;  2IWO A;  2G5M B;  2DJT A;  2Z17 A;  2PDZ A;  4Q2N A;  1B8Q A;  3SHU A;  1QAV A;  2I4S A;  2QKU A;  1W9O A;  4L8N A;  2PA1 A;  4Z33 A;  2EDV A;  4Q3H A;  2JOA A;  5E11 A;  1SOZ A;  1WF7 A;  4JOJ A;  2EHR A;  3CBX A;  1YBO A;  5HED A;  3GJ9 A;  4WYU A;  2PKT A;  1WH1 A;  3SFJ A;  1UF1 A;  4K75 A;  1G9O A;  2H2B A;  5HEY A;  5HFB A;  1P1E A;  3KZD A;  3L4F D;  2HGA A;  1TP5 A;  4Q2P A;  3PDV A;  2PZD A;  1M5Z A;  3K50 A;  2EV8 A;  4AMH A;  5E6P B;  3R68 A;  2DAZ A;  1UJV A;  2IWP A;  2OGP A;  2M10 A;  3SUZ A;  1W9E A;  2OSG A;  2M3M A;  2I6V A;  5I7Z A;  4P0C A;  1UJD A;  2KJP A;  4Q6S A;  2OMJ A;  1WJL A;  4UU5 A;  2CSJ A;  4EDJ A;  1OBY A;  5D13 A;  3FY5 A;  1Q3O A;  4JOF A;  2R3Y A;  3QJN A;  1NF3 C;  1N6F A;  2X7Z A;  2EEI A;  3TSZ A;  3QIK A;  3STJ A;  5GND A;  5HET A;  2D8I A;  4LMM A;  3LNY A;  3MH4 A;  4NMS A;  3DJ3 A;  1TE0 A;  4K72 A;  2QG1 A;  1UEP A;  1Y7N A;  2D92 A;  4PQW A;  5HFC A;  1VAE A;  3R0H A;  1UEZ A;  1WIF A;  4Q2O A;  4R2Z A;  2UZC A;  2HE2 A;  2AIN A;  1Z86 A;  3ID3 A;  2EAQ A;  3PS4 A;  4NMP A;  3BPU A;  4GHN A;  2JIN A;  3QE1 A;  3GSL A;  1WHA A;  1IU2 A;  2AWW A;  2JXO A;  2DC2 A;  2KBS A;  4HOP B;  1T2M A;  1V5L A;  4P2A B;  1NTE A;  1UEW A;  3QGL A;  2L4S A;  2CSS A;  2DMZ A;  1TP3 A;  2KAW A;  3CS0 A;  3EGH C;  4MPA A;  5E1Y A;  2M0U A;  1QAV B;  2ENO A;  2DM8 A;  2E7K A;  3PV4 A;  4NMO A;  4O06 A;  4GVD A;  2KQF A;  2QBW A;  4OEP A;  2IWQ A;  2R4H A;  2K20 A;  4E3B A;  3JXT A;  1RGW A;  2M0V A;  3NFK A;  1WFG A;  2FCF A;  3B76 A;  3GCN A;  5HEB A;  1X5Q A;  2H2C A;  2EDP A;  1QLC A;  2W4F A;  1U38 A;  3QDO A;  1U3B A;  4OAJ A;  3WKL A;  4K6Y A;  5F67 A;  2KV8 A;  3WKM A;  1RY4 A;  2I1N A;  2GZV A;  2REY A;  5HFF A;  5HDY A;  2OCS A;  4JOK A;  3E17 A;  1N7E A;  3I4W A;  2EGN A;  2O2T A;  1N7F A;  3QJM A;  1L6O A;  3OTP A;  2VZ5 A;  5H3J A;  4Q6H A;  5FHT A;  4G69 A;  2JIK A;  2Q9V A;  4XHV A;  5HFE A;  2OS6 A;  5HF4 A;  1Z87 A;  2LA8 A;  5A2P A;  2AWX A;  2K1Z A;  2IWN A;  5GLJ A;  2F5Y A;  2MX6 A;  3QO6 A;  5E22 A;  2QKT A;  3TMH A;  2ZPM A;  4E35 A;  2G2L A;  1MFL A;  4Q2Q A;  3ID1 A;  2EGK A;  2KOH A;  3CH8 A;  1X8S A;  3RLE A;  1Q3P A;  2DLU A;  3PDZ A;  1WI4 A;  2I04 A;  2VWR A;  5G1E A;  3K82 A;  4RI0 A;  2ZPL A;  2EGO A;  5G1D A;  1KY9 A;  1U37 A;  2W7R A;  1RZX A;  1V5Q A;  1UJU A;  4NMQ A;  2PKU A;  1MFG A;  3HVQ C;  2KRG A;  3DOR A;  1IU0 A;  1FC9 A; 
#chains in the Genus database with same CATH topology
 1QAU A;  1P1D A;  2JWE A;  5EZ0 A;  2KOJ A;  2FE5 A;  1I16 A;  3DJA A;  2VPH A;  4NMV A;  1OBZ A;  3CYY A;  2D90 A;  3I1E A;  4NNL A;  2M0T A;  3GDS A;  1VB7 A;  2FN5 A;  2KL1 A;  3MH6 A;  2YT7 A;  3NFL A;  1VA8 A;  5DTH A;  3O46 A;  2VRF A;  4KFW A;  5EYZ A;  4UU6 A;  1UFX A;  2OZF A;  1K32 A;  2QKV A;  3HPK A;  2DKR A;  2JIL A;  4K78 A;  4REY A;  1OZI A;  1X9Z A;  3NGH A;  1BFE A;  4GVC A;  1WF8 A;  1X45 A;  1V6B A;  2DB5 A;  1X6D A;  2L97 A;  3PV5 A;  4OEO A;  4YYX A;  1N6E A;  1X5R A;  2AWU A;  2KJD A;  2L4T A;  3ID4 A;  1VCW A;  1FC7 A;  4HOP A;  4JOR A;  1R6J A;  1GQ4 A;  1UHP A;  4NXR A;  3OU0 A;  3RL8 A;  2H3M A;  1VJ6 A;  2RRM A;  2KJK A;  2OQS A;  3O5N A;  5E21 A;  1SOT A;  1PDR A;  2WL7 A;  4JOH A;  2KOM A;  2EDZ A;  2V90 A;  1UIT A;  2LUI A;  2JRE A;  1WHD A;  1Y8T A;  3KDG A;  1MC7 A;  2KPL A;  3DIW A;  3SOE A;  2H3L A;  1V1T A;  2KYL A;  2QT5 A;  3ZRT A;  2RCZ A;  1TQ3 A;  2I0L A;  1OBX A;  3KZE A;  3ID2 A;  3TSW A;  1W9Q A;  3HPM A;  4K76 A;  1GQ5 A;  4NNM A;  4F8K A;  1UM7 A;  4JL7 A;  4WYT A;  1N7T A;  3RL7 A;  4FGM A;  4IC6 A;  2EEH A;  1D5G A;  2KPK A;  3VQG A;  2KA9 A;  3GAB A;  4NMT A;  2Q3G A;  4E34 A;  3CC0 A;  4JOP A;  1V62 A;  4NMR A;  2LC6 A;  3R69 A;  2LOB A;  2V1W A;  2M0Z A;  2PNT A;  2P3W A;  2CS5 A;  2KG2 A;  3DJ1 A;  4KFV A;  2LC7 A;  2Z9I A;  3KDK A;  1UM1 A;  1FC6 A;  4JOG A;  2BYG A;  4N6X A;  5F3X A;  3K1R A;  1WFV A;  3PV2 A;  3GGE A;  2YUY A;  5FB8 C;  4JOE A;  1BE9 A;  2YUB A;  1XZ9 A;  1X5N A;  4Z8J A;  1ZOK A;  1UEQ A;  2GEF A;  2EJY A;  2HE4 A;  2MHO A;  1U39 A;  2VSV A;  3KHF A;  1KWA A;  3GDU A;  3SHW A;  1Q7X A;  3CBY A;  4NXQ A;  2EXG A;  1LCY A;  1N99 A;  1N6D A;  1I92 A;  1RGR A;  4H11 A;  4NXP A;  5HF1 A;  3AXA A;  2F0A A;  5HJ1 A;  3I18 A;  2EEG A;  4YDP A;  2FNE A;  1WG6 A;  1FCF A;  1ZUB A;  3GDV A;  3TSV A;  2I0I A;  2YT8 A;  5HFD A;  1KEF A;  1WI2 A;  2YTW A;  2EEJ A;  1IHJ A;  2OPG A;  1GM1 A;  3MH7 A;  3CBZ A;  3GCO A;  2DLS A;  3VQF A;  3NCV A;  5JXB A;  2VSP A;  3LNX A;  5B6L A;  3EGG C;  2IWO A;  2G5M B;  2DJT A;  2Z17 A;  2PDZ A;  4Q2N A;  1B8Q A;  3SHU A;  1QAV A;  2I4S A;  2QKU A;  1W9O A;  4L8N A;  2PA1 A;  4Z33 A;  2EDV A;  4Q3H A;  2JOA A;  5E11 A;  1SOZ A;  1WF7 A;  4JOJ A;  2EHR A;  3CBX A;  1YBO A;  5HED A;  3GJ9 A;  4WYU A;  2PKT A;  1WH1 A;  3SFJ A;  1UF1 A;  4K75 A;  1G9O A;  2H2B A;  5HEY A;  5HFB A;  1P1E A;  3KZD A;  3L4F D;  2HGA A;  1TP5 A;  4Q2P A;  3PDV A;  2PZD A;  1M5Z A;  3K50 A;  2EV8 A;  4AMH A;  5B42 A;  5E6P B;  3R68 A;  2DAZ A;  1UJV A;  2IWP A;  2OGP A;  2M10 A;  3SUZ A;  1W9E A;  2OSG A;  2M3M A;  2I6V A;  5I7Z A;  4P0C A;  1UJD A;  2KJP A;  4Q6S A;  2OMJ A;  1WJL A;  4UU5 A;  2CSJ A;  4EDJ A;  1OBY A;  5D13 A;  3FY5 A;  1Q3O A;  4JOF A;  2R3Y A;  3QJN A;  1NF3 C;  1N6F A;  2X7Z A;  2EEI A;  3TSZ A;  3QIK A;  3STJ A;  5GND A;  5HET A;  2D8I A;  4LMM A;  3LNY A;  3MH4 A;  4NMS A;  3DJ3 A;  1TE0 A;  4K72 A;  2QG1 A;  1UEP A;  1Y7N A;  2D92 A;  4PQW A;  5HFC A;  1VAE A;  3R0H A;  1UEZ A;  1WIF A;  4Q2O A;  4R2Z A;  2UZC A;  2HE2 A;  5ILB A;  2AIN A;  1Z86 A;  3ID3 A;  2EAQ A;  3PS4 A;  4NMP A;  3BPU A;  4GHN A;  2JIN A;  3QE1 A;  3GSL A;  1WHA A;  1IU2 A;  2AWW A;  2JXO A;  2DC2 A;  2KBS A;  4HOP B;  1T2M A;  1V5L A;  4P2A B;  1NTE A;  1UEW A;  3QGL A;  2L4S A;  2CSS A;  2DMZ A;  1TP3 A;  2KAW A;  3CS0 A;  3EGH C;  4MPA A;  5E1Y A;  2M0U A;  1QAV B;  2ENO A;  2DM8 A;  2E7K A;  3PV4 A;  4NMO A;  4O06 A;  4GVD A;  2KQF A;  2QBW A;  4OEP A;  2IWQ A;  2R4H A;  5IL9 A;  2K20 A;  4FLN A;  4E3B A;  3JXT A;  1RGW A;  2M0V A;  2JSN A;  3NFK A;  1WFG A;  2FCF A;  3B76 A;  3GCN A;  5HEB A;  1X5Q A;  2H2C A;  2EDP A;  1QLC A;  2W4F A;  4JJ0 A;  1U38 A;  3QDO A;  1U3B A;  4OAJ A;  3WKL A;  4K6Y A;  5F67 A;  2KV8 A;  3WKM A;  1RY4 A;  2I1N A;  2GZV A;  2REY A;  5HFF A;  5HDY A;  2OCS A;  4JOK A;  3E17 A;  1N7E A;  3I4W A;  2EGN A;  2O2T A;  1N7F A;  3QJM A;  1L6O A;  3OTP A;  2VZ5 A;  5H3J A;  4Q6H A;  5FHT A;  4G69 A;  4JJ3 A;  2JIK A;  2Q9V A;  4XHV A;  5HFE A;  2OS6 A;  5HF4 A;  1Z87 A;  2LA8 A;  5A2P A;  2AWX A;  2K1Z A;  2IWN A;  5GLJ A;  2F5Y A;  2MX6 A;  3QO6 A;  5E22 A;  2QKT A;  3TMH A;  2ZPM A;  4E35 A;  2G2L A;  1MFL A;  4Q2Q A;  3ID1 A;  2EGK A;  2KOH A;  3CH8 A;  1X8S A;  3RLE A;  1Q3P A;  2DLU A;  3PDZ A;  1WI4 A;  2I04 A;  2VWR A;  5G1E A;  3K82 A;  4RI0 A;  2ZPL A;  2EGO A;  5G1D A;  1KY9 A;  1U37 A;  2W7R A;  1RZX A;  1V5Q A;  1UJU A;  4NMQ A;  2PKU A;  1MFG A;  3HVQ C;  2KRG A;  3DOR A;  1IU0 A;  1FC9 A; 
#chains in the Genus database with same CATH homology
 1QAU A;  1P1D A;  2JWE A;  5EZ0 A;  2KOJ A;  2FE5 A;  1I16 A;  3DJA A;  2VPH A;  4NMV A;  1OBZ A;  3CYY A;  2D90 A;  3I1E A;  4NNL A;  2M0T A;  3GDS A;  1VB7 A;  2FN5 A;  2KL1 A;  3MH6 A;  2YT7 A;  3NFL A;  1VA8 A;  5DTH A;  3O46 A;  2VRF A;  4KFW A;  5EYZ A;  4UU6 A;  1UFX A;  2OZF A;  1K32 A;  2QKV A;  3HPK A;  2DKR A;  2JIL A;  4K78 A;  4REY A;  1OZI A;  1X9Z A;  3NGH A;  1BFE A;  4GVC A;  1WF8 A;  1X45 A;  1V6B A;  2DB5 A;  1X6D A;  2L97 A;  3PV5 A;  4OEO A;  4YYX A;  1N6E A;  1X5R A;  2AWU A;  2KJD A;  2L4T A;  3ID4 A;  1VCW A;  1FC7 A;  4HOP A;  4JOR A;  1R6J A;  1GQ4 A;  1UHP A;  4NXR A;  3OU0 A;  3RL8 A;  2H3M A;  1VJ6 A;  2RRM A;  2KJK A;  2OQS A;  3O5N A;  5E21 A;  1SOT A;  1PDR A;  2WL7 A;  4JOH A;  2KOM A;  2EDZ A;  2V90 A;  1UIT A;  2LUI A;  2JRE A;  1WHD A;  1Y8T A;  3KDG A;  1MC7 A;  2KPL A;  3DIW A;  3SOE A;  2H3L A;  1V1T A;  2KYL A;  2QT5 A;  3ZRT A;  2RCZ A;  1TQ3 A;  2I0L A;  1OBX A;  3KZE A;  3ID2 A;  3TSW A;  1W9Q A;  3HPM A;  4K76 A;  1GQ5 A;  4NNM A;  4F8K A;  1UM7 A;  4JL7 A;  4WYT A;  1N7T A;  3RL7 A;  4FGM A;  4IC6 A;  2EEH A;  1D5G A;  2KPK A;  3VQG A;  2KA9 A;  3GAB A;  4NMT A;  2Q3G A;  4E34 A;  3CC0 A;  4JOP A;  1V62 A;  4NMR A;  2LC6 A;  3R69 A;  2LOB A;  2V1W A;  2M0Z A;  2PNT A;  2P3W A;  2CS5 A;  2KG2 A;  3DJ1 A;  4KFV A;  2LC7 A;  2Z9I A;  3KDK A;  1UM1 A;  1FC6 A;  4JOG A;  2BYG A;  4N6X A;  5F3X A;  3K1R A;  1WFV A;  3PV2 A;  3GGE A;  2YUY A;  5FB8 C;  4JOE A;  1BE9 A;  2YUB A;  1XZ9 A;  1X5N A;  4Z8J A;  1ZOK A;  1UEQ A;  2GEF A;  2EJY A;  2HE4 A;  2MHO A;  1U39 A;  2VSV A;  3KHF A;  1KWA A;  3GDU A;  3SHW A;  1Q7X A;  3CBY A;  4NXQ A;  2EXG A;  1LCY A;  1N99 A;  1N6D A;  1I92 A;  1RGR A;  4H11 A;  4NXP A;  5HF1 A;  3AXA A;  2F0A A;  5HJ1 A;  3I18 A;  2EEG A;  4YDP A;  2FNE A;  1WG6 A;  1FCF A;  1ZUB A;  3GDV A;  3TSV A;  2I0I A;  2YT8 A;  5HFD A;  1KEF A;  1WI2 A;  2YTW A;  2EEJ A;  1IHJ A;  2OPG A;  1GM1 A;  3MH7 A;  3CBZ A;  3GCO A;  2DLS A;  3VQF A;  3NCV A;  5JXB A;  2VSP A;  3LNX A;  5B6L A;  3EGG C;  2IWO A;  2G5M B;  2DJT A;  2Z17 A;  2PDZ A;  4Q2N A;  1B8Q A;  3SHU A;  1QAV A;  2I4S A;  2QKU A;  1W9O A;  4L8N A;  2PA1 A;  4Z33 A;  2EDV A;  4Q3H A;  2JOA A;  5E11 A;  1SOZ A;  1WF7 A;  4JOJ A;  2EHR A;  3CBX A;  1YBO A;  5HED A;  3GJ9 A;  4WYU A;  2PKT A;  1WH1 A;  3SFJ A;  1UF1 A;  4K75 A;  1G9O A;  2H2B A;  5HEY A;  5HFB A;  1P1E A;  3KZD A;  3L4F D;  2HGA A;  1TP5 A;  4Q2P A;  3PDV A;  2PZD A;  1M5Z A;  3K50 A;  2EV8 A;  4AMH A;  5B42 A;  5E6P B;  3R68 A;  2DAZ A;  1UJV A;  2IWP A;  2OGP A;  2M10 A;  3SUZ A;  1W9E A;  2OSG A;  2M3M A;  2I6V A;  5I7Z A;  4P0C A;  1UJD A;  2KJP A;  4Q6S A;  2OMJ A;  1WJL A;  4UU5 A;  2CSJ A;  4EDJ A;  1OBY A;  5D13 A;  3FY5 A;  1Q3O A;  4JOF A;  2R3Y A;  3QJN A;  1NF3 C;  1N6F A;  2X7Z A;  2EEI A;  3TSZ A;  3QIK A;  3STJ A;  5GND A;  5HET A;  2D8I A;  4LMM A;  3LNY A;  3MH4 A;  4NMS A;  3DJ3 A;  1TE0 A;  4K72 A;  2QG1 A;  1UEP A;  1Y7N A;  2D92 A;  4PQW A;  5HFC A;  1VAE A;  3R0H A;  1UEZ A;  1WIF A;  4Q2O A;  4R2Z A;  2UZC A;  2HE2 A;  5ILB A;  2AIN A;  1Z86 A;  3ID3 A;  2EAQ A;  3PS4 A;  4NMP A;  3BPU A;  4GHN A;  2JIN A;  3QE1 A;  3GSL A;  1WHA A;  1IU2 A;  2AWW A;  2JXO A;  2DC2 A;  2KBS A;  4HOP B;  1T2M A;  1V5L A;  4P2A B;  1NTE A;  1UEW A;  3QGL A;  2L4S A;  2CSS A;  2DMZ A;  1TP3 A;  2KAW A;  3CS0 A;  3EGH C;  4MPA A;  5E1Y A;  2M0U A;  1QAV B;  2ENO A;  2DM8 A;  2E7K A;  3PV4 A;  4NMO A;  4O06 A;  4GVD A;  2KQF A;  2QBW A;  4OEP A;  2IWQ A;  2R4H A;  5IL9 A;  2K20 A;  4FLN A;  4E3B A;  3JXT A;  1RGW A;  2M0V A;  2JSN A;  3NFK A;  1WFG A;  2FCF A;  3B76 A;  3GCN A;  5HEB A;  1X5Q A;  2H2C A;  2EDP A;  1QLC A;  2W4F A;  4JJ0 A;  1U38 A;  3QDO A;  1U3B A;  4OAJ A;  3WKL A;  4K6Y A;  5F67 A;  2KV8 A;  3WKM A;  1RY4 A;  2I1N A;  2GZV A;  2REY A;  5HFF A;  5HDY A;  2OCS A;  4JOK A;  3E17 A;  1N7E A;  3I4W A;  2EGN A;  2O2T A;  1N7F A;  3QJM A;  1L6O A;  3OTP A;  2VZ5 A;  5H3J A;  4Q6H A;  5FHT A;  4G69 A;  4JJ3 A;  2JIK A;  2Q9V A;  4XHV A;  5HFE A;  2OS6 A;  5HF4 A;  1Z87 A;  2LA8 A;  5A2P A;  2AWX A;  2K1Z A;  2IWN A;  5GLJ A;  2F5Y A;  2MX6 A;  3QO6 A;  5E22 A;  2QKT A;  3TMH A;  2ZPM A;  4E35 A;  2G2L A;  1MFL A;  4Q2Q A;  3ID1 A;  2EGK A;  2KOH A;  3CH8 A;  1X8S A;  3RLE A;  1Q3P A;  2DLU A;  3PDZ A;  1WI4 A;  2I04 A;  2VWR A;  5G1E A;  3K82 A;  4RI0 A;  2ZPL A;  2EGO A;  5G1D A;  1KY9 A;  1U37 A;  2W7R A;  1RZX A;  1V5Q A;  1UJU A;  4NMQ A;  2PKU A;  1MFG A;  3HVQ C;  2KRG A;  3DOR A;  1IU0 A;  1FC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...