1OBZA

Crystal structure of the complex of the pdz tandem of syntenin with an interleukin 5 receptor alpha peptide.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
163
structure length
163
Chain Sequence
DPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTENIN 1
publication title Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 36
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1obzA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1obzA01
1VJ6A 2YT7A 5I7ZA 1QAVB 2EDVA 4NMPA 3WKMA 3R0HA 2KBSA 5HEDA 3VQGA 1D5GA 1SOZA 2EAQA 2ZPLA 2JREA 4NNLA 3GGEA 2QKVA 3STJA 3MH7A 1UJDA 1KWAA 3NFKA 1X5NA 3AXAA 2DMZA 4G69A 1FCFA 4GHNA 2KJPA 1OBZA 2EDZA 2HE4A 4WYTA 2E7KA 1X5QA 4JOJA 2M0UA 1WI4A 3PV5A 3FY5A 3NGHA 2HGAA 4JORA 2MX6A 2ZPMA 1IHJA 1W9QA 3I4WA 2DJTA 3OU0A 3NFLA 2LA8A 2D90A 2L4SA 4K78A 2EEJA 1X6DA 4KFVA 3EGHC 3PDZA 5HJ1A 2JOAA 2AWUA 4REYA 1VCWA 1KEFA 2Z17A 3WKLA 5F3XA 4YDPA 3DJ3A 3SOEA 2L97A 3DIWA 1MC7A 2RCZA 1NTEA 2F5YA 3SFJA 1FC9A 2KOJA 2EEHA 5HFFA 3RL7A 4UU5A 3RL8A 2R4HA 2LC6A 2EEIA 1ZOKA 4N6XA 3K82A 4NXPA 2EGNA 2KQFA 1ZUBA 3HPKA 1BE9A 2EXGA 1WG6A 4Q2OA 3EGGC 1P1EA 2OCSA 5JXBA 5DTHA 5F67A 4EDJA 3KZDA 1WFVA 1V1TA 1N6EA 1Q3PA 2H3MA 5E1YA 2W7RA 2H2BA 4KFWA 2M10A 2DC2A 2DB5A 2W4FA 4LMMA 1G9OA 3LNXA 2I0IA 3TSZA 2JIKA 4GVCA 3QIKA 1N7FA 3QDOA 4E34A 4UU6A 2EJYA 3GDSA 1WF8A 1UM1A 3QJMA 1I92A 1N6FA 3E17A 2IWNA 3LNYA 2YUBA 1UJVA 3CC0A 1V5LA 2QBWA 2V1WA 3R69A 2PKTA 2G5MB 4NMQA 4Q6SA 2KAWA 3K1RA 1PDRA 2JINA 1R6JA 2EGOA 2EDPA 5EZ0A 2QG1A 2LUIA 2L4TA 3VQFA 2I4SA 3KZEA 1M5ZA 1UFXA 2F0AA 2DLUA 1X45A 5HDYA 1KY9A 2KA9A 3RLEA 1IU2A 1FC6A 1UEZA 2EV8A 2P3WA 5A2PA 5E21A 2I0LA 3CH8A 4NNMA 5E22A 2KPKA 1WI2A 2IWQA 2JILA 4JOPA 3PV4A 2H3LA 2I1NA 2EGKA 5E6PB 3ZRTA 2PNTA 1Z86A 5B6LA 3I18A 5HETA 2OPGA 1BFEA 3B76A 3BPUA 2OGPA 2OQSA 2MHOA 1QAUA 3TMHA 2AWWA 2Q3GA 2QKUA 1Q7XA 2YTWA 2V90A 5HEYA 4K6YA 3PV2A 3R68A 1N7EA 3TSVA 2DKRA 2IWPA 4OEOA 2H2CA 1LCYA 2HE2A 4Q2PA 4L8NA 4AMHA 3QGLA 1MFLA 5E11A 4HOPB 2GZVA 2DAZA 2OSGA 3O5NA 2KV8A 5G1EA 4NMSA 3CBXA 4NXRA 2KOHA 5HFDA 2OS6A 3KHFA 4NMVA 1OZIA 1TP3A 1U3BA 1TP5A 1UM7A 2KL1A 1X5RA 2FN5A 4Z8JA 1V6BA 4H11A 4F8KA 1VAEA 3DORA 4JOGA 2KOMA 2BYGA 5HFCA 4PQWA 2QT5A 1W9OA 1RGWA 1OBXA 1WF7A 1UEPA 2JXOA 4K72A 1UJUA 2VPHA 4WYUA 1T2MA 4RI0A 1TE0A 3GSLA 3OTPA 5HF4A 1I16A 2R3YA 2I04A 1N7TA 2YT8A 1GQ4A 2PKUA 4Q2QA 2YUYA 4Q2NA 5H3JA 5GNDA 1TQ3A 1VA8A 3MH6A 1W9EA 4O06A 1Y8TA 2M0ZA 2M3MA 3CBZA 5HFEA 5D13A 1UEQA 1WFGA 4IC6A 2FNEA 3ID1A 1VB7A 2EHRA 2CSSA 1WHAA 3ID2A 4MPAA 1V62A 2VRFA 2X7ZA 3GCNA 3PDVA 4OEPA 4JL7A 3SUZA 2KYLA 4K75A 2CSJA 2LOBA 5HEBA 3DJAA 2KJDA 3HPMA 4R2ZA 4Z33A 1UF1A 1U38A 3HVQC 4E3BA 4JOKA 1GQ5A 4JOEA 3GJ9A 1RY4A 1NF3C 5GLJA 2DLSA 5EYZA 3L4FD 2OMJA 1V5QA 1RZXA 1QLCA 3PS4A 1WHDA 1WJLA 2WL7A 3O46A 2ENOA 1N6DA 2VSVA 2JWEA 5FB8C 3K50A 2G2LA 3QJNA 2Z9IA 2D8IA 4NMOA 2KG2A 3TSWA 1QAVA 4NMTA 2D92A 2KJKA 1X8SA 2KRGA 1U37A 1YBOA 1FC7A 1Z87A 1SOTA 5G1DA 2M0TA 2Q9VA 2M0VA 1UEWA 1WIFA 2K20A 1UHPA 1N99A 2K1ZA 4FGMA 1P1DA 1WH1A 4Q6HA 3I1EA 4Q3HA 1U39A 4NXQA 4OAJA 2QKTA 2VWRA 4GVDA 2LC7A 5HF1A 2PZDA 3GDVA 2DM8A 3CBYA 2IWOA 2PDZA 2O2TA 1K32A 3JXTA 2REYA 1IU0A 3DJ1A 3SHUA 4K76A 2CS5A 5HFBA 2OZFA 3GCOA 2FCFA 1Y7NA 3SHWA 4P2AB 1XZ9A 3ID3A 1OBYA 2AWXA 4E35A 2VZ5A 3ID4A 1Q3OA 3CYYA 2KPLA 4JOHA 4XHVA 2RRMA 1GM1A 1RGRA 4YYXA 3GDUA 1B8QA 1L6OA 3QO6A 3CS0A 1MFGA 4JOFA 3MH4A 2I6VA 3QE1A 2EEGA 2VSPA 2FE5A 2AINA 2PA1A 5FHTA 4P0CA 2UZCA 4NMRA 4HOPA 1UITA
chains in the Genus database with same CATH superfamily
1VJ6A 2YT7A 5I7ZA 1QAVB 2EDVA 4NMPA 3WKMA 3R0HA 2KBSA 5HEDA 3VQGA 1D5GA 1SOZA 2EAQA 2ZPLA 2JREA 4NNLA 3GGEA 2GEFA 2QKVA 3STJA 3MH7A 1UJDA 1KWAA 3NFKA 1X5NA 3AXAA 2DMZA 4G69A 1FCFA 4GHNA 2KJPA 1OBZA 2EDZA 2HE4A 3GABA 4WYTA 4JJ3A 2E7KA 1X5QA 4JOJA 2M0UA 1WI4A 3PV5A 3FY5A 5ILBA 3NGHA 2HGAA 4JORA 2MX6A 2ZPMA 1IHJA 1W9QA 3I4WA 2DJTA 3OU0A 3NFLA 2LA8A 2D90A 2L4SA 4K78A 2EEJA 1X6DA 2JSNA 4KFVA 3EGHC 3PDZA 5HJ1A 2JOAA 2AWUA 4REYA 1VCWA 1KEFA 2Z17A 3WKLA 5F3XA 4YDPA 3DJ3A 3SOEA 2L97A 3DIWA 1MC7A 2RCZA 1NTEA 2F5YA 3SFJA 1FC9A 2KOJA 2EEHA 5HFFA 3RL7A 4UU5A 3RL8A 2R4HA 2LC6A 2EEIA 1ZOKA 4N6XA 3K82A 4NXPA 2EGNA 2KQFA 1ZUBA 3HPKA 1BE9A 2EXGA 1WG6A 4Q2OA 3EGGC 1P1EA 2OCSA 5B42A 5JXBA 5DTHA 5F67A 4EDJA 3KZDA 1WFVA 1V1TA 1N6EA 1Q3PA 2H3MA 5E1YA 2W7RA 2H2BA 4KFWA 2M10A 2DC2A 2DB5A 2W4FA 4LMMA 1G9OA 3LNXA 2I0IA 3TSZA 2JIKA 4GVCA 3QIKA 1N7FA 3QDOA 4E34A 4UU6A 2EJYA 3GDSA 1WF8A 1UM1A 3QJMA 1I92A 1N6FA 3E17A 2IWNA 3LNYA 2YUBA 1UJVA 3CC0A 1V5LA 2QBWA 2V1WA 3R69A 1X9ZA 2PKTA 2G5MB 4NMQA 4Q6SA 2KAWA 3K1RA 1PDRA 2JINA 1R6JA 2EGOA 2EDPA 5EZ0A 2QG1A 2LUIA 4FLNA 2L4TA 3VQFA 2I4SA 3KZEA 1M5ZA 1UFXA 2F0AA 2DLUA 1X45A 5HDYA 1KY9A 2KA9A 3RLEA 1IU2A 1FC6A 1UEZA 2EV8A 2P3WA 5A2PA 5E21A 2I0LA 3CH8A 4NNMA 5E22A 2KPKA 1WI2A 2IWQA 2JILA 4JOPA 3PV4A 2H3LA 2I1NA 2EGKA 5E6PB 3ZRTA 2PNTA 1Z86A 5B6LA 3I18A 5HETA 2OPGA 1BFEA 3B76A 3BPUA 2OGPA 2OQSA 2MHOA 1QAUA 3TMHA 2AWWA 2Q3GA 2QKUA 1Q7XA 2YTWA 2V90A 5HEYA 4K6YA 3PV2A 3R68A 1N7EA 3TSVA 2DKRA 2IWPA 4OEOA 2H2CA 1LCYA 2HE2A 4Q2PA 4L8NA 4AMHA 3QGLA 1MFLA 5E11A 4HOPB 2GZVA 2DAZA 2OSGA 3O5NA 2KV8A 5G1EA 4NMSA 3CBXA 4NXRA 2KOHA 5HFDA 3KDKA 2OS6A 3KHFA 4NMVA 1OZIA 1TP3A 3NCVA 1U3BA 1TP5A 4JJ0A 1UM7A 2KL1A 1X5RA 2FN5A 4Z8JA 1V6BA 4H11A 4F8KA 1VAEA 3DORA 4JOGA 2KOMA 2BYGA 5HFCA 4PQWA 2QT5A 1W9OA 1RGWA 1OBXA 1WF7A 1UEPA 2JXOA 4K72A 1UJUA 2VPHA 4WYUA 1T2MA 4RI0A 1TE0A 3GSLA 3OTPA 5HF4A 1I16A 2R3YA 2I04A 1N7TA 2YT8A 1GQ4A 2PKUA 4Q2QA 2YUYA 4Q2NA 5H3JA 5GNDA 1TQ3A 1VA8A 3MH6A 1W9EA 4O06A 1Y8TA 2M0ZA 2M3MA 3CBZA 5IL9A 5HFEA 5D13A 1UEQA 1WFGA 4IC6A 2FNEA 3ID1A 1VB7A 2EHRA 2CSSA 1WHAA 3ID2A 4MPAA 1V62A 2VRFA 2X7ZA 3GCNA 3PDVA 4OEPA 4JL7A 3SUZA 2KYLA 4K75A 2CSJA 2LOBA 5HEBA 3DJAA 2KJDA 3HPMA 4R2ZA 4Z33A 1UF1A 1U38A 3HVQC 4E3BA 4JOKA 1GQ5A 4JOEA 3GJ9A 1RY4A 1NF3C 5GLJA 2DLSA 5EYZA 3L4FD 2OMJA 1V5QA 1RZXA 1QLCA 3PS4A 1WHDA 1WJLA 2WL7A 3O46A 2ENOA 1N6DA 2VSVA 2JWEA 5FB8C 3K50A 2G2LA 3QJNA 2Z9IA 2D8IA 4NMOA 2KG2A 3TSWA 1QAVA 4NMTA 2D92A 2KJKA 1X8SA 2KRGA 1U37A 1YBOA 1FC7A 1Z87A 1SOTA 5G1DA 2M0TA 2Q9VA 2M0VA 1UEWA 1WIFA 2K20A 1UHPA 1N99A 2K1ZA 4FGMA 1P1DA 1WH1A 4Q6HA 3I1EA 4Q3HA 1U39A 4NXQA 4OAJA 2QKTA 2VWRA 4GVDA 2LC7A 5HF1A 2PZDA 3GDVA 2DM8A 3CBYA 2IWOA 2PDZA 2O2TA 1K32A 3JXTA 2REYA 1IU0A 3DJ1A 3SHUA 4K76A 2CS5A 5HFBA 2OZFA 3GCOA 2FCFA 1Y7NA 3SHWA 4P2AB 1XZ9A 3ID3A 1OBYA 2AWXA 4E35A 2VZ5A 3ID4A 1Q3OA 3CYYA 3KDGA 2KPLA 4JOHA 4XHVA 2RRMA 1GM1A 1RGRA 4YYXA 3GDUA 1B8QA 1L6OA 3QO6A 3CS0A 1MFGA 4JOFA 3MH4A 2I6VA 3QE1A 2EEGA 2VSPA 2FE5A 2AINA 2PA1A 5FHTA 4P0CA 2UZCA 4NMRA 4HOPA 1UITA
chains in the Genus database with same CATH topology
1VJ6A 2YT7A 5I7ZA 1QAVB 2EDVA 4NMPA 3WKMA 3R0HA 2KBSA 5HEDA 3VQGA 1D5GA 1SOZA 2EAQA 2ZPLA 2JREA 4NNLA 3GGEA 2GEFA 2QKVA 3STJA 3MH7A 1UJDA 1KWAA 3NFKA 1X5NA 3AXAA 2DMZA 4G69A 1FCFA 4GHNA 2KJPA 1OBZA 2EDZA 2HE4A 3GABA 4WYTA 4JJ3A 2E7KA 1X5QA 4JOJA 2M0UA 1WI4A 3PV5A 3FY5A 5ILBA 3NGHA 2HGAA 4JORA 2MX6A 2ZPMA 1IHJA 1W9QA 3I4WA 2DJTA 3OU0A 3NFLA 2LA8A 2D90A 2L4SA 4K78A 2EEJA 1X6DA 2JSNA 4KFVA 3EGHC 3PDZA 5HJ1A 2JOAA 2AWUA 4REYA 1VCWA 1KEFA 2Z17A 3WKLA 5F3XA 4YDPA 3DJ3A 3SOEA 2L97A 3DIWA 1MC7A 2RCZA 1NTEA 2F5YA 3SFJA 1FC9A 2KOJA 2EEHA 5HFFA 3RL7A 4UU5A 3RL8A 2R4HA 2LC6A 2EEIA 1ZOKA 4N6XA 3K82A 4NXPA 2EGNA 2KQFA 1ZUBA 3HPKA 1BE9A 2EXGA 1WG6A 4Q2OA 3EGGC 1P1EA 2OCSA 5B42A 5JXBA 5DTHA 5F67A 4EDJA 3KZDA 1WFVA 1V1TA 1N6EA 1Q3PA 2H3MA 5E1YA 2W7RA 2H2BA 4KFWA 2M10A 2DC2A 2DB5A 2W4FA 4LMMA 1G9OA 3LNXA 2I0IA 3TSZA 2JIKA 4GVCA 3QIKA 1N7FA 3QDOA 4E34A 4UU6A 2EJYA 3GDSA 1WF8A 1UM1A 3QJMA 1I92A 1N6FA 3E17A 2IWNA 3LNYA 2YUBA 1UJVA 3CC0A 1V5LA 2QBWA 2V1WA 3R69A 1X9ZA 2PKTA 2G5MB 4NMQA 4Q6SA 2KAWA 3K1RA 1PDRA 2JINA 1R6JA 2EGOA 2EDPA 5EZ0A 2QG1A 2LUIA 4FLNA 2L4TA 3VQFA 2I4SA 3KZEA 1M5ZA 1UFXA 2F0AA 2DLUA 1X45A 5HDYA 1KY9A 2KA9A 3RLEA 1IU2A 1FC6A 1UEZA 2EV8A 2P3WA 5A2PA 5E21A 2I0LA 3CH8A 4NNMA 5E22A 2KPKA 1WI2A 2IWQA 2JILA 4JOPA 3PV4A 2H3LA 2I1NA 2EGKA 5E6PB 3ZRTA 2PNTA 1Z86A 5B6LA 3I18A 5HETA 2OPGA 1BFEA 3B76A 3BPUA 2OGPA 2OQSA 2MHOA 1QAUA 3TMHA 2AWWA 2Q3GA 2QKUA 1Q7XA 2YTWA 2V90A 5HEYA 4K6YA 3PV2A 3R68A 1N7EA 3TSVA 2DKRA 2IWPA 4OEOA 2H2CA 1LCYA 2HE2A 4Q2PA 4L8NA 4AMHA 3QGLA 1MFLA 5E11A 4HOPB 2GZVA 2DAZA 2OSGA 3O5NA 2KV8A 5G1EA 4NMSA 3CBXA 4NXRA 2KOHA 5HFDA 3KDKA 2OS6A 3KHFA 4NMVA 1OZIA 1TP3A 3NCVA 1U3BA 1TP5A 4JJ0A 1UM7A 2KL1A 1X5RA 2FN5A 4Z8JA 1V6BA 4H11A 4F8KA 1VAEA 3DORA 4JOGA 2KOMA 2BYGA 5HFCA 4PQWA 2QT5A 1W9OA 1RGWA 1OBXA 1WF7A 1UEPA 2JXOA 4K72A 1UJUA 2VPHA 4WYUA 1T2MA 4RI0A 1TE0A 3GSLA 3OTPA 5HF4A 1I16A 2R3YA 2I04A 1N7TA 2YT8A 1GQ4A 2PKUA 4Q2QA 2YUYA 4Q2NA 5H3JA 5GNDA 1TQ3A 1VA8A 3MH6A 1W9EA 4O06A 1Y8TA 2M0ZA 2M3MA 3CBZA 5IL9A 5HFEA 5D13A 1UEQA 1WFGA 4IC6A 2FNEA 3ID1A 1VB7A 2EHRA 2CSSA 1WHAA 3ID2A 4MPAA 1V62A 2VRFA 2X7ZA 3GCNA 3PDVA 4OEPA 4JL7A 3SUZA 2KYLA 4K75A 2CSJA 2LOBA 5HEBA 3DJAA 2KJDA 3HPMA 4R2ZA 4Z33A 1UF1A 1U38A 3HVQC 4E3BA 4JOKA 1GQ5A 4JOEA 3GJ9A 1RY4A 1NF3C 5GLJA 2DLSA 5EYZA 3L4FD 2OMJA 1V5QA 1RZXA 1QLCA 3PS4A 1WHDA 1WJLA 2WL7A 3O46A 2ENOA 1N6DA 2VSVA 2JWEA 5FB8C 3K50A 2G2LA 3QJNA 2Z9IA 2D8IA 4NMOA 2KG2A 3TSWA 1QAVA 4NMTA 2D92A 2KJKA 1X8SA 2KRGA 1U37A 1YBOA 1FC7A 1Z87A 1SOTA 5G1DA 2M0TA 2Q9VA 2M0VA 1UEWA 1WIFA 2K20A 1UHPA 1N99A 2K1ZA 4FGMA 1P1DA 1WH1A 4Q6HA 3I1EA 4Q3HA 1U39A 4NXQA 4OAJA 2QKTA 2VWRA 4GVDA 2LC7A 5HF1A 2PZDA 3GDVA 2DM8A 3CBYA 2IWOA 2PDZA 2O2TA 1K32A 3JXTA 2REYA 1IU0A 3DJ1A 3SHUA 4K76A 2CS5A 5HFBA 2OZFA 3GCOA 2FCFA 1Y7NA 3SHWA 4P2AB 1XZ9A 3ID3A 1OBYA 2AWXA 4E35A 2VZ5A 3ID4A 1Q3OA 3CYYA 3KDGA 2KPLA 4JOHA 4XHVA 2RRMA 1GM1A 1RGRA 4YYXA 3GDUA 1B8QA 1L6OA 3QO6A 3CS0A 1MFGA 4JOFA 3MH4A 2I6VA 3QE1A 2EEGA 2VSPA 2FE5A 2AINA 2PA1A 5FHTA 4P0CA 2UZCA 4NMRA 4HOPA 1UITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJ6 A;  2YT7 A;  5I7Z A;  1QAV B;  2EDV A;  4NMP A;  3WKM A;  3R0H A;  2KBS A;  5HED A;  3VQG A;  1D5G A;  1SOZ A;  2EAQ A;  2ZPL A;  2JRE A;  4NNL A;  3GGE A;  2QKV A;  3STJ A;  3MH7 A;  1UJD A;  1KWA A;  3NFK A;  1X5N A;  3AXA A;  2DMZ A;  4G69 A;  1FCF A;  4GHN A;  2KJP A;  1OBZ A;  2EDZ A;  2HE4 A;  4WYT A;  2E7K A;  1X5Q A;  4JOJ A;  2M0U A;  1WI4 A;  3PV5 A;  3FY5 A;  3NGH A;  2HGA A;  4JOR A;  2MX6 A;  2ZPM A;  1IHJ A;  1W9Q A;  3I4W A;  2DJT A;  3OU0 A;  3NFL A;  2LA8 A;  2D90 A;  2L4S A;  4K78 A;  2EEJ A;  1X6D A;  4KFV A;  3EGH C;  3PDZ A;  5HJ1 A;  2JOA A;  2AWU A;  4REY A;  1VCW A;  1KEF A;  2Z17 A;  3WKL A;  5F3X A;  4YDP A;  3DJ3 A;  3SOE A;  2L97 A;  3DIW A;  1MC7 A;  2RCZ A;  1NTE A;  2F5Y A;  3SFJ A;  1FC9 A;  2KOJ A;  2EEH A;  5HFF A;  3RL7 A;  4UU5 A;  3RL8 A;  2R4H A;  2LC6 A;  2EEI A;  1ZOK A;  4N6X A;  3K82 A;  4NXP A;  2EGN A;  2KQF A;  1ZUB A;  3HPK A;  1BE9 A;  2EXG A;  1WG6 A;  4Q2O A;  3EGG C;  1P1E A;  2OCS A;  5JXB A;  5DTH A;  5F67 A;  4EDJ A;  3KZD A;  1WFV A;  1V1T A;  1N6E A;  1Q3P A;  2H3M A;  5E1Y A;  2W7R A;  2H2B A;  4KFW A;  2M10 A;  2DC2 A;  2DB5 A;  2W4F A;  4LMM A;  1G9O A;  3LNX A;  2I0I A;  3TSZ A;  2JIK A;  4GVC A;  3QIK A;  1N7F A;  3QDO A;  4E34 A;  4UU6 A;  2EJY A;  3GDS A;  1WF8 A;  1UM1 A;  3QJM A;  1I92 A;  1N6F A;  3E17 A;  2IWN A;  3LNY A;  2YUB A;  1UJV A;  3CC0 A;  1V5L A;  2QBW A;  2V1W A;  3R69 A;  2PKT A;  2G5M B;  4NMQ A;  4Q6S A;  2KAW A;  3K1R A;  1PDR A;  2JIN A;  1R6J A;  2EGO A;  2EDP A;  5EZ0 A;  2QG1 A;  2LUI A;  2L4T A;  3VQF A;  2I4S A;  3KZE A;  1M5Z A;  1UFX A;  2F0A A;  2DLU A;  1X45 A;  5HDY A;  1KY9 A;  2KA9 A;  3RLE A;  1IU2 A;  1FC6 A;  1UEZ A;  2EV8 A;  2P3W A;  5A2P A;  5E21 A;  2I0L A;  3CH8 A;  4NNM A;  5E22 A;  2KPK A;  1WI2 A;  2IWQ A;  2JIL A;  4JOP A;  3PV4 A;  2H3L A;  2I1N A;  2EGK A;  5E6P B;  3ZRT A;  2PNT A;  1Z86 A;  5B6L A;  3I18 A;  5HET A;  2OPG A;  1BFE A;  3B76 A;  3BPU A;  2OGP A;  2OQS A;  2MHO A;  1QAU A;  3TMH A;  2AWW A;  2Q3G A;  2QKU A;  1Q7X A;  2YTW A;  2V90 A;  5HEY A;  4K6Y A;  3PV2 A;  3R68 A;  1N7E A;  3TSV A;  2DKR A;  2IWP A;  4OEO A;  2H2C A;  1LCY A;  2HE2 A;  4Q2P A;  4L8N A;  4AMH A;  3QGL A;  1MFL A;  5E11 A;  4HOP B;  2GZV A;  2DAZ A;  2OSG A;  3O5N A;  2KV8 A;  5G1E A;  4NMS A;  3CBX A;  4NXR A;  2KOH A;  5HFD A;  2OS6 A;  3KHF A;  4NMV A;  1OZI A;  1TP3 A;  1U3B A;  1TP5 A;  1UM7 A;  2KL1 A;  1X5R A;  2FN5 A;  4Z8J A;  1V6B A;  4H11 A;  4F8K A;  1VAE A;  3DOR A;  4JOG A;  2KOM A;  2BYG A;  5HFC A;  4PQW A;  2QT5 A;  1W9O A;  1RGW A;  1OBX A;  1WF7 A;  1UEP A;  2JXO A;  4K72 A;  1UJU A;  2VPH A;  4WYU A;  1T2M A;  4RI0 A;  1TE0 A;  3GSL A;  3OTP A;  5HF4 A;  1I16 A;  2R3Y A;  2I04 A;  1N7T A;  2YT8 A;  1GQ4 A;  2PKU A;  4Q2Q A;  2YUY A;  4Q2N A;  5H3J A;  5GND A;  1TQ3 A;  1VA8 A;  3MH6 A;  1W9E A;  4O06 A;  1Y8T A;  2M0Z A;  2M3M A;  3CBZ A;  5HFE A;  5D13 A;  1UEQ A;  1WFG A;  4IC6 A;  2FNE A;  3ID1 A;  1VB7 A;  2EHR A;  2CSS A;  1WHA A;  3ID2 A;  4MPA A;  1V62 A;  2VRF A;  2X7Z A;  3GCN A;  3PDV A;  4OEP A;  4JL7 A;  3SUZ A;  2KYL A;  4K75 A;  2CSJ A;  2LOB A;  5HEB A;  3DJA A;  2KJD A;  3HPM A;  4R2Z A;  4Z33 A;  1UF1 A;  1U38 A;  3HVQ C;  4E3B A;  4JOK A;  1GQ5 A;  4JOE A;  3GJ9 A;  1RY4 A;  1NF3 C;  5GLJ A;  2DLS A;  5EYZ A;  3L4F D;  2OMJ A;  1V5Q A;  1RZX A;  1QLC A;  3PS4 A;  1WHD A;  1WJL A;  2WL7 A;  3O46 A;  2ENO A;  1N6D A;  2VSV A;  2JWE A;  5FB8 C;  3K50 A;  2G2L A;  3QJN A;  2Z9I A;  2D8I A;  4NMO A;  2KG2 A;  3TSW A;  1QAV A;  4NMT A;  2D92 A;  2KJK A;  1X8S A;  2KRG A;  1U37 A;  1YBO A;  1FC7 A;  1Z87 A;  1SOT A;  5G1D A;  2M0T A;  2Q9V A;  2M0V A;  1UEW A;  1WIF A;  2K20 A;  1UHP A;  1N99 A;  2K1Z A;  4FGM A;  1P1D A;  1WH1 A;  4Q6H A;  3I1E A;  4Q3H A;  1U39 A;  4NXQ A;  4OAJ A;  2QKT A;  2VWR A;  4GVD A;  2LC7 A;  5HF1 A;  2PZD A;  3GDV A;  2DM8 A;  3CBY A;  2IWO A;  2PDZ A;  2O2T A;  1K32 A;  3JXT A;  2REY A;  1IU0 A;  3DJ1 A;  3SHU A;  4K76 A;  2CS5 A;  5HFB A;  2OZF A;  3GCO A;  2FCF A;  1Y7N A;  3SHW A;  4P2A B;  1XZ9 A;  3ID3 A;  1OBY A;  2AWX A;  4E35 A;  2VZ5 A;  3ID4 A;  1Q3O A;  3CYY A;  2KPL A;  4JOH A;  4XHV A;  2RRM A;  1GM1 A;  1RGR A;  4YYX A;  3GDU A;  1B8Q A;  1L6O A;  3QO6 A;  3CS0 A;  1MFG A;  4JOF A;  3MH4 A;  2I6V A;  3QE1 A;  2EEG A;  2VSP A;  2FE5 A;  2AIN A;  2PA1 A;  5FHT A;  4P0C A;  2UZC A;  4NMR A;  4HOP A;  1UIT A; 
#chains in the Genus database with same CATH topology
 1VJ6 A;  2YT7 A;  5I7Z A;  1QAV B;  2EDV A;  4NMP A;  3WKM A;  3R0H A;  2KBS A;  5HED A;  3VQG A;  1D5G A;  1SOZ A;  2EAQ A;  2ZPL A;  2JRE A;  4NNL A;  3GGE A;  2GEF A;  2QKV A;  3STJ A;  3MH7 A;  1UJD A;  1KWA A;  3NFK A;  1X5N A;  3AXA A;  2DMZ A;  4G69 A;  1FCF A;  4GHN A;  2KJP A;  1OBZ A;  2EDZ A;  2HE4 A;  3GAB A;  4WYT A;  4JJ3 A;  2E7K A;  1X5Q A;  4JOJ A;  2M0U A;  1WI4 A;  3PV5 A;  3FY5 A;  5ILB A;  3NGH A;  2HGA A;  4JOR A;  2MX6 A;  2ZPM A;  1IHJ A;  1W9Q A;  3I4W A;  2DJT A;  3OU0 A;  3NFL A;  2LA8 A;  2D90 A;  2L4S A;  4K78 A;  2EEJ A;  1X6D A;  2JSN A;  4KFV A;  3EGH C;  3PDZ A;  5HJ1 A;  2JOA A;  2AWU A;  4REY A;  1VCW A;  1KEF A;  2Z17 A;  3WKL A;  5F3X A;  4YDP A;  3DJ3 A;  3SOE A;  2L97 A;  3DIW A;  1MC7 A;  2RCZ A;  1NTE A;  2F5Y A;  3SFJ A;  1FC9 A;  2KOJ A;  2EEH A;  5HFF A;  3RL7 A;  4UU5 A;  3RL8 A;  2R4H A;  2LC6 A;  2EEI A;  1ZOK A;  4N6X A;  3K82 A;  4NXP A;  2EGN A;  2KQF A;  1ZUB A;  3HPK A;  1BE9 A;  2EXG A;  1WG6 A;  4Q2O A;  3EGG C;  1P1E A;  2OCS A;  5B42 A;  5JXB A;  5DTH A;  5F67 A;  4EDJ A;  3KZD A;  1WFV A;  1V1T A;  1N6E A;  1Q3P A;  2H3M A;  5E1Y A;  2W7R A;  2H2B A;  4KFW A;  2M10 A;  2DC2 A;  2DB5 A;  2W4F A;  4LMM A;  1G9O A;  3LNX A;  2I0I A;  3TSZ A;  2JIK A;  4GVC A;  3QIK A;  1N7F A;  3QDO A;  4E34 A;  4UU6 A;  2EJY A;  3GDS A;  1WF8 A;  1UM1 A;  3QJM A;  1I92 A;  1N6F A;  3E17 A;  2IWN A;  3LNY A;  2YUB A;  1UJV A;  3CC0 A;  1V5L A;  2QBW A;  2V1W A;  3R69 A;  1X9Z A;  2PKT A;  2G5M B;  4NMQ A;  4Q6S A;  2KAW A;  3K1R A;  1PDR A;  2JIN A;  1R6J A;  2EGO A;  2EDP A;  5EZ0 A;  2QG1 A;  2LUI A;  4FLN A;  2L4T A;  3VQF A;  2I4S A;  3KZE A;  1M5Z A;  1UFX A;  2F0A A;  2DLU A;  1X45 A;  5HDY A;  1KY9 A;  2KA9 A;  3RLE A;  1IU2 A;  1FC6 A;  1UEZ A;  2EV8 A;  2P3W A;  5A2P A;  5E21 A;  2I0L A;  3CH8 A;  4NNM A;  5E22 A;  2KPK A;  1WI2 A;  2IWQ A;  2JIL A;  4JOP A;  3PV4 A;  2H3L A;  2I1N A;  2EGK A;  5E6P B;  3ZRT A;  2PNT A;  1Z86 A;  5B6L A;  3I18 A;  5HET A;  2OPG A;  1BFE A;  3B76 A;  3BPU A;  2OGP A;  2OQS A;  2MHO A;  1QAU A;  3TMH A;  2AWW A;  2Q3G A;  2QKU A;  1Q7X A;  2YTW A;  2V90 A;  5HEY A;  4K6Y A;  3PV2 A;  3R68 A;  1N7E A;  3TSV A;  2DKR A;  2IWP A;  4OEO A;  2H2C A;  1LCY A;  2HE2 A;  4Q2P A;  4L8N A;  4AMH A;  3QGL A;  1MFL A;  5E11 A;  4HOP B;  2GZV A;  2DAZ A;  2OSG A;  3O5N A;  2KV8 A;  5G1E A;  4NMS A;  3CBX A;  4NXR A;  2KOH A;  5HFD A;  3KDK A;  2OS6 A;  3KHF A;  4NMV A;  1OZI A;  1TP3 A;  3NCV A;  1U3B A;  1TP5 A;  4JJ0 A;  1UM7 A;  2KL1 A;  1X5R A;  2FN5 A;  4Z8J A;  1V6B A;  4H11 A;  4F8K A;  1VAE A;  3DOR A;  4JOG A;  2KOM A;  2BYG A;  5HFC A;  4PQW A;  2QT5 A;  1W9O A;  1RGW A;  1OBX A;  1WF7 A;  1UEP A;  2JXO A;  4K72 A;  1UJU A;  2VPH A;  4WYU A;  1T2M A;  4RI0 A;  1TE0 A;  3GSL A;  3OTP A;  5HF4 A;  1I16 A;  2R3Y A;  2I04 A;  1N7T A;  2YT8 A;  1GQ4 A;  2PKU A;  4Q2Q A;  2YUY A;  4Q2N A;  5H3J A;  5GND A;  1TQ3 A;  1VA8 A;  3MH6 A;  1W9E A;  4O06 A;  1Y8T A;  2M0Z A;  2M3M A;  3CBZ A;  5IL9 A;  5HFE A;  5D13 A;  1UEQ A;  1WFG A;  4IC6 A;  2FNE A;  3ID1 A;  1VB7 A;  2EHR A;  2CSS A;  1WHA A;  3ID2 A;  4MPA A;  1V62 A;  2VRF A;  2X7Z A;  3GCN A;  3PDV A;  4OEP A;  4JL7 A;  3SUZ A;  2KYL A;  4K75 A;  2CSJ A;  2LOB A;  5HEB A;  3DJA A;  2KJD A;  3HPM A;  4R2Z A;  4Z33 A;  1UF1 A;  1U38 A;  3HVQ C;  4E3B A;  4JOK A;  1GQ5 A;  4JOE A;  3GJ9 A;  1RY4 A;  1NF3 C;  5GLJ A;  2DLS A;  5EYZ A;  3L4F D;  2OMJ A;  1V5Q A;  1RZX A;  1QLC A;  3PS4 A;  1WHD A;  1WJL A;  2WL7 A;  3O46 A;  2ENO A;  1N6D A;  2VSV A;  2JWE A;  5FB8 C;  3K50 A;  2G2L A;  3QJN A;  2Z9I A;  2D8I A;  4NMO A;  2KG2 A;  3TSW A;  1QAV A;  4NMT A;  2D92 A;  2KJK A;  1X8S A;  2KRG A;  1U37 A;  1YBO A;  1FC7 A;  1Z87 A;  1SOT A;  5G1D A;  2M0T A;  2Q9V A;  2M0V A;  1UEW A;  1WIF A;  2K20 A;  1UHP A;  1N99 A;  2K1Z A;  4FGM A;  1P1D A;  1WH1 A;  4Q6H A;  3I1E A;  4Q3H A;  1U39 A;  4NXQ A;  4OAJ A;  2QKT A;  2VWR A;  4GVD A;  2LC7 A;  5HF1 A;  2PZD A;  3GDV A;  2DM8 A;  3CBY A;  2IWO A;  2PDZ A;  2O2T A;  1K32 A;  3JXT A;  2REY A;  1IU0 A;  3DJ1 A;  3SHU A;  4K76 A;  2CS5 A;  5HFB A;  2OZF A;  3GCO A;  2FCF A;  1Y7N A;  3SHW A;  4P2A B;  1XZ9 A;  3ID3 A;  1OBY A;  2AWX A;  4E35 A;  2VZ5 A;  3ID4 A;  1Q3O A;  3CYY A;  3KDG A;  2KPL A;  4JOH A;  4XHV A;  2RRM A;  1GM1 A;  1RGR A;  4YYX A;  3GDU A;  1B8Q A;  1L6O A;  3QO6 A;  3CS0 A;  1MFG A;  4JOF A;  3MH4 A;  2I6V A;  3QE1 A;  2EEG A;  2VSP A;  2FE5 A;  2AIN A;  2PA1 A;  5FHT A;  4P0C A;  2UZC A;  4NMR A;  4HOP A;  1UIT A; 
#chains in the Genus database with same CATH homology
 1VJ6 A;  2YT7 A;  5I7Z A;  1QAV B;  2EDV A;  4NMP A;  3WKM A;  3R0H A;  2KBS A;  5HED A;  3VQG A;  1D5G A;  1SOZ A;  2EAQ A;  2ZPL A;  2JRE A;  4NNL A;  3GGE A;  2GEF A;  2QKV A;  3STJ A;  3MH7 A;  1UJD A;  1KWA A;  3NFK A;  1X5N A;  3AXA A;  2DMZ A;  4G69 A;  1FCF A;  4GHN A;  2KJP A;  1OBZ A;  2EDZ A;  2HE4 A;  3GAB A;  4WYT A;  4JJ3 A;  2E7K A;  1X5Q A;  4JOJ A;  2M0U A;  1WI4 A;  3PV5 A;  3FY5 A;  5ILB A;  3NGH A;  2HGA A;  4JOR A;  2MX6 A;  2ZPM A;  1IHJ A;  1W9Q A;  3I4W A;  2DJT A;  3OU0 A;  3NFL A;  2LA8 A;  2D90 A;  2L4S A;  4K78 A;  2EEJ A;  1X6D A;  2JSN A;  4KFV A;  3EGH C;  3PDZ A;  5HJ1 A;  2JOA A;  2AWU A;  4REY A;  1VCW A;  1KEF A;  2Z17 A;  3WKL A;  5F3X A;  4YDP A;  3DJ3 A;  3SOE A;  2L97 A;  3DIW A;  1MC7 A;  2RCZ A;  1NTE A;  2F5Y A;  3SFJ A;  1FC9 A;  2KOJ A;  2EEH A;  5HFF A;  3RL7 A;  4UU5 A;  3RL8 A;  2R4H A;  2LC6 A;  2EEI A;  1ZOK A;  4N6X A;  3K82 A;  4NXP A;  2EGN A;  2KQF A;  1ZUB A;  3HPK A;  1BE9 A;  2EXG A;  1WG6 A;  4Q2O A;  3EGG C;  1P1E A;  2OCS A;  5B42 A;  5JXB A;  5DTH A;  5F67 A;  4EDJ A;  3KZD A;  1WFV A;  1V1T A;  1N6E A;  1Q3P A;  2H3M A;  5E1Y A;  2W7R A;  2H2B A;  4KFW A;  2M10 A;  2DC2 A;  2DB5 A;  2W4F A;  4LMM A;  1G9O A;  3LNX A;  2I0I A;  3TSZ A;  2JIK A;  4GVC A;  3QIK A;  1N7F A;  3QDO A;  4E34 A;  4UU6 A;  2EJY A;  3GDS A;  1WF8 A;  1UM1 A;  3QJM A;  1I92 A;  1N6F A;  3E17 A;  2IWN A;  3LNY A;  2YUB A;  1UJV A;  3CC0 A;  1V5L A;  2QBW A;  2V1W A;  3R69 A;  1X9Z A;  2PKT A;  2G5M B;  4NMQ A;  4Q6S A;  2KAW A;  3K1R A;  1PDR A;  2JIN A;  1R6J A;  2EGO A;  2EDP A;  5EZ0 A;  2QG1 A;  2LUI A;  4FLN A;  2L4T A;  3VQF A;  2I4S A;  3KZE A;  1M5Z A;  1UFX A;  2F0A A;  2DLU A;  1X45 A;  5HDY A;  1KY9 A;  2KA9 A;  3RLE A;  1IU2 A;  1FC6 A;  1UEZ A;  2EV8 A;  2P3W A;  5A2P A;  5E21 A;  2I0L A;  3CH8 A;  4NNM A;  5E22 A;  2KPK A;  1WI2 A;  2IWQ A;  2JIL A;  4JOP A;  3PV4 A;  2H3L A;  2I1N A;  2EGK A;  5E6P B;  3ZRT A;  2PNT A;  1Z86 A;  5B6L A;  3I18 A;  5HET A;  2OPG A;  1BFE A;  3B76 A;  3BPU A;  2OGP A;  2OQS A;  2MHO A;  1QAU A;  3TMH A;  2AWW A;  2Q3G A;  2QKU A;  1Q7X A;  2YTW A;  2V90 A;  5HEY A;  4K6Y A;  3PV2 A;  3R68 A;  1N7E A;  3TSV A;  2DKR A;  2IWP A;  4OEO A;  2H2C A;  1LCY A;  2HE2 A;  4Q2P A;  4L8N A;  4AMH A;  3QGL A;  1MFL A;  5E11 A;  4HOP B;  2GZV A;  2DAZ A;  2OSG A;  3O5N A;  2KV8 A;  5G1E A;  4NMS A;  3CBX A;  4NXR A;  2KOH A;  5HFD A;  3KDK A;  2OS6 A;  3KHF A;  4NMV A;  1OZI A;  1TP3 A;  3NCV A;  1U3B A;  1TP5 A;  4JJ0 A;  1UM7 A;  2KL1 A;  1X5R A;  2FN5 A;  4Z8J A;  1V6B A;  4H11 A;  4F8K A;  1VAE A;  3DOR A;  4JOG A;  2KOM A;  2BYG A;  5HFC A;  4PQW A;  2QT5 A;  1W9O A;  1RGW A;  1OBX A;  1WF7 A;  1UEP A;  2JXO A;  4K72 A;  1UJU A;  2VPH A;  4WYU A;  1T2M A;  4RI0 A;  1TE0 A;  3GSL A;  3OTP A;  5HF4 A;  1I16 A;  2R3Y A;  2I04 A;  1N7T A;  2YT8 A;  1GQ4 A;  2PKU A;  4Q2Q A;  2YUY A;  4Q2N A;  5H3J A;  5GND A;  1TQ3 A;  1VA8 A;  3MH6 A;  1W9E A;  4O06 A;  1Y8T A;  2M0Z A;  2M3M A;  3CBZ A;  5IL9 A;  5HFE A;  5D13 A;  1UEQ A;  1WFG A;  4IC6 A;  2FNE A;  3ID1 A;  1VB7 A;  2EHR A;  2CSS A;  1WHA A;  3ID2 A;  4MPA A;  1V62 A;  2VRF A;  2X7Z A;  3GCN A;  3PDV A;  4OEP A;  4JL7 A;  3SUZ A;  2KYL A;  4K75 A;  2CSJ A;  2LOB A;  5HEB A;  3DJA A;  2KJD A;  3HPM A;  4R2Z A;  4Z33 A;  1UF1 A;  1U38 A;  3HVQ C;  4E3B A;  4JOK A;  1GQ5 A;  4JOE A;  3GJ9 A;  1RY4 A;  1NF3 C;  5GLJ A;  2DLS A;  5EYZ A;  3L4F D;  2OMJ A;  1V5Q A;  1RZX A;  1QLC A;  3PS4 A;  1WHD A;  1WJL A;  2WL7 A;  3O46 A;  2ENO A;  1N6D A;  2VSV A;  2JWE A;  5FB8 C;  3K50 A;  2G2L A;  3QJN A;  2Z9I A;  2D8I A;  4NMO A;  2KG2 A;  3TSW A;  1QAV A;  4NMT A;  2D92 A;  2KJK A;  1X8S A;  2KRG A;  1U37 A;  1YBO A;  1FC7 A;  1Z87 A;  1SOT A;  5G1D A;  2M0T A;  2Q9V A;  2M0V A;  1UEW A;  1WIF A;  2K20 A;  1UHP A;  1N99 A;  2K1Z A;  4FGM A;  1P1D A;  1WH1 A;  4Q6H A;  3I1E A;  4Q3H A;  1U39 A;  4NXQ A;  4OAJ A;  2QKT A;  2VWR A;  4GVD A;  2LC7 A;  5HF1 A;  2PZD A;  3GDV A;  2DM8 A;  3CBY A;  2IWO A;  2PDZ A;  2O2T A;  1K32 A;  3JXT A;  2REY A;  1IU0 A;  3DJ1 A;  3SHU A;  4K76 A;  2CS5 A;  5HFB A;  2OZF A;  3GCO A;  2FCF A;  1Y7N A;  3SHW A;  4P2A B;  1XZ9 A;  3ID3 A;  1OBY A;  2AWX A;  4E35 A;  2VZ5 A;  3ID4 A;  1Q3O A;  3CYY A;  3KDG A;  2KPL A;  4JOH A;  4XHV A;  2RRM A;  1GM1 A;  1RGR A;  4YYX A;  3GDU A;  1B8Q A;  1L6O A;  3QO6 A;  3CS0 A;  1MFG A;  4JOF A;  3MH4 A;  2I6V A;  3QE1 A;  2EEG A;  2VSP A;  2FE5 A;  2AIN A;  2PA1 A;  5FHT A;  4P0C A;  2UZC A;  4NMR A;  4HOP A;  1UIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...