1L6OA

Xenopus dishevelled pdz domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
MIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Segment polarity protein dishevelled homolog DVL-2
publication title Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Gene regulation
total genus 17
structure length 95
sequence length 95
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1l6oA00
4JOGA 2HE4A 3NGHA 3HPMA 1QLCA 2PA1A 4Q2QA 5GNDA 2M0VA 1RGRA 1UFXA 1WFGA 3BPUA 2RCZA 2REYA 3ZRTA 5E6PB 2H3MA 3QIKA 2LC7A 1V5QA 4R2ZA 4IC6A 1Y8TA 2PNTA 1T2MA 3GSLA 5H3JA 1IU0A 1K32A 1X5QA 2QT5A 5I7ZA 4GHNA 4E3BA 2OSGA 1VA8A 3OTPA 5E11A 1P1EA 2YUBA 2G2LA 2AWUA 2LA8A 2EDVA 5HJ1A 1U39A 2I1NA 3VQFA 2PKUA 1TP5A 4NMPA 3CYYA 3GDSA 2Q3GA 2LUIA 4JOKA 1GQ4A 2PKTA 4F8KA 1QAUA 1UM1A 2EJYA 2VRFA 4Q3HA 2Q9VA 1X6DA 1X5NA 3K50A 2EDZA 4GVCA 2KA9A 3ID1A 1OBZA 4JL7A 3ID2A 4NMQA 2K1ZA 1VCWA 1YBOA 1N6DA 5B6LA 4PQWA 3SHUA 1R6JA 2EGOA 2F0AA 3NFKA 5JXBA 2KOJA 2M3MA 4OEOA 4YDPA 3TSWA 1UEWA 2FN5A 2X7ZA 2RRMA 5HEDA 1Q3OA 2YT8A 3O46A 2P3WA 2JXOA 3CC0A 2QKTA 2EEHA 2ZPMA 2KOMA 1BFEA 3PV5A 4K78A 1GQ5A 1UJDA 1PDRA 2DJTA 3R69A 3KHFA 2DMZA 4NNLA 2EEIA 2VPHA 2F5YA 1V6BA 3CBYA 2MHOA 2DLUA 2KQFA 3DJAA 2G5MB 2H2BA 1X45A 3QJNA 1L6OA 2M0TA 5G1DA 2DC2A 1X8SA 2JINA 3TSZA 4HOPB 4NMRA 1RY4A 1M5ZA 1UEQA 2VWRA 2W4FA 4UU5A 3PDVA 5HF1A 3HVQC 4YYXA 1TP3A 1Q3PA 3CBZA 1NTEA 4K72A 2L97A 2KPLA 2MX6A 1U38A 3QE1A 2HE2A 4REYA 2YT7A 2M10A 3PV4A 4JOHA 1UEZA 3WKMA 1WI2A 2DLSA 2K20A 2DB5A 4H11A 3DJ1A 5HFEA 4HOPA 3PS4A 4NMVA 3LNYA 1QAVB 4GVDA 1WHDA 1WF8A 2M0UA 5DTHA 2PZDA 3HPKA 3GCOA 1OZIA 5E22A 2VSPA 2QBWA 3RL7A 1VJ6A 2M0ZA 5FB8C 5HETA 2KPKA 2EAQA 3TSVA 1KEFA 1N99A 3SHWA 5HEBA 2IWOA 3QGLA 1N6EA 3GDUA 2R4HA 1N6FA 3DIWA 3JXTA 2PDZA 2V90A 3SFJA 3OU0A 2YTWA 2JIKA 1UEPA 2KL1A 4NXQA 1Y7NA 2AWXA 3B76A 3GGEA 5EYZA 1MFGA 1FC7A 1Q7XA 2DM8A 1QAVA 3KZEA 3PDZA 1VAEA 1RZXA 1UJVA 3E17A 1FC6A 5HFBA 4JOFA 1P1DA 2H3LA 2I6VA 3QDOA 5E1YA 2OPGA 2UZCA 4XHVA 5A2PA 3K1RA 5G1EA 4O06A 3O5NA 3FY5A 2EV8A 2KJPA 2KBSA 3I1EA 4E34A 1KWAA 2Z9IA 4EDJA 4N6XA 4RI0A 3SOEA 2ZPLA 3CH8A 3EGHC 1SOZA 2KJKA 1W9EA 1IHJA 3MH4A 4MPAA 1WI4A 2HGAA 3K82A 3RLEA 4AMHA 4Q2NA 1U37A 2LC6A 2O2TA 2KRGA 4JORA 4JOJA 1TE0A 3QJMA 3GCNA 2QKVA 4Z8JA 2OQSA 5E21A 4P0CA 1NF3C 3CS0A 3SUZA 1FC9A 1XZ9A 2ENOA 2KV8A 3GDVA 1UHPA 4JOEA 1IU2A 4OEPA 4KFVA 1SOTA 1U3BA 1UM7A 1OBXA 1WF7A 4Q2OA 2KJDA 2FCFA 4WYUA 1ZUBA 1V5LA 1RGWA 1VB7A 2DAZA 2L4SA 4FGMA 1WHAA 2DKRA 4NMSA 5D13A 4K75A 1WFVA 1WH1A 3RL8A 1LCYA 2VZ5A 3R0HA 2R3YA 2KAWA 2E7KA 2D8IA 1FCFA 3ID3A 5F67A 3NFLA 4Q6SA 1UF1A 3MH6A 4NNMA 1W9QA 2JWEA 1KY9A 5HFCA 3TMHA 4JOPA 2I0IA 2YUYA 2OGPA 4NXRA 2JREA 2I4SA 1V62A 2KYLA 3PV2A 4NXPA 1MFLA 5EZ0A 2D92A 1D5GA 4UU6A 5GLJA 2AWWA 4K76A 1N7TA 2CS5A 1I92A 2FE5A 3R68A 4NMOA 3I4WA 1B8QA 3STJA 4G69A 2EGNA 2IWNA 4L8NA 3I18A 1WIFA 2KOHA 4Q6HA 2EXGA 2IWPA 5HEYA 2FNEA 2EEGA 2OCSA 1ZOKA 1I16A 5FHTA 2QG1A 1GM1A 2V1WA 3WKLA 1V1TA 2LOBA 3LNXA 3DORA 1W9OA 3EGGC 3QO6A 2WL7A 4LMMA 4Z33A 1WJLA 2EEJA 4OAJA 4WYTA 2QKUA 4K6YA 1WG6A 4NMTA 2I0LA 2CSJA 2IWQA 1N7EA 2GZVA 2OS6A 3AXAA 3DJ3A 2W7RA 3MH7A 5F3XA 2BYGA 2JOAA 4E35A 1BE9A 2OMJA 2VSVA 2Z17A 5HFFA 2I04A 5HFDA 2EDPA 1UJUA 1TQ3A 1UITA 3KZDA 3GJ9A 2KG2A 3L4FD 1G9OA 2OZFA 5HF4A 1MC7A 2D90A 3CBXA 2EHRA 3VQGA 2AINA 2CSSA 1X5RA 1Z86A 1Z87A 1N7FA 3ID4A 5HDYA 4KFWA 4P2AB 2L4TA 1OBYA 2H2CA 4Q2PA 2JILA 2EGKA
chains in the Genus database with same CATH superfamily
4JOGA 3KDGA 2HE4A 3NGHA 3HPMA 1QLCA 2PA1A 4Q2QA 5GNDA 2M0VA 1RGRA 1UFXA 1WFGA 3BPUA 2RCZA 2REYA 3ZRTA 5E6PB 2H3MA 5ILBA 3QIKA 2LC7A 1V5QA 4R2ZA 4IC6A 1Y8TA 2PNTA 1T2MA 3GSLA 5H3JA 1IU0A 1K32A 1X5QA 2QT5A 5I7ZA 4GHNA 4E3BA 2OSGA 1VA8A 3OTPA 5E11A 1P1EA 2YUBA 2G2LA 2AWUA 2LA8A 2EDVA 5HJ1A 1U39A 2I1NA 3VQFA 2PKUA 1TP5A 4NMPA 3CYYA 3GDSA 2Q3GA 2LUIA 4JOKA 1GQ4A 2PKTA 4F8KA 1QAUA 1UM1A 2EJYA 2VRFA 4Q3HA 2Q9VA 1X6DA 1X5NA 3K50A 2EDZA 4GVCA 2KA9A 3ID1A 1OBZA 4JL7A 3ID2A 4NMQA 2K1ZA 1VCWA 1YBOA 1N6DA 5B6LA 4PQWA 3SHUA 1R6JA 2EGOA 2F0AA 3NFKA 5JXBA 2KOJA 2M3MA 4OEOA 4YDPA 3TSWA 1UEWA 2FN5A 2X7ZA 2RRMA 5HEDA 1Q3OA 2YT8A 3O46A 2P3WA 2JXOA 3CC0A 2QKTA 2EEHA 2ZPMA 2KOMA 1BFEA 3PV5A 4K78A 1GQ5A 1UJDA 1PDRA 2DJTA 3R69A 3KHFA 2DMZA 4NNLA 2EEIA 2VPHA 2F5YA 1V6BA 3CBYA 2MHOA 2DLUA 2KQFA 3DJAA 2G5MB 2H2BA 1X45A 3QJNA 1L6OA 2M0TA 5G1DA 5IL9A 2DC2A 1X8SA 2JINA 3TSZA 3NCVA 4HOPB 4NMRA 1RY4A 1M5ZA 1UEQA 2VWRA 2W4FA 4UU5A 3PDVA 5HF1A 3HVQC 4YYXA 1TP3A 1Q3PA 3CBZA 1NTEA 4K72A 2L97A 2KPLA 2MX6A 1U38A 3QE1A 2HE2A 4REYA 2YT7A 2M10A 3PV4A 4JOHA 1UEZA 3WKMA 1WI2A 2DLSA 4FLNA 2K20A 2DB5A 4H11A 3DJ1A 5HFEA 4HOPA 3PS4A 4NMVA 3LNYA 1QAVB 4GVDA 1WHDA 1WF8A 2M0UA 5DTHA 2PZDA 3HPKA 3GCOA 1OZIA 5E22A 2VSPA 2QBWA 3RL7A 1VJ6A 2M0ZA 5FB8C 5HETA 2KPKA 4JJ3A 2EAQA 3TSVA 1KEFA 1N99A 3SHWA 5HEBA 2IWOA 3QGLA 1N6EA 3GDUA 2R4HA 1N6FA 3DIWA 3GABA 2PDZA 2V90A 3JXTA 3SFJA 3OU0A 2YTWA 2JIKA 1UEPA 2KL1A 4NXQA 1Y7NA 2AWXA 3B76A 3GGEA 5EYZA 1MFGA 1FC7A 1Q7XA 2DM8A 1QAVA 3KZEA 3PDZA 1VAEA 1RZXA 1UJVA 3E17A 1FC6A 5HFBA 4JOFA 2GEFA 1P1DA 2H3LA 2I6VA 3QDOA 5E1YA 2JSNA 2OPGA 2UZCA 4XHVA 5A2PA 3K1RA 5G1EA 4O06A 3O5NA 3FY5A 2EV8A 2KJPA 2KBSA 3I1EA 4E34A 1KWAA 2Z9IA 4EDJA 4N6XA 4RI0A 3SOEA 2ZPLA 3CH8A 3EGHC 1SOZA 2KJKA 1W9EA 1IHJA 3MH4A 4MPAA 1WI4A 2HGAA 3K82A 3RLEA 4AMHA 4Q2NA 1U37A 2LC6A 2O2TA 2KRGA 4JORA 3KDKA 4JOJA 1TE0A 3QJMA 3GCNA 2QKVA 4Z8JA 2OQSA 5E21A 4P0CA 1NF3C 3CS0A 3SUZA 1FC9A 1XZ9A 2ENOA 2KV8A 3GDVA 1UHPA 4JOEA 1IU2A 4OEPA 4KFVA 1SOTA 1U3BA 1UM7A 1OBXA 5B42A 1WF7A 4Q2OA 2KJDA 2FCFA 4WYUA 1ZUBA 1V5LA 4JJ0A 1RGWA 1VB7A 2DAZA 2L4SA 4FGMA 1WHAA 2DKRA 4NMSA 5D13A 4K75A 1WFVA 1WH1A 3RL8A 1LCYA 2VZ5A 3R0HA 2R3YA 2KAWA 2E7KA 2D8IA 1FCFA 3ID3A 5F67A 3NFLA 4Q6SA 1UF1A 3MH6A 4NNMA 1W9QA 2JWEA 1KY9A 5HFCA 3TMHA 1X9ZA 4JOPA 2I0IA 2YUYA 2OGPA 4NXRA 2JREA 2I4SA 1V62A 2KYLA 3PV2A 4NXPA 1MFLA 5EZ0A 2D92A 1D5GA 4UU6A 5GLJA 2AWWA 4K76A 1N7TA 2CS5A 1I92A 2FE5A 3R68A 4NMOA 3I4WA 1B8QA 3STJA 4G69A 2EGNA 2IWNA 4L8NA 3I18A 1WIFA 2KOHA 4Q6HA 2EXGA 2IWPA 5HEYA 2FNEA 2EEGA 2OCSA 1ZOKA 1I16A 5FHTA 2QG1A 1GM1A 2V1WA 3WKLA 1V1TA 2LOBA 3LNXA 3DORA 1W9OA 3EGGC 3QO6A 2WL7A 4LMMA 4Z33A 1WJLA 2EEJA 4OAJA 4WYTA 2QKUA 4K6YA 1WG6A 4NMTA 2I0LA 2CSJA 2IWQA 1N7EA 2GZVA 2OS6A 3AXAA 3DJ3A 2W7RA 3MH7A 5F3XA 2BYGA 2JOAA 4E35A 1BE9A 2OMJA 2VSVA 2Z17A 5HFFA 2I04A 5HFDA 2EDPA 1UJUA 1TQ3A 1UITA 3KZDA 3GJ9A 2KG2A 3L4FD 1G9OA 2OZFA 5HF4A 1MC7A 2D90A 3CBXA 2EHRA 3VQGA 2AINA 2CSSA 1X5RA 1Z86A 1Z87A 1N7FA 3ID4A 5HDYA 4KFWA 4P2AB 2L4TA 1OBYA 2H2CA 4Q2PA 2JILA 2EGKA
chains in the Genus database with same CATH topology
4JOGA 3KDGA 2HE4A 3NGHA 3HPMA 1QLCA 2PA1A 4Q2QA 5GNDA 2M0VA 1RGRA 1UFXA 1WFGA 3BPUA 2RCZA 2REYA 3ZRTA 5E6PB 2H3MA 5ILBA 3QIKA 2LC7A 1V5QA 4R2ZA 4IC6A 1Y8TA 2PNTA 1T2MA 3GSLA 5H3JA 1IU0A 1K32A 1X5QA 2QT5A 5I7ZA 4GHNA 4E3BA 2OSGA 1VA8A 3OTPA 5E11A 1P1EA 2YUBA 2G2LA 2AWUA 2LA8A 2EDVA 5HJ1A 1U39A 2I1NA 3VQFA 2PKUA 1TP5A 4NMPA 3CYYA 3GDSA 2Q3GA 2LUIA 4JOKA 1GQ4A 2PKTA 4F8KA 1QAUA 1UM1A 2EJYA 2VRFA 4Q3HA 2Q9VA 1X6DA 1X5NA 3K50A 2EDZA 4GVCA 2KA9A 3ID1A 1OBZA 4JL7A 3ID2A 4NMQA 2K1ZA 1VCWA 1YBOA 1N6DA 5B6LA 4PQWA 3SHUA 1R6JA 2EGOA 2F0AA 3NFKA 5JXBA 2KOJA 2M3MA 4OEOA 4YDPA 3TSWA 1UEWA 2FN5A 2X7ZA 2RRMA 5HEDA 1Q3OA 2YT8A 3O46A 2P3WA 2JXOA 3CC0A 2QKTA 2EEHA 2ZPMA 2KOMA 1BFEA 3PV5A 4K78A 1GQ5A 1UJDA 1PDRA 2DJTA 3R69A 3KHFA 2DMZA 4NNLA 2EEIA 2VPHA 2F5YA 1V6BA 3CBYA 2MHOA 2DLUA 2KQFA 3DJAA 2G5MB 2H2BA 1X45A 3QJNA 1L6OA 2M0TA 5G1DA 5IL9A 2DC2A 1X8SA 2JINA 3TSZA 3NCVA 4HOPB 4NMRA 1RY4A 1M5ZA 1UEQA 2VWRA 2W4FA 4UU5A 3PDVA 5HF1A 3HVQC 4YYXA 1TP3A 1Q3PA 3CBZA 1NTEA 4K72A 2L97A 2KPLA 2MX6A 1U38A 3QE1A 2HE2A 4REYA 2YT7A 2M10A 3PV4A 4JOHA 1UEZA 3WKMA 1WI2A 2DLSA 4FLNA 2K20A 2DB5A 4H11A 3DJ1A 5HFEA 4HOPA 3PS4A 4NMVA 3LNYA 1QAVB 4GVDA 1WHDA 1WF8A 2M0UA 5DTHA 2PZDA 3HPKA 3GCOA 1OZIA 5E22A 2VSPA 2QBWA 3RL7A 1VJ6A 2M0ZA 5FB8C 5HETA 2KPKA 4JJ3A 2EAQA 3TSVA 1KEFA 1N99A 3SHWA 5HEBA 2IWOA 3QGLA 1N6EA 3GDUA 2R4HA 1N6FA 3DIWA 3GABA 2PDZA 2V90A 3JXTA 3SFJA 3OU0A 2YTWA 2JIKA 1UEPA 2KL1A 4NXQA 1Y7NA 2AWXA 3B76A 3GGEA 5EYZA 1MFGA 1FC7A 1Q7XA 2DM8A 1QAVA 3KZEA 3PDZA 1VAEA 1RZXA 1UJVA 3E17A 1FC6A 5HFBA 4JOFA 2GEFA 1P1DA 2H3LA 2I6VA 3QDOA 5E1YA 2JSNA 2OPGA 2UZCA 4XHVA 5A2PA 3K1RA 5G1EA 4O06A 3O5NA 3FY5A 2EV8A 2KJPA 2KBSA 3I1EA 4E34A 1KWAA 2Z9IA 4EDJA 4N6XA 4RI0A 3SOEA 2ZPLA 3CH8A 3EGHC 1SOZA 2KJKA 1W9EA 1IHJA 3MH4A 4MPAA 1WI4A 2HGAA 3K82A 3RLEA 4AMHA 4Q2NA 1U37A 2LC6A 2O2TA 2KRGA 4JORA 3KDKA 4JOJA 1TE0A 3QJMA 3GCNA 2QKVA 4Z8JA 2OQSA 5E21A 4P0CA 1NF3C 3CS0A 3SUZA 1FC9A 1XZ9A 2ENOA 2KV8A 3GDVA 1UHPA 4JOEA 1IU2A 4OEPA 4KFVA 1SOTA 1U3BA 1UM7A 1OBXA 5B42A 1WF7A 4Q2OA 2KJDA 2FCFA 4WYUA 1ZUBA 1V5LA 4JJ0A 1RGWA 1VB7A 2DAZA 2L4SA 4FGMA 1WHAA 2DKRA 4NMSA 5D13A 4K75A 1WFVA 1WH1A 3RL8A 1LCYA 2VZ5A 3R0HA 2R3YA 2KAWA 2E7KA 2D8IA 1FCFA 3ID3A 5F67A 3NFLA 4Q6SA 1UF1A 3MH6A 4NNMA 1W9QA 2JWEA 1KY9A 5HFCA 3TMHA 1X9ZA 4JOPA 2I0IA 2YUYA 2OGPA 4NXRA 2JREA 2I4SA 1V62A 2KYLA 3PV2A 4NXPA 1MFLA 5EZ0A 2D92A 1D5GA 4UU6A 5GLJA 2AWWA 4K76A 1N7TA 2CS5A 1I92A 2FE5A 3R68A 4NMOA 3I4WA 1B8QA 3STJA 4G69A 2EGNA 2IWNA 4L8NA 3I18A 1WIFA 2KOHA 4Q6HA 2EXGA 2IWPA 5HEYA 2FNEA 2EEGA 2OCSA 1ZOKA 1I16A 5FHTA 2QG1A 1GM1A 2V1WA 3WKLA 1V1TA 2LOBA 3LNXA 3DORA 1W9OA 3EGGC 3QO6A 2WL7A 4LMMA 4Z33A 1WJLA 2EEJA 4OAJA 4WYTA 2QKUA 4K6YA 1WG6A 4NMTA 2I0LA 2CSJA 2IWQA 1N7EA 2GZVA 2OS6A 3AXAA 3DJ3A 2W7RA 3MH7A 5F3XA 2BYGA 2JOAA 4E35A 1BE9A 2OMJA 2VSVA 2Z17A 5HFFA 2I04A 5HFDA 2EDPA 1UJUA 1TQ3A 1UITA 3KZDA 3GJ9A 2KG2A 3L4FD 1G9OA 2OZFA 5HF4A 1MC7A 2D90A 3CBXA 2EHRA 3VQGA 2AINA 2CSSA 1X5RA 1Z86A 1Z87A 1N7FA 3ID4A 5HDYA 4KFWA 4P2AB 2L4TA 1OBYA 2H2CA 4Q2PA 2JILA 2EGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOG A;  2HE4 A;  3NGH A;  3HPM A;  1QLC A;  2PA1 A;  4Q2Q A;  5GND A;  2M0V A;  1RGR A;  1UFX A;  1WFG A;  3BPU A;  2RCZ A;  2REY A;  3ZRT A;  5E6P B;  2H3M A;  3QIK A;  2LC7 A;  1V5Q A;  4R2Z A;  4IC6 A;  1Y8T A;  2PNT A;  1T2M A;  3GSL A;  5H3J A;  1IU0 A;  1K32 A;  1X5Q A;  2QT5 A;  5I7Z A;  4GHN A;  4E3B A;  2OSG A;  1VA8 A;  3OTP A;  5E11 A;  1P1E A;  2YUB A;  2G2L A;  2AWU A;  2LA8 A;  2EDV A;  5HJ1 A;  1U39 A;  2I1N A;  3VQF A;  2PKU A;  1TP5 A;  4NMP A;  3CYY A;  3GDS A;  2Q3G A;  2LUI A;  4JOK A;  1GQ4 A;  2PKT A;  4F8K A;  1QAU A;  1UM1 A;  2EJY A;  2VRF A;  4Q3H A;  2Q9V A;  1X6D A;  1X5N A;  3K50 A;  2EDZ A;  4GVC A;  2KA9 A;  3ID1 A;  1OBZ A;  4JL7 A;  3ID2 A;  4NMQ A;  2K1Z A;  1VCW A;  1YBO A;  1N6D A;  5B6L A;  4PQW A;  3SHU A;  1R6J A;  2EGO A;  2F0A A;  3NFK A;  5JXB A;  2KOJ A;  2M3M A;  4OEO A;  4YDP A;  3TSW A;  1UEW A;  2FN5 A;  2X7Z A;  2RRM A;  5HED A;  1Q3O A;  2YT8 A;  3O46 A;  2P3W A;  2JXO A;  3CC0 A;  2QKT A;  2EEH A;  2ZPM A;  2KOM A;  1BFE A;  3PV5 A;  4K78 A;  1GQ5 A;  1UJD A;  1PDR A;  2DJT A;  3R69 A;  3KHF A;  2DMZ A;  4NNL A;  2EEI A;  2VPH A;  2F5Y A;  1V6B A;  3CBY A;  2MHO A;  2DLU A;  2KQF A;  3DJA A;  2G5M B;  2H2B A;  1X45 A;  3QJN A;  1L6O A;  2M0T A;  5G1D A;  2DC2 A;  1X8S A;  2JIN A;  3TSZ A;  4HOP B;  4NMR A;  1RY4 A;  1M5Z A;  1UEQ A;  2VWR A;  2W4F A;  4UU5 A;  3PDV A;  5HF1 A;  3HVQ C;  4YYX A;  1TP3 A;  1Q3P A;  3CBZ A;  1NTE A;  4K72 A;  2L97 A;  2KPL A;  2MX6 A;  1U38 A;  3QE1 A;  2HE2 A;  4REY A;  2YT7 A;  2M10 A;  3PV4 A;  4JOH A;  1UEZ A;  3WKM A;  1WI2 A;  2DLS A;  2K20 A;  2DB5 A;  4H11 A;  3DJ1 A;  5HFE A;  4HOP A;  3PS4 A;  4NMV A;  3LNY A;  1QAV B;  4GVD A;  1WHD A;  1WF8 A;  2M0U A;  5DTH A;  2PZD A;  3HPK A;  3GCO A;  1OZI A;  5E22 A;  2VSP A;  2QBW A;  3RL7 A;  1VJ6 A;  2M0Z A;  5FB8 C;  5HET A;  2KPK A;  2EAQ A;  3TSV A;  1KEF A;  1N99 A;  3SHW A;  5HEB A;  2IWO A;  3QGL A;  1N6E A;  3GDU A;  2R4H A;  1N6F A;  3DIW A;  3JXT A;  2PDZ A;  2V90 A;  3SFJ A;  3OU0 A;  2YTW A;  2JIK A;  1UEP A;  2KL1 A;  4NXQ A;  1Y7N A;  2AWX A;  3B76 A;  3GGE A;  5EYZ A;  1MFG A;  1FC7 A;  1Q7X A;  2DM8 A;  1QAV A;  3KZE A;  3PDZ A;  1VAE A;  1RZX A;  1UJV A;  3E17 A;  1FC6 A;  5HFB A;  4JOF A;  1P1D A;  2H3L A;  2I6V A;  3QDO A;  5E1Y A;  2OPG A;  2UZC A;  4XHV A;  5A2P A;  3K1R A;  5G1E A;  4O06 A;  3O5N A;  3FY5 A;  2EV8 A;  2KJP A;  2KBS A;  3I1E A;  4E34 A;  1KWA A;  2Z9I A;  4EDJ A;  4N6X A;  4RI0 A;  3SOE A;  2ZPL A;  3CH8 A;  3EGH C;  1SOZ A;  2KJK A;  1W9E A;  1IHJ A;  3MH4 A;  4MPA A;  1WI4 A;  2HGA A;  3K82 A;  3RLE A;  4AMH A;  4Q2N A;  1U37 A;  2LC6 A;  2O2T A;  2KRG A;  4JOR A;  4JOJ A;  1TE0 A;  3QJM A;  3GCN A;  2QKV A;  4Z8J A;  2OQS A;  5E21 A;  4P0C A;  1NF3 C;  3CS0 A;  3SUZ A;  1FC9 A;  1XZ9 A;  2ENO A;  2KV8 A;  3GDV A;  1UHP A;  4JOE A;  1IU2 A;  4OEP A;  4KFV A;  1SOT A;  1U3B A;  1UM7 A;  1OBX A;  1WF7 A;  4Q2O A;  2KJD A;  2FCF A;  4WYU A;  1ZUB A;  1V5L A;  1RGW A;  1VB7 A;  2DAZ A;  2L4S A;  4FGM A;  1WHA A;  2DKR A;  4NMS A;  5D13 A;  4K75 A;  1WFV A;  1WH1 A;  3RL8 A;  1LCY A;  2VZ5 A;  3R0H A;  2R3Y A;  2KAW A;  2E7K A;  2D8I A;  1FCF A;  3ID3 A;  5F67 A;  3NFL A;  4Q6S A;  1UF1 A;  3MH6 A;  4NNM A;  1W9Q A;  2JWE A;  1KY9 A;  5HFC A;  3TMH A;  4JOP A;  2I0I A;  2YUY A;  2OGP A;  4NXR A;  2JRE A;  2I4S A;  1V62 A;  2KYL A;  3PV2 A;  4NXP A;  1MFL A;  5EZ0 A;  2D92 A;  1D5G A;  4UU6 A;  5GLJ A;  2AWW A;  4K76 A;  1N7T A;  2CS5 A;  1I92 A;  2FE5 A;  3R68 A;  4NMO A;  3I4W A;  1B8Q A;  3STJ A;  4G69 A;  2EGN A;  2IWN A;  4L8N A;  3I18 A;  1WIF A;  2KOH A;  4Q6H A;  2EXG A;  2IWP A;  5HEY A;  2FNE A;  2EEG A;  2OCS A;  1ZOK A;  1I16 A;  5FHT A;  2QG1 A;  1GM1 A;  2V1W A;  3WKL A;  1V1T A;  2LOB A;  3LNX A;  3DOR A;  1W9O A;  3EGG C;  3QO6 A;  2WL7 A;  4LMM A;  4Z33 A;  1WJL A;  2EEJ A;  4OAJ A;  4WYT A;  2QKU A;  4K6Y A;  1WG6 A;  4NMT A;  2I0L A;  2CSJ A;  2IWQ A;  1N7E A;  2GZV A;  2OS6 A;  3AXA A;  3DJ3 A;  2W7R A;  3MH7 A;  5F3X A;  2BYG A;  2JOA A;  4E35 A;  1BE9 A;  2OMJ A;  2VSV A;  2Z17 A;  5HFF A;  2I04 A;  5HFD A;  2EDP A;  1UJU A;  1TQ3 A;  1UIT A;  3KZD A;  3GJ9 A;  2KG2 A;  3L4F D;  1G9O A;  2OZF A;  5HF4 A;  1MC7 A;  2D90 A;  3CBX A;  2EHR A;  3VQG A;  2AIN A;  2CSS A;  1X5R A;  1Z86 A;  1Z87 A;  1N7F A;  3ID4 A;  5HDY A;  4KFW A;  4P2A B;  2L4T A;  1OBY A;  2H2C A;  4Q2P A;  2JIL A;  2EGK A; 
#chains in the Genus database with same CATH topology
 4JOG A;  3KDG A;  2HE4 A;  3NGH A;  3HPM A;  1QLC A;  2PA1 A;  4Q2Q A;  5GND A;  2M0V A;  1RGR A;  1UFX A;  1WFG A;  3BPU A;  2RCZ A;  2REY A;  3ZRT A;  5E6P B;  2H3M A;  5ILB A;  3QIK A;  2LC7 A;  1V5Q A;  4R2Z A;  4IC6 A;  1Y8T A;  2PNT A;  1T2M A;  3GSL A;  5H3J A;  1IU0 A;  1K32 A;  1X5Q A;  2QT5 A;  5I7Z A;  4GHN A;  4E3B A;  2OSG A;  1VA8 A;  3OTP A;  5E11 A;  1P1E A;  2YUB A;  2G2L A;  2AWU A;  2LA8 A;  2EDV A;  5HJ1 A;  1U39 A;  2I1N A;  3VQF A;  2PKU A;  1TP5 A;  4NMP A;  3CYY A;  3GDS A;  2Q3G A;  2LUI A;  4JOK A;  1GQ4 A;  2PKT A;  4F8K A;  1QAU A;  1UM1 A;  2EJY A;  2VRF A;  4Q3H A;  2Q9V A;  1X6D A;  1X5N A;  3K50 A;  2EDZ A;  4GVC A;  2KA9 A;  3ID1 A;  1OBZ A;  4JL7 A;  3ID2 A;  4NMQ A;  2K1Z A;  1VCW A;  1YBO A;  1N6D A;  5B6L A;  4PQW A;  3SHU A;  1R6J A;  2EGO A;  2F0A A;  3NFK A;  5JXB A;  2KOJ A;  2M3M A;  4OEO A;  4YDP A;  3TSW A;  1UEW A;  2FN5 A;  2X7Z A;  2RRM A;  5HED A;  1Q3O A;  2YT8 A;  3O46 A;  2P3W A;  2JXO A;  3CC0 A;  2QKT A;  2EEH A;  2ZPM A;  2KOM A;  1BFE A;  3PV5 A;  4K78 A;  1GQ5 A;  1UJD A;  1PDR A;  2DJT A;  3R69 A;  3KHF A;  2DMZ A;  4NNL A;  2EEI A;  2VPH A;  2F5Y A;  1V6B A;  3CBY A;  2MHO A;  2DLU A;  2KQF A;  3DJA A;  2G5M B;  2H2B A;  1X45 A;  3QJN A;  1L6O A;  2M0T A;  5G1D A;  5IL9 A;  2DC2 A;  1X8S A;  2JIN A;  3TSZ A;  3NCV A;  4HOP B;  4NMR A;  1RY4 A;  1M5Z A;  1UEQ A;  2VWR A;  2W4F A;  4UU5 A;  3PDV A;  5HF1 A;  3HVQ C;  4YYX A;  1TP3 A;  1Q3P A;  3CBZ A;  1NTE A;  4K72 A;  2L97 A;  2KPL A;  2MX6 A;  1U38 A;  3QE1 A;  2HE2 A;  4REY A;  2YT7 A;  2M10 A;  3PV4 A;  4JOH A;  1UEZ A;  3WKM A;  1WI2 A;  2DLS A;  4FLN A;  2K20 A;  2DB5 A;  4H11 A;  3DJ1 A;  5HFE A;  4HOP A;  3PS4 A;  4NMV A;  3LNY A;  1QAV B;  4GVD A;  1WHD A;  1WF8 A;  2M0U A;  5DTH A;  2PZD A;  3HPK A;  3GCO A;  1OZI A;  5E22 A;  2VSP A;  2QBW A;  3RL7 A;  1VJ6 A;  2M0Z A;  5FB8 C;  5HET A;  2KPK A;  4JJ3 A;  2EAQ A;  3TSV A;  1KEF A;  1N99 A;  3SHW A;  5HEB A;  2IWO A;  3QGL A;  1N6E A;  3GDU A;  2R4H A;  1N6F A;  3DIW A;  3GAB A;  2PDZ A;  2V90 A;  3JXT A;  3SFJ A;  3OU0 A;  2YTW A;  2JIK A;  1UEP A;  2KL1 A;  4NXQ A;  1Y7N A;  2AWX A;  3B76 A;  3GGE A;  5EYZ A;  1MFG A;  1FC7 A;  1Q7X A;  2DM8 A;  1QAV A;  3KZE A;  3PDZ A;  1VAE A;  1RZX A;  1UJV A;  3E17 A;  1FC6 A;  5HFB A;  4JOF A;  2GEF A;  1P1D A;  2H3L A;  2I6V A;  3QDO A;  5E1Y A;  2JSN A;  2OPG A;  2UZC A;  4XHV A;  5A2P A;  3K1R A;  5G1E A;  4O06 A;  3O5N A;  3FY5 A;  2EV8 A;  2KJP A;  2KBS A;  3I1E A;  4E34 A;  1KWA A;  2Z9I A;  4EDJ A;  4N6X A;  4RI0 A;  3SOE A;  2ZPL A;  3CH8 A;  3EGH C;  1SOZ A;  2KJK A;  1W9E A;  1IHJ A;  3MH4 A;  4MPA A;  1WI4 A;  2HGA A;  3K82 A;  3RLE A;  4AMH A;  4Q2N A;  1U37 A;  2LC6 A;  2O2T A;  2KRG A;  4JOR A;  3KDK A;  4JOJ A;  1TE0 A;  3QJM A;  3GCN A;  2QKV A;  4Z8J A;  2OQS A;  5E21 A;  4P0C A;  1NF3 C;  3CS0 A;  3SUZ A;  1FC9 A;  1XZ9 A;  2ENO A;  2KV8 A;  3GDV A;  1UHP A;  4JOE A;  1IU2 A;  4OEP A;  4KFV A;  1SOT A;  1U3B A;  1UM7 A;  1OBX A;  5B42 A;  1WF7 A;  4Q2O A;  2KJD A;  2FCF A;  4WYU A;  1ZUB A;  1V5L A;  4JJ0 A;  1RGW A;  1VB7 A;  2DAZ A;  2L4S A;  4FGM A;  1WHA A;  2DKR A;  4NMS A;  5D13 A;  4K75 A;  1WFV A;  1WH1 A;  3RL8 A;  1LCY A;  2VZ5 A;  3R0H A;  2R3Y A;  2KAW A;  2E7K A;  2D8I A;  1FCF A;  3ID3 A;  5F67 A;  3NFL A;  4Q6S A;  1UF1 A;  3MH6 A;  4NNM A;  1W9Q A;  2JWE A;  1KY9 A;  5HFC A;  3TMH A;  1X9Z A;  4JOP A;  2I0I A;  2YUY A;  2OGP A;  4NXR A;  2JRE A;  2I4S A;  1V62 A;  2KYL A;  3PV2 A;  4NXP A;  1MFL A;  5EZ0 A;  2D92 A;  1D5G A;  4UU6 A;  5GLJ A;  2AWW A;  4K76 A;  1N7T A;  2CS5 A;  1I92 A;  2FE5 A;  3R68 A;  4NMO A;  3I4W A;  1B8Q A;  3STJ A;  4G69 A;  2EGN A;  2IWN A;  4L8N A;  3I18 A;  1WIF A;  2KOH A;  4Q6H A;  2EXG A;  2IWP A;  5HEY A;  2FNE A;  2EEG A;  2OCS A;  1ZOK A;  1I16 A;  5FHT A;  2QG1 A;  1GM1 A;  2V1W A;  3WKL A;  1V1T A;  2LOB A;  3LNX A;  3DOR A;  1W9O A;  3EGG C;  3QO6 A;  2WL7 A;  4LMM A;  4Z33 A;  1WJL A;  2EEJ A;  4OAJ A;  4WYT A;  2QKU A;  4K6Y A;  1WG6 A;  4NMT A;  2I0L A;  2CSJ A;  2IWQ A;  1N7E A;  2GZV A;  2OS6 A;  3AXA A;  3DJ3 A;  2W7R A;  3MH7 A;  5F3X A;  2BYG A;  2JOA A;  4E35 A;  1BE9 A;  2OMJ A;  2VSV A;  2Z17 A;  5HFF A;  2I04 A;  5HFD A;  2EDP A;  1UJU A;  1TQ3 A;  1UIT A;  3KZD A;  3GJ9 A;  2KG2 A;  3L4F D;  1G9O A;  2OZF A;  5HF4 A;  1MC7 A;  2D90 A;  3CBX A;  2EHR A;  3VQG A;  2AIN A;  2CSS A;  1X5R A;  1Z86 A;  1Z87 A;  1N7F A;  3ID4 A;  5HDY A;  4KFW A;  4P2A B;  2L4T A;  1OBY A;  2H2C A;  4Q2P A;  2JIL A;  2EGK A; 
#chains in the Genus database with same CATH homology
 4JOG A;  3KDG A;  2HE4 A;  3NGH A;  3HPM A;  1QLC A;  2PA1 A;  4Q2Q A;  5GND A;  2M0V A;  1RGR A;  1UFX A;  1WFG A;  3BPU A;  2RCZ A;  2REY A;  3ZRT A;  5E6P B;  2H3M A;  5ILB A;  3QIK A;  2LC7 A;  1V5Q A;  4R2Z A;  4IC6 A;  1Y8T A;  2PNT A;  1T2M A;  3GSL A;  5H3J A;  1IU0 A;  1K32 A;  1X5Q A;  2QT5 A;  5I7Z A;  4GHN A;  4E3B A;  2OSG A;  1VA8 A;  3OTP A;  5E11 A;  1P1E A;  2YUB A;  2G2L A;  2AWU A;  2LA8 A;  2EDV A;  5HJ1 A;  1U39 A;  2I1N A;  3VQF A;  2PKU A;  1TP5 A;  4NMP A;  3CYY A;  3GDS A;  2Q3G A;  2LUI A;  4JOK A;  1GQ4 A;  2PKT A;  4F8K A;  1QAU A;  1UM1 A;  2EJY A;  2VRF A;  4Q3H A;  2Q9V A;  1X6D A;  1X5N A;  3K50 A;  2EDZ A;  4GVC A;  2KA9 A;  3ID1 A;  1OBZ A;  4JL7 A;  3ID2 A;  4NMQ A;  2K1Z A;  1VCW A;  1YBO A;  1N6D A;  5B6L A;  4PQW A;  3SHU A;  1R6J A;  2EGO A;  2F0A A;  3NFK A;  5JXB A;  2KOJ A;  2M3M A;  4OEO A;  4YDP A;  3TSW A;  1UEW A;  2FN5 A;  2X7Z A;  2RRM A;  5HED A;  1Q3O A;  2YT8 A;  3O46 A;  2P3W A;  2JXO A;  3CC0 A;  2QKT A;  2EEH A;  2ZPM A;  2KOM A;  1BFE A;  3PV5 A;  4K78 A;  1GQ5 A;  1UJD A;  1PDR A;  2DJT A;  3R69 A;  3KHF A;  2DMZ A;  4NNL A;  2EEI A;  2VPH A;  2F5Y A;  1V6B A;  3CBY A;  2MHO A;  2DLU A;  2KQF A;  3DJA A;  2G5M B;  2H2B A;  1X45 A;  3QJN A;  1L6O A;  2M0T A;  5G1D A;  5IL9 A;  2DC2 A;  1X8S A;  2JIN A;  3TSZ A;  3NCV A;  4HOP B;  4NMR A;  1RY4 A;  1M5Z A;  1UEQ A;  2VWR A;  2W4F A;  4UU5 A;  3PDV A;  5HF1 A;  3HVQ C;  4YYX A;  1TP3 A;  1Q3P A;  3CBZ A;  1NTE A;  4K72 A;  2L97 A;  2KPL A;  2MX6 A;  1U38 A;  3QE1 A;  2HE2 A;  4REY A;  2YT7 A;  2M10 A;  3PV4 A;  4JOH A;  1UEZ A;  3WKM A;  1WI2 A;  2DLS A;  4FLN A;  2K20 A;  2DB5 A;  4H11 A;  3DJ1 A;  5HFE A;  4HOP A;  3PS4 A;  4NMV A;  3LNY A;  1QAV B;  4GVD A;  1WHD A;  1WF8 A;  2M0U A;  5DTH A;  2PZD A;  3HPK A;  3GCO A;  1OZI A;  5E22 A;  2VSP A;  2QBW A;  3RL7 A;  1VJ6 A;  2M0Z A;  5FB8 C;  5HET A;  2KPK A;  4JJ3 A;  2EAQ A;  3TSV A;  1KEF A;  1N99 A;  3SHW A;  5HEB A;  2IWO A;  3QGL A;  1N6E A;  3GDU A;  2R4H A;  1N6F A;  3DIW A;  3GAB A;  2PDZ A;  2V90 A;  3JXT A;  3SFJ A;  3OU0 A;  2YTW A;  2JIK A;  1UEP A;  2KL1 A;  4NXQ A;  1Y7N A;  2AWX A;  3B76 A;  3GGE A;  5EYZ A;  1MFG A;  1FC7 A;  1Q7X A;  2DM8 A;  1QAV A;  3KZE A;  3PDZ A;  1VAE A;  1RZX A;  1UJV A;  3E17 A;  1FC6 A;  5HFB A;  4JOF A;  2GEF A;  1P1D A;  2H3L A;  2I6V A;  3QDO A;  5E1Y A;  2JSN A;  2OPG A;  2UZC A;  4XHV A;  5A2P A;  3K1R A;  5G1E A;  4O06 A;  3O5N A;  3FY5 A;  2EV8 A;  2KJP A;  2KBS A;  3I1E A;  4E34 A;  1KWA A;  2Z9I A;  4EDJ A;  4N6X A;  4RI0 A;  3SOE A;  2ZPL A;  3CH8 A;  3EGH C;  1SOZ A;  2KJK A;  1W9E A;  1IHJ A;  3MH4 A;  4MPA A;  1WI4 A;  2HGA A;  3K82 A;  3RLE A;  4AMH A;  4Q2N A;  1U37 A;  2LC6 A;  2O2T A;  2KRG A;  4JOR A;  3KDK A;  4JOJ A;  1TE0 A;  3QJM A;  3GCN A;  2QKV A;  4Z8J A;  2OQS A;  5E21 A;  4P0C A;  1NF3 C;  3CS0 A;  3SUZ A;  1FC9 A;  1XZ9 A;  2ENO A;  2KV8 A;  3GDV A;  1UHP A;  4JOE A;  1IU2 A;  4OEP A;  4KFV A;  1SOT A;  1U3B A;  1UM7 A;  1OBX A;  5B42 A;  1WF7 A;  4Q2O A;  2KJD A;  2FCF A;  4WYU A;  1ZUB A;  1V5L A;  4JJ0 A;  1RGW A;  1VB7 A;  2DAZ A;  2L4S A;  4FGM A;  1WHA A;  2DKR A;  4NMS A;  5D13 A;  4K75 A;  1WFV A;  1WH1 A;  3RL8 A;  1LCY A;  2VZ5 A;  3R0H A;  2R3Y A;  2KAW A;  2E7K A;  2D8I A;  1FCF A;  3ID3 A;  5F67 A;  3NFL A;  4Q6S A;  1UF1 A;  3MH6 A;  4NNM A;  1W9Q A;  2JWE A;  1KY9 A;  5HFC A;  3TMH A;  1X9Z A;  4JOP A;  2I0I A;  2YUY A;  2OGP A;  4NXR A;  2JRE A;  2I4S A;  1V62 A;  2KYL A;  3PV2 A;  4NXP A;  1MFL A;  5EZ0 A;  2D92 A;  1D5G A;  4UU6 A;  5GLJ A;  2AWW A;  4K76 A;  1N7T A;  2CS5 A;  1I92 A;  2FE5 A;  3R68 A;  4NMO A;  3I4W A;  1B8Q A;  3STJ A;  4G69 A;  2EGN A;  2IWN A;  4L8N A;  3I18 A;  1WIF A;  2KOH A;  4Q6H A;  2EXG A;  2IWP A;  5HEY A;  2FNE A;  2EEG A;  2OCS A;  1ZOK A;  1I16 A;  5FHT A;  2QG1 A;  1GM1 A;  2V1W A;  3WKL A;  1V1T A;  2LOB A;  3LNX A;  3DOR A;  1W9O A;  3EGG C;  3QO6 A;  2WL7 A;  4LMM A;  4Z33 A;  1WJL A;  2EEJ A;  4OAJ A;  4WYT A;  2QKU A;  4K6Y A;  1WG6 A;  4NMT A;  2I0L A;  2CSJ A;  2IWQ A;  1N7E A;  2GZV A;  2OS6 A;  3AXA A;  3DJ3 A;  2W7R A;  3MH7 A;  5F3X A;  2BYG A;  2JOA A;  4E35 A;  1BE9 A;  2OMJ A;  2VSV A;  2Z17 A;  5HFF A;  2I04 A;  5HFD A;  2EDP A;  1UJU A;  1TQ3 A;  1UIT A;  3KZD A;  3GJ9 A;  2KG2 A;  3L4F D;  1G9O A;  2OZF A;  5HF4 A;  1MC7 A;  2D90 A;  3CBX A;  2EHR A;  3VQG A;  2AIN A;  2CSS A;  1X5R A;  1Z86 A;  1Z87 A;  1N7F A;  3ID4 A;  5HDY A;  4KFW A;  4P2A B;  2L4T A;  1OBY A;  2H2C A;  4Q2P A;  2JIL A;  2EGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...