1L6OA

Xenopus dishevelled pdz domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
MIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Segment polarity protein dishevelled homolog DVL-2
publication title Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Gene regulation
total genus 17
structure length 95
sequence length 95
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1l6oA00
3SOEA 2QKUA 4Z33A 1I16A 2M0ZA 2P3WA 4NMTA 5JXBA 2KPLA 1UEPA 2EEHA 1N7FA 4Q3HA 3HPKA 4JORA 5HF1A 2I04A 2EDZA 2EAQA 4FGMA 5E6PB 4XHVA 3O46A 3CBYA 2EEIA 1SOZA 2VRFA 4NMSA 2I4SA 1V5LA 4YYXA 1UJUA 3QIKA 4YDPA 2O2TA 4WYTA 4NXRA 2Q9VA 2JREA 5F3XA 2RCZA 2REYA 1N6DA 3LNYA 1P1EA 3CBXA 3ID4A 4Z8JA 4Q2QA 2KG2A 2JILA 2JOAA 5HEYA 4Q6SA 2YUBA 1UEZA 4WYUA 2VSVA 1WHDA 5HFFA 2AWUA 4GHNA 5HFEA 5DTHA 4OEPA 2I0LA 4JOGA 4GVCA 1TP3A 3I4WA 4P2AB 2VWRA 2KOHA 3VQGA 1KY9A 1UITA 2VSPA 2DMZA 4JL7A 1VJ6A 5H3JA 2YUYA 1OZIA 2PA1A 3DIWA 3ID3A 4K75A 5GLJA 1RY4A 1X5NA 2IWQA 5HF4A 3VQFA 4GVDA 2PKTA 2ZPLA 3RL7A 5HJ1A 2KL1A 1G9OA 2E7KA 1QAVB 1Y8TA 3CH8A 1KEFA 2OCSA 2K20A 1WIFA 3WKMA 3SHWA 2DM8A 5E21A 3RLEA 5HFBA 2EXGA 1KWAA 2KBSA 2I1NA 2H2BA 3QO6A 4N6XA 1ZUBA 2V90A 2KJPA 3GJ9A 1QLCA 2EDVA 2R4HA 1L6OA 3OU0A 1MFLA 3STJA 1WJLA 2RRMA 3I18A 2OMJA 1UJVA 3GDSA 2G2LA 1GM1A 2KV8A 1TE0A 3DORA 1UM7A 2KRGA 1UEQA 4JOHA 2HE2A 2EGOA 1I92A 5HFCA 3B76A 3CYYA 3KHFA 1U38A 4Q6HA 2W4FA 2PNTA 2X7ZA 3BPUA 1TQ3A 2EDPA 2IWOA 1WH1A 4OEOA 3PDZA 5HEBA 2CSSA 4NXPA 2JWEA 5HETA 1W9EA 1K32A 2YT8A 1Q3PA 2MX6A 2OQSA 2DC2A 2EV8A 2LC6A 1P1DA 1UFXA 3QDOA 2M10A 2KYLA 2M0UA 2K1ZA 5FB8C 3K82A 3GGEA 2FCFA 2KQFA 2DLSA 2FN5A 2EEJA 1FC6A 4UU5A 4LMMA 2WL7A 3KZEA 1YBOA 2JXOA 1WF8A 4HOPB 1MC7A 1RZXA 2L4TA 2EJYA 2KJKA 2KPKA 2VPHA 3GDVA 3HVQC 2D90A 1LCYA 2KOMA 2YTWA 5HDYA 4AMHA 5EYZA 1VCWA 2OPGA 2QBWA 4E34A 1WI2A 1WI4A 3QJMA 2H2CA 2F5YA 2W7RA 4KFVA 4NMVA 5I7ZA 2CS5A 1OBYA 3TSVA 3I1EA 2IWPA 4KFWA 3AXAA 3ID1A 1ZOKA 1D5GA 2PKUA 4E3BA 2DLUA 2HE4A 1QAUA 1FCFA 5F67A 1OBZA 1XZ9A 2ZPMA 4NMQA 2F0AA 2H3LA 4JOJA 5G1DA 1X45A 4RI0A 1N99A 2HGAA 1VAEA 2OZFA 3DJAA 1V62A 1V5QA 2AINA 3QE1A 1X5QA 5EZ0A 3QJNA 2EEGA 3O5NA 2KJDA 2KAWA 1GQ4A 1Z86A 4NXQA 4Q2PA 1NTEA 3TMHA 5FHTA 4NNMA 2JINA 2L97A 4L8NA 1RGRA 3OTPA 3QGLA 4JOEA 1X8SA 3NFKA 2YT7A 2DAZA 5HFDA 5GNDA 2L4SA 4E35A 2I0IA 1Z87A 2PZDA 3GDUA 3NGHA 3PV2A 1VA8A 1WFGA 1WFVA 1R6JA 3R69A 1M5ZA 2AWWA 4NNLA 2MHOA 1VB7A 2CSJA 4REYA 3NFLA 4R2ZA 2Z9IA 1WG6A 3MH7A 1NF3C 1UHPA 4HOPA 3FY5A 1WF7A 3WKLA 3MH6A 1SOTA 1V6BA 1X5RA 3SHUA 3GCNA 2I6VA 5D13A 4JOKA 2IWNA 1BE9A 3R68A 2DKRA 4Q2NA 4NMPA 4IC6A 3PS4A 5G1EA 3PDVA 1GQ5A 1N7TA 1RGWA 1WHAA 2FE5A 3PV5A 3SUZA 3GSLA 4K6YA 2D8IA 2DJTA 2V1WA 5B6LA 2M0TA 1N7EA 2OGPA 4K78A 1UEWA 1TP5A 1N6FA 3TSWA 1QAVA 5E1YA 3K50A 3JXTA 1Q3OA 3CC0A 4Q2OA 3TSZA 5E11A 2FNEA 1IHJA 1PDRA 4PQWA 2AWXA 1U39A 1X6DA 3L4FD 4K72A 1V1TA 3DJ3A 2M3MA 5E22A 4K76A 2Q3GA 4O06A 4OAJA 2H3MA 3ID2A 5HEDA 3CS0A 3PV4A 2LUIA 1Y7NA 3EGGC 2G5MB 4F8KA 4H11A 2Z17A 3SFJA 4NMRA 1FC7A 1UM1A 1U3BA 2LA8A 3R0HA 1OBXA 2EGKA 4JOPA 1W9QA 3EGHC 2LC7A 1U37A 2M0VA 1B8QA 2BYGA 3ZRTA 3E17A 2QG1A 4EDJA 1BFEA 4MPAA 2EGNA 2PDZA 2QT5A 2QKVA 1IU0A 2GZVA 3HPMA 3MH4A 2OS6A 1UJDA 2DB5A 4JOFA 2R3YA 2D92A 1UF1A 4G69A 3KZDA 3GCOA 2KA9A 1IU2A 1T2MA 1N6EA 2LOBA 1FC9A 4NMOA 2JIKA 3DJ1A 1Q7XA 1W9OA 2EHRA 2OSGA 5A2PA 2KOJA 2UZCA 3K1RA 2ENOA 2VZ5A 3LNXA 3RL8A 2QKTA 3CBZA 4P0CA 4UU6A 1MFGA
chains in the Genus database with same CATH superfamily
3SOEA 2QKUA 4Z33A 1I16A 2M0ZA 2P3WA 4NMTA 5JXBA 2KPLA 1UEPA 2EEHA 1N7FA 4Q3HA 3HPKA 4JORA 5HF1A 2I04A 2EDZA 2EAQA 4FGMA 5E6PB 4XHVA 3O46A 3CBYA 2EEIA 1SOZA 2VRFA 4NMSA 2I4SA 1V5LA 4YYXA 1UJUA 3KDKA 3QIKA 4YDPA 2O2TA 4WYTA 4NXRA 2Q9VA 2JREA 5F3XA 2RCZA 2REYA 1N6DA 3LNYA 1P1EA 3CBXA 3ID4A 4Z8JA 4Q2QA 2KG2A 2JILA 2JOAA 5HEYA 4Q6SA 2YUBA 1UEZA 4WYUA 2VSVA 1WHDA 5HFFA 2AWUA 4GHNA 5HFEA 5DTHA 4OEPA 2I0LA 4JOGA 4GVCA 1TP3A 3I4WA 4P2AB 2VWRA 2KOHA 3GABA 3VQGA 1KY9A 1UITA 2VSPA 2DMZA 4JL7A 1VJ6A 5H3JA 2YUYA 1OZIA 2PA1A 3DIWA 3ID3A 4K75A 5GLJA 1RY4A 1X5NA 2IWQA 5HF4A 3VQFA 4GVDA 2PKTA 2ZPLA 3RL7A 5HJ1A 2KL1A 1G9OA 2E7KA 1QAVB 1Y8TA 3CH8A 1KEFA 2OCSA 2K20A 1WIFA 3WKMA 3SHWA 2DM8A 5E21A 3RLEA 5HFBA 2EXGA 1KWAA 2KBSA 2I1NA 2H2BA 3QO6A 4N6XA 1ZUBA 2V90A 2KJPA 3GJ9A 1QLCA 2EDVA 2R4HA 1L6OA 3NCVA 3OU0A 1MFLA 3STJA 1WJLA 2RRMA 3I18A 2OMJA 1UJVA 3GDSA 2G2LA 1GM1A 2KV8A 1TE0A 3DORA 1UM7A 2KRGA 1UEQA 4JOHA 2HE2A 2EGOA 1I92A 5HFCA 3B76A 3CYYA 3KHFA 1U38A 4Q6HA 2W4FA 2PNTA 2X7ZA 3BPUA 1TQ3A 2EDPA 2IWOA 1WH1A 4OEOA 3PDZA 5HEBA 2CSSA 4NXPA 2JWEA 5HETA 1W9EA 1K32A 2YT8A 1Q3PA 2MX6A 2OQSA 2DC2A 4JJ3A 2EV8A 2LC6A 1P1DA 1UFXA 3QDOA 2M10A 2KYLA 2M0UA 2K1ZA 5FB8C 3K82A 3GGEA 2FCFA 2KQFA 2DLSA 2FN5A 2EEJA 1FC6A 4UU5A 4LMMA 2WL7A 3KZEA 1YBOA 2JXOA 1WF8A 4HOPB 1MC7A 1RZXA 2L4TA 2EJYA 2KJKA 2KPKA 2VPHA 3GDVA 3HVQC 2D90A 1LCYA 2KOMA 2YTWA 5HDYA 4AMHA 5EYZA 1X9ZA 1VCWA 2OPGA 2QBWA 4E34A 1WI2A 1WI4A 3QJMA 2H2CA 2F5YA 2W7RA 4KFVA 4NMVA 5I7ZA 2CS5A 1OBYA 3TSVA 3I1EA 2IWPA 4KFWA 3AXAA 3ID1A 1ZOKA 1D5GA 2PKUA 4E3BA 2DLUA 5ILBA 2HE4A 1QAUA 1FCFA 5F67A 1OBZA 1XZ9A 2ZPMA 4NMQA 2F0AA 2H3LA 4JOJA 5G1DA 1X45A 4RI0A 1N99A 2HGAA 1VAEA 2OZFA 3DJAA 1V62A 1V5QA 2AINA 3QE1A 1X5QA 5EZ0A 3QJNA 2EEGA 3O5NA 2KJDA 2KAWA 1GQ4A 1Z86A 4NXQA 4Q2PA 1NTEA 3TMHA 5FHTA 4NNMA 2JINA 2L97A 4L8NA 1RGRA 3OTPA 3QGLA 4JOEA 1X8SA 3NFKA 2YT7A 2DAZA 5HFDA 5GNDA 2L4SA 4E35A 2I0IA 1Z87A 2PZDA 3GDUA 3NGHA 3PV2A 1VA8A 1WFGA 1WFVA 2JSNA 1R6JA 3R69A 1M5ZA 2AWWA 4NNLA 2MHOA 1VB7A 2CSJA 4REYA 3NFLA 4R2ZA 2Z9IA 1WG6A 3MH7A 1NF3C 1UHPA 4HOPA 3FY5A 1WF7A 3WKLA 3MH6A 1SOTA 1V6BA 1X5RA 5B42A 3SHUA 3GCNA 2I6VA 5D13A 4JOKA 2IWNA 1BE9A 3R68A 2DKRA 4Q2NA 4NMPA 4IC6A 3PS4A 5G1EA 3PDVA 1GQ5A 1N7TA 1RGWA 1WHAA 2FE5A 3PV5A 3SUZA 3GSLA 4K6YA 2D8IA 2DJTA 2V1WA 5B6LA 2M0TA 1N7EA 2OGPA 4K78A 1UEWA 1TP5A 1N6FA 3TSWA 1QAVA 5E1YA 3K50A 3JXTA 1Q3OA 3CC0A 4Q2OA 3TSZA 5E11A 2FNEA 1IHJA 1PDRA 4PQWA 2AWXA 1U39A 1X6DA 3L4FD 4K72A 1V1TA 3DJ3A 2M3MA 5E22A 4K76A 2Q3GA 4O06A 4OAJA 2H3MA 3ID2A 5HEDA 3CS0A 3PV4A 2LUIA 1Y7NA 3EGGC 2G5MB 4F8KA 4H11A 2Z17A 3SFJA 4NMRA 1FC7A 1UM1A 1U3BA 2LA8A 3R0HA 1OBXA 2EGKA 4JOPA 1W9QA 3EGHC 2LC7A 1U37A 2M0VA 1B8QA 2BYGA 3ZRTA 3E17A 2QG1A 4JJ0A 4EDJA 1BFEA 4MPAA 2EGNA 2PDZA 2QT5A 2QKVA 1IU0A 2GZVA 3HPMA 3KDGA 3MH4A 2OS6A 1UJDA 2DB5A 4JOFA 2R3YA 2D92A 1UF1A 4G69A 3KZDA 3GCOA 2KA9A 1IU2A 1T2MA 1N6EA 2LOBA 1FC9A 4NMOA 2JIKA 3DJ1A 1Q7XA 1W9OA 2EHRA 2OSGA 5A2PA 5IL9A 2KOJA 2UZCA 3K1RA 2ENOA 2GEFA 2VZ5A 4FLNA 3LNXA 3RL8A 2QKTA 3CBZA 4P0CA 4UU6A 1MFGA
chains in the Genus database with same CATH topology
3SOEA 2QKUA 4Z33A 1I16A 2M0ZA 2P3WA 4NMTA 5JXBA 2KPLA 1UEPA 2EEHA 1N7FA 4Q3HA 3HPKA 4JORA 5HF1A 2I04A 2EDZA 2EAQA 4FGMA 5E6PB 4XHVA 3O46A 3CBYA 2EEIA 1SOZA 2VRFA 4NMSA 2I4SA 1V5LA 4YYXA 1UJUA 3KDKA 3QIKA 4YDPA 2O2TA 4WYTA 4NXRA 2Q9VA 2JREA 5F3XA 2RCZA 2REYA 1N6DA 3LNYA 1P1EA 3CBXA 3ID4A 4Z8JA 4Q2QA 2KG2A 2JILA 2JOAA 5HEYA 4Q6SA 2YUBA 1UEZA 4WYUA 2VSVA 1WHDA 5HFFA 2AWUA 4GHNA 5HFEA 5DTHA 4OEPA 2I0LA 4JOGA 4GVCA 1TP3A 3I4WA 4P2AB 2VWRA 2KOHA 3GABA 3VQGA 1KY9A 1UITA 2VSPA 2DMZA 4JL7A 1VJ6A 5H3JA 2YUYA 1OZIA 2PA1A 3DIWA 3ID3A 4K75A 5GLJA 1RY4A 1X5NA 2IWQA 5HF4A 3VQFA 4GVDA 2PKTA 2ZPLA 3RL7A 5HJ1A 2KL1A 1G9OA 2E7KA 1QAVB 1Y8TA 3CH8A 1KEFA 2OCSA 2K20A 1WIFA 3WKMA 3SHWA 2DM8A 5E21A 3RLEA 5HFBA 2EXGA 1KWAA 2KBSA 2I1NA 2H2BA 3QO6A 4N6XA 1ZUBA 2V90A 2KJPA 3GJ9A 1QLCA 2EDVA 2R4HA 1L6OA 3NCVA 3OU0A 1MFLA 3STJA 1WJLA 2RRMA 3I18A 2OMJA 1UJVA 3GDSA 2G2LA 1GM1A 2KV8A 1TE0A 3DORA 1UM7A 2KRGA 1UEQA 4JOHA 2HE2A 2EGOA 1I92A 5HFCA 3B76A 3CYYA 3KHFA 1U38A 4Q6HA 2W4FA 2PNTA 2X7ZA 3BPUA 1TQ3A 2EDPA 2IWOA 1WH1A 4OEOA 3PDZA 5HEBA 2CSSA 4NXPA 2JWEA 5HETA 1W9EA 1K32A 2YT8A 1Q3PA 2MX6A 2OQSA 2DC2A 4JJ3A 2EV8A 2LC6A 1P1DA 1UFXA 3QDOA 2M10A 2KYLA 2M0UA 2K1ZA 5FB8C 3K82A 3GGEA 2FCFA 2KQFA 2DLSA 2FN5A 2EEJA 1FC6A 4UU5A 4LMMA 2WL7A 3KZEA 1YBOA 2JXOA 1WF8A 4HOPB 1MC7A 1RZXA 2L4TA 2EJYA 2KJKA 2KPKA 2VPHA 3GDVA 3HVQC 2D90A 1LCYA 2KOMA 2YTWA 5HDYA 4AMHA 5EYZA 1X9ZA 1VCWA 2OPGA 2QBWA 4E34A 1WI2A 1WI4A 3QJMA 2H2CA 2F5YA 2W7RA 4KFVA 4NMVA 5I7ZA 2CS5A 1OBYA 3TSVA 3I1EA 2IWPA 4KFWA 3AXAA 3ID1A 1ZOKA 1D5GA 2PKUA 4E3BA 2DLUA 5ILBA 2HE4A 1QAUA 1FCFA 5F67A 1OBZA 1XZ9A 2ZPMA 4NMQA 2F0AA 2H3LA 4JOJA 5G1DA 1X45A 4RI0A 1N99A 2HGAA 1VAEA 2OZFA 3DJAA 1V62A 1V5QA 2AINA 3QE1A 1X5QA 5EZ0A 3QJNA 2EEGA 3O5NA 2KJDA 2KAWA 1GQ4A 1Z86A 4NXQA 4Q2PA 1NTEA 3TMHA 5FHTA 4NNMA 2JINA 2L97A 4L8NA 1RGRA 3OTPA 3QGLA 4JOEA 1X8SA 3NFKA 2YT7A 2DAZA 5HFDA 5GNDA 2L4SA 4E35A 2I0IA 1Z87A 2PZDA 3GDUA 3NGHA 3PV2A 1VA8A 1WFGA 1WFVA 2JSNA 1R6JA 3R69A 1M5ZA 2AWWA 4NNLA 2MHOA 1VB7A 2CSJA 4REYA 3NFLA 4R2ZA 2Z9IA 1WG6A 3MH7A 1NF3C 1UHPA 4HOPA 3FY5A 1WF7A 3WKLA 3MH6A 1SOTA 1V6BA 1X5RA 5B42A 3SHUA 3GCNA 2I6VA 5D13A 4JOKA 2IWNA 1BE9A 3R68A 2DKRA 4Q2NA 4NMPA 4IC6A 3PS4A 5G1EA 3PDVA 1GQ5A 1N7TA 1RGWA 1WHAA 2FE5A 3PV5A 3SUZA 3GSLA 4K6YA 2D8IA 2DJTA 2V1WA 5B6LA 2M0TA 1N7EA 2OGPA 4K78A 1UEWA 1TP5A 1N6FA 3TSWA 1QAVA 5E1YA 3K50A 3JXTA 1Q3OA 3CC0A 4Q2OA 3TSZA 5E11A 2FNEA 1IHJA 1PDRA 4PQWA 2AWXA 1U39A 1X6DA 3L4FD 4K72A 1V1TA 3DJ3A 2M3MA 5E22A 4K76A 2Q3GA 4O06A 4OAJA 2H3MA 3ID2A 5HEDA 3CS0A 3PV4A 2LUIA 1Y7NA 3EGGC 2G5MB 4F8KA 4H11A 2Z17A 3SFJA 4NMRA 1FC7A 1UM1A 1U3BA 2LA8A 3R0HA 1OBXA 2EGKA 4JOPA 1W9QA 3EGHC 2LC7A 1U37A 2M0VA 1B8QA 2BYGA 3ZRTA 3E17A 2QG1A 4JJ0A 4EDJA 1BFEA 4MPAA 2EGNA 2PDZA 2QT5A 2QKVA 1IU0A 2GZVA 3HPMA 3KDGA 3MH4A 2OS6A 1UJDA 2DB5A 4JOFA 2R3YA 2D92A 1UF1A 4G69A 3KZDA 3GCOA 2KA9A 1IU2A 1T2MA 1N6EA 2LOBA 1FC9A 4NMOA 2JIKA 3DJ1A 1Q7XA 1W9OA 2EHRA 2OSGA 5A2PA 5IL9A 2KOJA 2UZCA 3K1RA 2ENOA 2GEFA 2VZ5A 4FLNA 3LNXA 3RL8A 2QKTA 3CBZA 4P0CA 4UU6A 1MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOE A;  2QKU A;  4Z33 A;  1I16 A;  2M0Z A;  2P3W A;  4NMT A;  5JXB A;  2KPL A;  1UEP A;  2EEH A;  1N7F A;  4Q3H A;  3HPK A;  4JOR A;  5HF1 A;  2I04 A;  2EDZ A;  2EAQ A;  4FGM A;  5E6P B;  4XHV A;  3O46 A;  3CBY A;  2EEI A;  1SOZ A;  2VRF A;  4NMS A;  2I4S A;  1V5L A;  4YYX A;  1UJU A;  3QIK A;  4YDP A;  2O2T A;  4WYT A;  4NXR A;  2Q9V A;  2JRE A;  5F3X A;  2RCZ A;  2REY A;  1N6D A;  3LNY A;  1P1E A;  3CBX A;  3ID4 A;  4Z8J A;  4Q2Q A;  2KG2 A;  2JIL A;  2JOA A;  5HEY A;  4Q6S A;  2YUB A;  1UEZ A;  4WYU A;  2VSV A;  1WHD A;  5HFF A;  2AWU A;  4GHN A;  5HFE A;  5DTH A;  4OEP A;  2I0L A;  4JOG A;  4GVC A;  1TP3 A;  3I4W A;  4P2A B;  2VWR A;  2KOH A;  3VQG A;  1KY9 A;  1UIT A;  2VSP A;  2DMZ A;  4JL7 A;  1VJ6 A;  5H3J A;  2YUY A;  1OZI A;  2PA1 A;  3DIW A;  3ID3 A;  4K75 A;  5GLJ A;  1RY4 A;  1X5N A;  2IWQ A;  5HF4 A;  3VQF A;  4GVD A;  2PKT A;  2ZPL A;  3RL7 A;  5HJ1 A;  2KL1 A;  1G9O A;  2E7K A;  1QAV B;  1Y8T A;  3CH8 A;  1KEF A;  2OCS A;  2K20 A;  1WIF A;  3WKM A;  3SHW A;  2DM8 A;  5E21 A;  3RLE A;  5HFB A;  2EXG A;  1KWA A;  2KBS A;  2I1N A;  2H2B A;  3QO6 A;  4N6X A;  1ZUB A;  2V90 A;  2KJP A;  3GJ9 A;  1QLC A;  2EDV A;  2R4H A;  1L6O A;  3OU0 A;  1MFL A;  3STJ A;  1WJL A;  2RRM A;  3I18 A;  2OMJ A;  1UJV A;  3GDS A;  2G2L A;  1GM1 A;  2KV8 A;  1TE0 A;  3DOR A;  1UM7 A;  2KRG A;  1UEQ A;  4JOH A;  2HE2 A;  2EGO A;  1I92 A;  5HFC A;  3B76 A;  3CYY A;  3KHF A;  1U38 A;  4Q6H A;  2W4F A;  2PNT A;  2X7Z A;  3BPU A;  1TQ3 A;  2EDP A;  2IWO A;  1WH1 A;  4OEO A;  3PDZ A;  5HEB A;  2CSS A;  4NXP A;  2JWE A;  5HET A;  1W9E A;  1K32 A;  2YT8 A;  1Q3P A;  2MX6 A;  2OQS A;  2DC2 A;  2EV8 A;  2LC6 A;  1P1D A;  1UFX A;  3QDO A;  2M10 A;  2KYL A;  2M0U A;  2K1Z A;  5FB8 C;  3K82 A;  3GGE A;  2FCF A;  2KQF A;  2DLS A;  2FN5 A;  2EEJ A;  1FC6 A;  4UU5 A;  4LMM A;  2WL7 A;  3KZE A;  1YBO A;  2JXO A;  1WF8 A;  4HOP B;  1MC7 A;  1RZX A;  2L4T A;  2EJY A;  2KJK A;  2KPK A;  2VPH A;  3GDV A;  3HVQ C;  2D90 A;  1LCY A;  2KOM A;  2YTW A;  5HDY A;  4AMH A;  5EYZ A;  1VCW A;  2OPG A;  2QBW A;  4E34 A;  1WI2 A;  1WI4 A;  3QJM A;  2H2C A;  2F5Y A;  2W7R A;  4KFV A;  4NMV A;  5I7Z A;  2CS5 A;  1OBY A;  3TSV A;  3I1E A;  2IWP A;  4KFW A;  3AXA A;  3ID1 A;  1ZOK A;  1D5G A;  2PKU A;  4E3B A;  2DLU A;  2HE4 A;  1QAU A;  1FCF A;  5F67 A;  1OBZ A;  1XZ9 A;  2ZPM A;  4NMQ A;  2F0A A;  2H3L A;  4JOJ A;  5G1D A;  1X45 A;  4RI0 A;  1N99 A;  2HGA A;  1VAE A;  2OZF A;  3DJA A;  1V62 A;  1V5Q A;  2AIN A;  3QE1 A;  1X5Q A;  5EZ0 A;  3QJN A;  2EEG A;  3O5N A;  2KJD A;  2KAW A;  1GQ4 A;  1Z86 A;  4NXQ A;  4Q2P A;  1NTE A;  3TMH A;  5FHT A;  4NNM A;  2JIN A;  2L97 A;  4L8N A;  1RGR A;  3OTP A;  3QGL A;  4JOE A;  1X8S A;  3NFK A;  2YT7 A;  2DAZ A;  5HFD A;  5GND A;  2L4S A;  4E35 A;  2I0I A;  1Z87 A;  2PZD A;  3GDU A;  3NGH A;  3PV2 A;  1VA8 A;  1WFG A;  1WFV A;  1R6J A;  3R69 A;  1M5Z A;  2AWW A;  4NNL A;  2MHO A;  1VB7 A;  2CSJ A;  4REY A;  3NFL A;  4R2Z A;  2Z9I A;  1WG6 A;  3MH7 A;  1NF3 C;  1UHP A;  4HOP A;  3FY5 A;  1WF7 A;  3WKL A;  3MH6 A;  1SOT A;  1V6B A;  1X5R A;  3SHU A;  3GCN A;  2I6V A;  5D13 A;  4JOK A;  2IWN A;  1BE9 A;  3R68 A;  2DKR A;  4Q2N A;  4NMP A;  4IC6 A;  3PS4 A;  5G1E A;  3PDV A;  1GQ5 A;  1N7T A;  1RGW A;  1WHA A;  2FE5 A;  3PV5 A;  3SUZ A;  3GSL A;  4K6Y A;  2D8I A;  2DJT A;  2V1W A;  5B6L A;  2M0T A;  1N7E A;  2OGP A;  4K78 A;  1UEW A;  1TP5 A;  1N6F A;  3TSW A;  1QAV A;  5E1Y A;  3K50 A;  3JXT A;  1Q3O A;  3CC0 A;  4Q2O A;  3TSZ A;  5E11 A;  2FNE A;  1IHJ A;  1PDR A;  4PQW A;  2AWX A;  1U39 A;  1X6D A;  3L4F D;  4K72 A;  1V1T A;  3DJ3 A;  2M3M A;  5E22 A;  4K76 A;  2Q3G A;  4O06 A;  4OAJ A;  2H3M A;  3ID2 A;  5HED A;  3CS0 A;  3PV4 A;  2LUI A;  1Y7N A;  3EGG C;  2G5M B;  4F8K A;  4H11 A;  2Z17 A;  3SFJ A;  4NMR A;  1FC7 A;  1UM1 A;  1U3B A;  2LA8 A;  3R0H A;  1OBX A;  2EGK A;  4JOP A;  1W9Q A;  3EGH C;  2LC7 A;  1U37 A;  2M0V A;  1B8Q A;  2BYG A;  3ZRT A;  3E17 A;  2QG1 A;  4EDJ A;  1BFE A;  4MPA A;  2EGN A;  2PDZ A;  2QT5 A;  2QKV A;  1IU0 A;  2GZV A;  3HPM A;  3MH4 A;  2OS6 A;  1UJD A;  2DB5 A;  4JOF A;  2R3Y A;  2D92 A;  1UF1 A;  4G69 A;  3KZD A;  3GCO A;  2KA9 A;  1IU2 A;  1T2M A;  1N6E A;  2LOB A;  1FC9 A;  4NMO A;  2JIK A;  3DJ1 A;  1Q7X A;  1W9O A;  2EHR A;  2OSG A;  5A2P A;  2KOJ A;  2UZC A;  3K1R A;  2ENO A;  2VZ5 A;  3LNX A;  3RL8 A;  2QKT A;  3CBZ A;  4P0C A;  4UU6 A;  1MFG A; 
#chains in the Genus database with same CATH topology
 3SOE A;  2QKU A;  4Z33 A;  1I16 A;  2M0Z A;  2P3W A;  4NMT A;  5JXB A;  2KPL A;  1UEP A;  2EEH A;  1N7F A;  4Q3H A;  3HPK A;  4JOR A;  5HF1 A;  2I04 A;  2EDZ A;  2EAQ A;  4FGM A;  5E6P B;  4XHV A;  3O46 A;  3CBY A;  2EEI A;  1SOZ A;  2VRF A;  4NMS A;  2I4S A;  1V5L A;  4YYX A;  1UJU A;  3KDK A;  3QIK A;  4YDP A;  2O2T A;  4WYT A;  4NXR A;  2Q9V A;  2JRE A;  5F3X A;  2RCZ A;  2REY A;  1N6D A;  3LNY A;  1P1E A;  3CBX A;  3ID4 A;  4Z8J A;  4Q2Q A;  2KG2 A;  2JIL A;  2JOA A;  5HEY A;  4Q6S A;  2YUB A;  1UEZ A;  4WYU A;  2VSV A;  1WHD A;  5HFF A;  2AWU A;  4GHN A;  5HFE A;  5DTH A;  4OEP A;  2I0L A;  4JOG A;  4GVC A;  1TP3 A;  3I4W A;  4P2A B;  2VWR A;  2KOH A;  3GAB A;  3VQG A;  1KY9 A;  1UIT A;  2VSP A;  2DMZ A;  4JL7 A;  1VJ6 A;  5H3J A;  2YUY A;  1OZI A;  2PA1 A;  3DIW A;  3ID3 A;  4K75 A;  5GLJ A;  1RY4 A;  1X5N A;  2IWQ A;  5HF4 A;  3VQF A;  4GVD A;  2PKT A;  2ZPL A;  3RL7 A;  5HJ1 A;  2KL1 A;  1G9O A;  2E7K A;  1QAV B;  1Y8T A;  3CH8 A;  1KEF A;  2OCS A;  2K20 A;  1WIF A;  3WKM A;  3SHW A;  2DM8 A;  5E21 A;  3RLE A;  5HFB A;  2EXG A;  1KWA A;  2KBS A;  2I1N A;  2H2B A;  3QO6 A;  4N6X A;  1ZUB A;  2V90 A;  2KJP A;  3GJ9 A;  1QLC A;  2EDV A;  2R4H A;  1L6O A;  3NCV A;  3OU0 A;  1MFL A;  3STJ A;  1WJL A;  2RRM A;  3I18 A;  2OMJ A;  1UJV A;  3GDS A;  2G2L A;  1GM1 A;  2KV8 A;  1TE0 A;  3DOR A;  1UM7 A;  2KRG A;  1UEQ A;  4JOH A;  2HE2 A;  2EGO A;  1I92 A;  5HFC A;  3B76 A;  3CYY A;  3KHF A;  1U38 A;  4Q6H A;  2W4F A;  2PNT A;  2X7Z A;  3BPU A;  1TQ3 A;  2EDP A;  2IWO A;  1WH1 A;  4OEO A;  3PDZ A;  5HEB A;  2CSS A;  4NXP A;  2JWE A;  5HET A;  1W9E A;  1K32 A;  2YT8 A;  1Q3P A;  2MX6 A;  2OQS A;  2DC2 A;  4JJ3 A;  2EV8 A;  2LC6 A;  1P1D A;  1UFX A;  3QDO A;  2M10 A;  2KYL A;  2M0U A;  2K1Z A;  5FB8 C;  3K82 A;  3GGE A;  2FCF A;  2KQF A;  2DLS A;  2FN5 A;  2EEJ A;  1FC6 A;  4UU5 A;  4LMM A;  2WL7 A;  3KZE A;  1YBO A;  2JXO A;  1WF8 A;  4HOP B;  1MC7 A;  1RZX A;  2L4T A;  2EJY A;  2KJK A;  2KPK A;  2VPH A;  3GDV A;  3HVQ C;  2D90 A;  1LCY A;  2KOM A;  2YTW A;  5HDY A;  4AMH A;  5EYZ A;  1X9Z A;  1VCW A;  2OPG A;  2QBW A;  4E34 A;  1WI2 A;  1WI4 A;  3QJM A;  2H2C A;  2F5Y A;  2W7R A;  4KFV A;  4NMV A;  5I7Z A;  2CS5 A;  1OBY A;  3TSV A;  3I1E A;  2IWP A;  4KFW A;  3AXA A;  3ID1 A;  1ZOK A;  1D5G A;  2PKU A;  4E3B A;  2DLU A;  5ILB A;  2HE4 A;  1QAU A;  1FCF A;  5F67 A;  1OBZ A;  1XZ9 A;  2ZPM A;  4NMQ A;  2F0A A;  2H3L A;  4JOJ A;  5G1D A;  1X45 A;  4RI0 A;  1N99 A;  2HGA A;  1VAE A;  2OZF A;  3DJA A;  1V62 A;  1V5Q A;  2AIN A;  3QE1 A;  1X5Q A;  5EZ0 A;  3QJN A;  2EEG A;  3O5N A;  2KJD A;  2KAW A;  1GQ4 A;  1Z86 A;  4NXQ A;  4Q2P A;  1NTE A;  3TMH A;  5FHT A;  4NNM A;  2JIN A;  2L97 A;  4L8N A;  1RGR A;  3OTP A;  3QGL A;  4JOE A;  1X8S A;  3NFK A;  2YT7 A;  2DAZ A;  5HFD A;  5GND A;  2L4S A;  4E35 A;  2I0I A;  1Z87 A;  2PZD A;  3GDU A;  3NGH A;  3PV2 A;  1VA8 A;  1WFG A;  1WFV A;  2JSN A;  1R6J A;  3R69 A;  1M5Z A;  2AWW A;  4NNL A;  2MHO A;  1VB7 A;  2CSJ A;  4REY A;  3NFL A;  4R2Z A;  2Z9I A;  1WG6 A;  3MH7 A;  1NF3 C;  1UHP A;  4HOP A;  3FY5 A;  1WF7 A;  3WKL A;  3MH6 A;  1SOT A;  1V6B A;  1X5R A;  5B42 A;  3SHU A;  3GCN A;  2I6V A;  5D13 A;  4JOK A;  2IWN A;  1BE9 A;  3R68 A;  2DKR A;  4Q2N A;  4NMP A;  4IC6 A;  3PS4 A;  5G1E A;  3PDV A;  1GQ5 A;  1N7T A;  1RGW A;  1WHA A;  2FE5 A;  3PV5 A;  3SUZ A;  3GSL A;  4K6Y A;  2D8I A;  2DJT A;  2V1W A;  5B6L A;  2M0T A;  1N7E A;  2OGP A;  4K78 A;  1UEW A;  1TP5 A;  1N6F A;  3TSW A;  1QAV A;  5E1Y A;  3K50 A;  3JXT A;  1Q3O A;  3CC0 A;  4Q2O A;  3TSZ A;  5E11 A;  2FNE A;  1IHJ A;  1PDR A;  4PQW A;  2AWX A;  1U39 A;  1X6D A;  3L4F D;  4K72 A;  1V1T A;  3DJ3 A;  2M3M A;  5E22 A;  4K76 A;  2Q3G A;  4O06 A;  4OAJ A;  2H3M A;  3ID2 A;  5HED A;  3CS0 A;  3PV4 A;  2LUI A;  1Y7N A;  3EGG C;  2G5M B;  4F8K A;  4H11 A;  2Z17 A;  3SFJ A;  4NMR A;  1FC7 A;  1UM1 A;  1U3B A;  2LA8 A;  3R0H A;  1OBX A;  2EGK A;  4JOP A;  1W9Q A;  3EGH C;  2LC7 A;  1U37 A;  2M0V A;  1B8Q A;  2BYG A;  3ZRT A;  3E17 A;  2QG1 A;  4JJ0 A;  4EDJ A;  1BFE A;  4MPA A;  2EGN A;  2PDZ A;  2QT5 A;  2QKV A;  1IU0 A;  2GZV A;  3HPM A;  3KDG A;  3MH4 A;  2OS6 A;  1UJD A;  2DB5 A;  4JOF A;  2R3Y A;  2D92 A;  1UF1 A;  4G69 A;  3KZD A;  3GCO A;  2KA9 A;  1IU2 A;  1T2M A;  1N6E A;  2LOB A;  1FC9 A;  4NMO A;  2JIK A;  3DJ1 A;  1Q7X A;  1W9O A;  2EHR A;  2OSG A;  5A2P A;  5IL9 A;  2KOJ A;  2UZC A;  3K1R A;  2ENO A;  2GEF A;  2VZ5 A;  4FLN A;  3LNX A;  3RL8 A;  2QKT A;  3CBZ A;  4P0C A;  4UU6 A;  1MFG A; 
#chains in the Genus database with same CATH homology
 3SOE A;  2QKU A;  4Z33 A;  1I16 A;  2M0Z A;  2P3W A;  4NMT A;  5JXB A;  2KPL A;  1UEP A;  2EEH A;  1N7F A;  4Q3H A;  3HPK A;  4JOR A;  5HF1 A;  2I04 A;  2EDZ A;  2EAQ A;  4FGM A;  5E6P B;  4XHV A;  3O46 A;  3CBY A;  2EEI A;  1SOZ A;  2VRF A;  4NMS A;  2I4S A;  1V5L A;  4YYX A;  1UJU A;  3KDK A;  3QIK A;  4YDP A;  2O2T A;  4WYT A;  4NXR A;  2Q9V A;  2JRE A;  5F3X A;  2RCZ A;  2REY A;  1N6D A;  3LNY A;  1P1E A;  3CBX A;  3ID4 A;  4Z8J A;  4Q2Q A;  2KG2 A;  2JIL A;  2JOA A;  5HEY A;  4Q6S A;  2YUB A;  1UEZ A;  4WYU A;  2VSV A;  1WHD A;  5HFF A;  2AWU A;  4GHN A;  5HFE A;  5DTH A;  4OEP A;  2I0L A;  4JOG A;  4GVC A;  1TP3 A;  3I4W A;  4P2A B;  2VWR A;  2KOH A;  3GAB A;  3VQG A;  1KY9 A;  1UIT A;  2VSP A;  2DMZ A;  4JL7 A;  1VJ6 A;  5H3J A;  2YUY A;  1OZI A;  2PA1 A;  3DIW A;  3ID3 A;  4K75 A;  5GLJ A;  1RY4 A;  1X5N A;  2IWQ A;  5HF4 A;  3VQF A;  4GVD A;  2PKT A;  2ZPL A;  3RL7 A;  5HJ1 A;  2KL1 A;  1G9O A;  2E7K A;  1QAV B;  1Y8T A;  3CH8 A;  1KEF A;  2OCS A;  2K20 A;  1WIF A;  3WKM A;  3SHW A;  2DM8 A;  5E21 A;  3RLE A;  5HFB A;  2EXG A;  1KWA A;  2KBS A;  2I1N A;  2H2B A;  3QO6 A;  4N6X A;  1ZUB A;  2V90 A;  2KJP A;  3GJ9 A;  1QLC A;  2EDV A;  2R4H A;  1L6O A;  3NCV A;  3OU0 A;  1MFL A;  3STJ A;  1WJL A;  2RRM A;  3I18 A;  2OMJ A;  1UJV A;  3GDS A;  2G2L A;  1GM1 A;  2KV8 A;  1TE0 A;  3DOR A;  1UM7 A;  2KRG A;  1UEQ A;  4JOH A;  2HE2 A;  2EGO A;  1I92 A;  5HFC A;  3B76 A;  3CYY A;  3KHF A;  1U38 A;  4Q6H A;  2W4F A;  2PNT A;  2X7Z A;  3BPU A;  1TQ3 A;  2EDP A;  2IWO A;  1WH1 A;  4OEO A;  3PDZ A;  5HEB A;  2CSS A;  4NXP A;  2JWE A;  5HET A;  1W9E A;  1K32 A;  2YT8 A;  1Q3P A;  2MX6 A;  2OQS A;  2DC2 A;  4JJ3 A;  2EV8 A;  2LC6 A;  1P1D A;  1UFX A;  3QDO A;  2M10 A;  2KYL A;  2M0U A;  2K1Z A;  5FB8 C;  3K82 A;  3GGE A;  2FCF A;  2KQF A;  2DLS A;  2FN5 A;  2EEJ A;  1FC6 A;  4UU5 A;  4LMM A;  2WL7 A;  3KZE A;  1YBO A;  2JXO A;  1WF8 A;  4HOP B;  1MC7 A;  1RZX A;  2L4T A;  2EJY A;  2KJK A;  2KPK A;  2VPH A;  3GDV A;  3HVQ C;  2D90 A;  1LCY A;  2KOM A;  2YTW A;  5HDY A;  4AMH A;  5EYZ A;  1X9Z A;  1VCW A;  2OPG A;  2QBW A;  4E34 A;  1WI2 A;  1WI4 A;  3QJM A;  2H2C A;  2F5Y A;  2W7R A;  4KFV A;  4NMV A;  5I7Z A;  2CS5 A;  1OBY A;  3TSV A;  3I1E A;  2IWP A;  4KFW A;  3AXA A;  3ID1 A;  1ZOK A;  1D5G A;  2PKU A;  4E3B A;  2DLU A;  5ILB A;  2HE4 A;  1QAU A;  1FCF A;  5F67 A;  1OBZ A;  1XZ9 A;  2ZPM A;  4NMQ A;  2F0A A;  2H3L A;  4JOJ A;  5G1D A;  1X45 A;  4RI0 A;  1N99 A;  2HGA A;  1VAE A;  2OZF A;  3DJA A;  1V62 A;  1V5Q A;  2AIN A;  3QE1 A;  1X5Q A;  5EZ0 A;  3QJN A;  2EEG A;  3O5N A;  2KJD A;  2KAW A;  1GQ4 A;  1Z86 A;  4NXQ A;  4Q2P A;  1NTE A;  3TMH A;  5FHT A;  4NNM A;  2JIN A;  2L97 A;  4L8N A;  1RGR A;  3OTP A;  3QGL A;  4JOE A;  1X8S A;  3NFK A;  2YT7 A;  2DAZ A;  5HFD A;  5GND A;  2L4S A;  4E35 A;  2I0I A;  1Z87 A;  2PZD A;  3GDU A;  3NGH A;  3PV2 A;  1VA8 A;  1WFG A;  1WFV A;  2JSN A;  1R6J A;  3R69 A;  1M5Z A;  2AWW A;  4NNL A;  2MHO A;  1VB7 A;  2CSJ A;  4REY A;  3NFL A;  4R2Z A;  2Z9I A;  1WG6 A;  3MH7 A;  1NF3 C;  1UHP A;  4HOP A;  3FY5 A;  1WF7 A;  3WKL A;  3MH6 A;  1SOT A;  1V6B A;  1X5R A;  5B42 A;  3SHU A;  3GCN A;  2I6V A;  5D13 A;  4JOK A;  2IWN A;  1BE9 A;  3R68 A;  2DKR A;  4Q2N A;  4NMP A;  4IC6 A;  3PS4 A;  5G1E A;  3PDV A;  1GQ5 A;  1N7T A;  1RGW A;  1WHA A;  2FE5 A;  3PV5 A;  3SUZ A;  3GSL A;  4K6Y A;  2D8I A;  2DJT A;  2V1W A;  5B6L A;  2M0T A;  1N7E A;  2OGP A;  4K78 A;  1UEW A;  1TP5 A;  1N6F A;  3TSW A;  1QAV A;  5E1Y A;  3K50 A;  3JXT A;  1Q3O A;  3CC0 A;  4Q2O A;  3TSZ A;  5E11 A;  2FNE A;  1IHJ A;  1PDR A;  4PQW A;  2AWX A;  1U39 A;  1X6D A;  3L4F D;  4K72 A;  1V1T A;  3DJ3 A;  2M3M A;  5E22 A;  4K76 A;  2Q3G A;  4O06 A;  4OAJ A;  2H3M A;  3ID2 A;  5HED A;  3CS0 A;  3PV4 A;  2LUI A;  1Y7N A;  3EGG C;  2G5M B;  4F8K A;  4H11 A;  2Z17 A;  3SFJ A;  4NMR A;  1FC7 A;  1UM1 A;  1U3B A;  2LA8 A;  3R0H A;  1OBX A;  2EGK A;  4JOP A;  1W9Q A;  3EGH C;  2LC7 A;  1U37 A;  2M0V A;  1B8Q A;  2BYG A;  3ZRT A;  3E17 A;  2QG1 A;  4JJ0 A;  4EDJ A;  1BFE A;  4MPA A;  2EGN A;  2PDZ A;  2QT5 A;  2QKV A;  1IU0 A;  2GZV A;  3HPM A;  3KDG A;  3MH4 A;  2OS6 A;  1UJD A;  2DB5 A;  4JOF A;  2R3Y A;  2D92 A;  1UF1 A;  4G69 A;  3KZD A;  3GCO A;  2KA9 A;  1IU2 A;  1T2M A;  1N6E A;  2LOB A;  1FC9 A;  4NMO A;  2JIK A;  3DJ1 A;  1Q7X A;  1W9O A;  2EHR A;  2OSG A;  5A2P A;  5IL9 A;  2KOJ A;  2UZC A;  3K1R A;  2ENO A;  2GEF A;  2VZ5 A;  4FLN A;  3LNX A;  3RL8 A;  2QKT A;  3CBZ A;  4P0C A;  4UU6 A;  1MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...