1RZXA

Crystal structure of a par-6 pdz-peptide complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
ETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG5884-PA
publication title Cdc42 regulates the Par-6 PDZ domain through an allosteric CRIB-PDZ transition.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle
total genus 17
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1rzxA00
1UFXA 2DLUA 4E34A 1Z86A 5E6PB 3DJ1A 2PA1A 1V5QA 2H2CA 2PKUA 4K6YA 3AXAA 4P2AB 1U38A 2KOHA 3SUZA 3TSWA 2DB5A 2PZDA 4UU6A 2KJDA 1Q7XA 4MPAA 1XZ9A 4OEPA 1I16A 4AMHA 1VJ6A 4N6XA 4NMRA 3KZDA 2JILA 1NTEA 5HFBA 1SOTA 2W7RA 3GDSA 2KOJA 2G5MB 2CSJA 1T2MA 2KPLA 5I7ZA 3KZEA 3DJAA 3R68A 5EZ0A 4R2ZA 1V1TA 4JOJA 2CS5A 2KBSA 4Q6HA 3NGHA 1U39A 2OZFA 5B6LA 4F8KA 2CSSA 2JOAA 2ZPLA 3OTPA 2M0VA 4HOPB 2H2BA 2RRMA 3I18A 4EDJA 2F5YA 3NFLA 3QE1A 1WF7A 1RY4A 3CBYA 2KJPA 2EEIA 3SOEA 4KFVA 5GLJA 4JORA 4K72A 2LUIA 4GHNA 2UZCA 4NXQA 3R0HA 2EDZA 2EGNA 5HFDA 2KQFA 5EYZA 1P1EA 3EGGC 1R6JA 4NMOA 1IU2A 2YT8A 2I0IA 1WH1A 4OEOA 1YBOA 3CBZA 2Z17A 1WHAA 4OAJA 4WYTA 3BPUA 3QO6A 2YT7A 2AWXA 1QAUA 5HFFA 2KV8A 3RLEA 4WYUA 1RZXA 2L4TA 2KOMA 5HF4A 3PS4A 3SFJA 1BE9A 1ZOKA 3FY5A 1VA8A 2I04A 2JWEA 5H3JA 2LOBA 2M0TA 2IWQA 2FCFA 3E17A 3O5NA 2I6VA 2OSGA 2M3MA 2R3YA 3QDOA 3OU0A 1TE0A 1BFEA 2ENOA 2K1ZA 2KRGA 4JOKA 2O2TA 3QIKA 2Q9VA 4K78A 1UHPA 2JXOA 2FE5A 3ID2A 4NMTA 3LNYA 3MH6A 4NMSA 2L97A 2DAZA 1UM7A 2GZVA 1OBYA 3ZRTA 2DM8A 1VB7A 2PNTA 3TMHA 3HVQC 4UU5A 2KAWA 4Q2PA 3KHFA 2D92A 2HGAA 2I4SA 2EGOA 5DTHA 2FNEA 4E35A 2QKVA 2QT5A 1K32A 1ZUBA 3K82A 1WF8A 3GDUA 3VQFA 1I92A 1N6EA 1KWAA 4HOPA 1U37A 2KG2A 3QGLA 2YTWA 2VRFA 5HFEA 2K20A 2DLSA 2EV8A 1X5QA 4IC6A 2W4FA 5HJ1A 4JOEA 1FC6A 1Q3PA 4K76A 2RCZA 5JXBA 3ID3A 2HE2A 1FC9A 4LMMA 2JREA 2M0ZA 4Q3HA 5HEDA 2I1NA 3R69A 1UITA 3L4FD 5D13A 1W9EA 1TQ3A 2EDPA 2D8IA 2PKTA 3RL8A 1GQ5A 5HFCA 2KYLA 5E1YA 4JOGA 4KFWA 1W9QA 4Q2QA 3PV5A 3DJ3A 1UJVA 5HDYA 1WFGA 2QKTA 2OGPA 1WI2A 2OMJA 3SHWA 3O46A 4NNLA 5G1DA 4RI0A 2MHOA 3DORA 4NMPA 2EJYA 2EEGA 1U3BA 3QJNA 1NF3C 1V62A 4Q2OA 2AWWA 2G2LA 2KA9A 2PDZA 3CYYA 2V1WA 3DIWA 1KEFA 3QJMA 1UM1A 4NNMA 4NMVA 2H3MA 2VZ5A 1N7TA 4JL7A 1QAVB 1Y7NA 4NXRA 2DMZA 4G69A 2LC7A 3K1RA 1FC7A 5A2PA 1G9OA 3WKLA 2OQSA 4JOPA 1QLCA 2FN5A 2LA8A 1LCYA 2REYA 2IWNA 1TP3A 1W9OA 1RGWA 1VCWA 3TSVA 1FCFA 2R4HA 2ZPMA 4REYA 2L4SA 4P0CA 1UEWA 1D5GA 3RL7A 1Q3OA 2DKRA 2KL1A 2EEJA 1SOZA 1TP5A 2EGKA 2V90A 2EXGA 3STJA 5E22A 2HE4A 5F67A 3GGEA 4Z8JA 3GDVA 1IU0A 4NMQA 1N6FA 1KY9A 1MFLA 1MFGA 5E11A 1GM1A 2JIKA 4YDPA 2VPHA 2EEHA 5FHTA 2OCSA 2QBWA 2JINA 3PDZA 1WFVA 1RGRA 2D90A 4GVDA 1UJDA 4JOHA 3NFKA 3PV4A 4O06A 1X5RA 1V5LA 2YUBA 3CS0A 3CBXA 2KPKA 5HEBA 3PDVA 3GCNA 1X8SA 2OPGA 1M5ZA 1N7FA 1VAEA 3GJ9A 3TSZA 1X5NA 2VSVA 1UEZA 2M0UA 3I4WA 1X6DA 1UF1A 3MH4A 1V6BA 2VWRA 1OZIA 4E3BA 3HPMA 1OBZA 1N6DA 2H3LA 1UEQA 1N99A 4YYXA 2AINA 1OBXA 1UJUA 2I0LA 2OS6A 5HF1A 2Z9IA 2VSPA 2DC2A 2X7ZA 3HPKA 5FB8C 3ID1A 4JOFA 1IHJA 1GQ4A 1QAVA 2MX6A 3I1EA 2BYGA 2M10A 3K50A 4XHVA 3SHUA 4Q6SA 1P1DA 4Z33A 5G1EA 4K75A 5HEYA 2QG1A 3PV2A 2IWPA 1WI4A 3ID4A 2EAQA 4H11A 3WKMA 1UEPA 2P3WA 4NXPA 3GCOA 2F0AA 3MH7A 5E21A 1WHDA 5F3XA 2EDVA 2EHRA 4Q2NA 3LNXA 4L8NA 1Z87A 5HETA 1Y8TA 2KJKA 4FGMA 2LC6A 5GNDA 2AWUA 3EGHC 3VQGA 4PQWA 4GVCA 3B76A 2WL7A 3GSLA 1WG6A 3CC0A 1L6OA 2E7KA 2IWOA 1X45A 2DJTA 3CH8A 1B8QA 2Q3GA 1N7EA 1WIFA 2QKUA 1PDRA 1WJLA 1MC7A 2YUYA 3JXTA
chains in the Genus database with same CATH superfamily
1UFXA 2DLUA 4E34A 1Z86A 5E6PB 3DJ1A 2PA1A 1V5QA 2H2CA 2PKUA 4K6YA 3AXAA 4P2AB 1U38A 2KOHA 3SUZA 3TSWA 2DB5A 2PZDA 4UU6A 2KJDA 1Q7XA 4MPAA 1XZ9A 4OEPA 1I16A 4AMHA 1VJ6A 4N6XA 4NMRA 3KZDA 2JILA 1NTEA 5HFBA 1SOTA 2W7RA 3GDSA 2KOJA 2G5MB 2CSJA 1T2MA 2KPLA 5I7ZA 3KZEA 3DJAA 3R68A 5EZ0A 4R2ZA 1V1TA 4JOJA 2CS5A 2KBSA 4Q6HA 3NGHA 1U39A 2OZFA 5B6LA 4F8KA 2CSSA 2JOAA 2ZPLA 3OTPA 2M0VA 4HOPB 2H2BA 2RRMA 3I18A 4EDJA 2F5YA 3NFLA 3QE1A 1WF7A 1RY4A 3CBYA 2KJPA 2EEIA 3SOEA 4KFVA 5GLJA 4JORA 4K72A 2LUIA 4GHNA 2GEFA 2UZCA 4NXQA 3R0HA 2EDZA 2EGNA 5HFDA 2KQFA 5EYZA 1P1EA 3EGGC 1R6JA 4NMOA 3KDGA 1IU2A 2YT8A 2I0IA 1WH1A 4OEOA 1YBOA 3CBZA 2Z17A 1WHAA 4OAJA 4WYTA 3BPUA 3QO6A 2JSNA 2AWXA 2YT7A 1QAUA 5HFFA 2KV8A 3RLEA 4WYUA 1RZXA 2L4TA 2KOMA 5HF4A 3PS4A 3SFJA 1BE9A 1ZOKA 3FY5A 1VA8A 2I04A 2JWEA 5H3JA 2LOBA 2M0TA 2IWQA 2FCFA 3E17A 3O5NA 2I6VA 2OSGA 2M3MA 2R3YA 3QDOA 3OU0A 1TE0A 1BFEA 2ENOA 2K1ZA 2KRGA 4JOKA 2O2TA 3QIKA 2Q9VA 4K78A 1UHPA 2JXOA 2FE5A 3ID2A 4NMTA 3LNYA 3MH6A 4NMSA 2L97A 2DAZA 1UM7A 2GZVA 1OBYA 3ZRTA 2DM8A 1VB7A 2PNTA 3TMHA 3HVQC 4UU5A 2KAWA 4Q2PA 3KHFA 2D92A 2HGAA 2I4SA 2EGOA 5DTHA 2FNEA 4E35A 2QKVA 2QT5A 1K32A 1ZUBA 3K82A 1WF8A 3GDUA 3VQFA 1I92A 1N6EA 1KWAA 4HOPA 1U37A 2KG2A 3QGLA 2YTWA 2VRFA 5HFEA 2K20A 2DLSA 2EV8A 1X5QA 4IC6A 2W4FA 5HJ1A 4JOEA 1FC6A 1Q3PA 4K76A 2RCZA 5JXBA 3ID3A 2HE2A 1FC9A 4LMMA 2JREA 2M0ZA 4Q3HA 5HEDA 2I1NA 3R69A 1UITA 3L4FD 5D13A 1W9EA 1TQ3A 2EDPA 2D8IA 4JJ3A 2PKTA 3RL8A 1GQ5A 5HFCA 2KYLA 5E1YA 4JOGA 1X9ZA 4KFWA 1W9QA 4Q2QA 3PV5A 3DJ3A 1UJVA 5HDYA 1WFGA 2QKTA 2OGPA 1WI2A 2OMJA 3SHWA 3O46A 4NNLA 5G1DA 4RI0A 2MHOA 3DORA 4NMPA 2EJYA 2EEGA 1U3BA 3QJNA 1NF3C 1V62A 4Q2OA 2AWWA 2G2LA 2KA9A 2PDZA 3CYYA 2V1WA 3DIWA 1KEFA 3QJMA 1UM1A 4NNMA 4NMVA 2H3MA 2VZ5A 1N7TA 4JL7A 1QAVB 1Y7NA 4NXRA 2DMZA 4G69A 2LC7A 3K1RA 1FC7A 5A2PA 1G9OA 3WKLA 2OQSA 4JOPA 5B42A 1QLCA 2FN5A 2LA8A 1LCYA 2REYA 2IWNA 1TP3A 1W9OA 1RGWA 1VCWA 3TSVA 1FCFA 2R4HA 2ZPMA 4REYA 2L4SA 4P0CA 1UEWA 1D5GA 3RL7A 1Q3OA 2DKRA 2KL1A 2EEJA 1SOZA 1TP5A 2EGKA 2V90A 2EXGA 3STJA 3GABA 5E22A 2HE4A 5F67A 3GGEA 4Z8JA 3GDVA 1IU0A 3NCVA 4NMQA 1N6FA 1KY9A 1MFLA 1MFGA 5E11A 1GM1A 2JIKA 4YDPA 2VPHA 2EEHA 5FHTA 2OCSA 2QBWA 2JINA 3PDZA 1WFVA 1RGRA 2D90A 4GVDA 1UJDA 4JOHA 3NFKA 3PV4A 4O06A 1X5RA 1V5LA 2YUBA 3CS0A 3CBXA 2KPKA 5HEBA 3PDVA 3GCNA 1X8SA 2OPGA 1M5ZA 1N7FA 1VAEA 3GJ9A 3TSZA 1X5NA 2VSVA 1UEZA 2M0UA 3I4WA 1X6DA 1UF1A 3MH4A 1V6BA 2VWRA 1OZIA 4E3BA 3HPMA 1OBZA 1N6DA 2H3LA 1UEQA 1N99A 4YYXA 5IL9A 2AINA 1OBXA 1UJUA 2I0LA 2OS6A 5HF1A 2Z9IA 2VSPA 2DC2A 2X7ZA 3HPKA 5FB8C 3ID1A 4JOFA 1IHJA 1GQ4A 1QAVA 2MX6A 3I1EA 2BYGA 2M10A 3K50A 4XHVA 3SHUA 4Q6SA 1P1DA 4Z33A 5G1EA 4K75A 5HEYA 2QG1A 3PV2A 2IWPA 1WI4A 3ID4A 2EAQA 4H11A 3WKMA 1UEPA 2P3WA 4NXPA 3GCOA 2F0AA 3MH7A 5ILBA 5E21A 1WHDA 5F3XA 2EDVA 2EHRA 4Q2NA 3LNXA 4L8NA 1Z87A 5HETA 1Y8TA 2KJKA 4FGMA 2LC6A 5GNDA 2AWUA 3KDKA 3EGHC 3VQGA 4JJ0A 4PQWA 4GVCA 3B76A 2WL7A 3GSLA 1WG6A 3CC0A 1L6OA 2E7KA 4FLNA 2IWOA 1X45A 2DJTA 3CH8A 1B8QA 2Q3GA 1N7EA 1WIFA 2QKUA 1PDRA 1WJLA 1MC7A 2YUYA 3JXTA
chains in the Genus database with same CATH topology
1UFXA 2DLUA 4E34A 1Z86A 5E6PB 3DJ1A 2PA1A 1V5QA 2H2CA 2PKUA 4K6YA 3AXAA 4P2AB 1U38A 2KOHA 3SUZA 3TSWA 2DB5A 2PZDA 4UU6A 2KJDA 1Q7XA 4MPAA 1XZ9A 4OEPA 1I16A 4AMHA 1VJ6A 4N6XA 4NMRA 3KZDA 2JILA 1NTEA 5HFBA 1SOTA 2W7RA 3GDSA 2KOJA 2G5MB 2CSJA 1T2MA 2KPLA 5I7ZA 3KZEA 3DJAA 3R68A 5EZ0A 4R2ZA 1V1TA 4JOJA 2CS5A 2KBSA 4Q6HA 3NGHA 1U39A 2OZFA 5B6LA 4F8KA 2CSSA 2JOAA 2ZPLA 3OTPA 2M0VA 4HOPB 2H2BA 2RRMA 3I18A 4EDJA 2F5YA 3NFLA 3QE1A 1WF7A 1RY4A 3CBYA 2KJPA 2EEIA 3SOEA 4KFVA 5GLJA 4JORA 4K72A 2LUIA 4GHNA 2GEFA 2UZCA 4NXQA 3R0HA 2EDZA 2EGNA 5HFDA 2KQFA 5EYZA 1P1EA 3EGGC 1R6JA 4NMOA 3KDGA 1IU2A 2YT8A 2I0IA 1WH1A 4OEOA 1YBOA 3CBZA 2Z17A 1WHAA 4OAJA 4WYTA 3BPUA 3QO6A 2JSNA 2AWXA 2YT7A 1QAUA 5HFFA 2KV8A 3RLEA 4WYUA 1RZXA 2L4TA 2KOMA 5HF4A 3PS4A 3SFJA 1BE9A 1ZOKA 3FY5A 1VA8A 2I04A 2JWEA 5H3JA 2LOBA 2M0TA 2IWQA 2FCFA 3E17A 3O5NA 2I6VA 2OSGA 2M3MA 2R3YA 3QDOA 3OU0A 1TE0A 1BFEA 2ENOA 2K1ZA 2KRGA 4JOKA 2O2TA 3QIKA 2Q9VA 4K78A 1UHPA 2JXOA 2FE5A 3ID2A 4NMTA 3LNYA 3MH6A 4NMSA 2L97A 2DAZA 1UM7A 2GZVA 1OBYA 3ZRTA 2DM8A 1VB7A 2PNTA 3TMHA 3HVQC 4UU5A 2KAWA 4Q2PA 3KHFA 2D92A 2HGAA 2I4SA 2EGOA 5DTHA 2FNEA 4E35A 2QKVA 2QT5A 1K32A 1ZUBA 3K82A 1WF8A 3GDUA 3VQFA 1I92A 1N6EA 1KWAA 4HOPA 1U37A 2KG2A 3QGLA 2YTWA 2VRFA 5HFEA 2K20A 2DLSA 2EV8A 1X5QA 4IC6A 2W4FA 5HJ1A 4JOEA 1FC6A 1Q3PA 4K76A 2RCZA 5JXBA 3ID3A 2HE2A 1FC9A 4LMMA 2JREA 2M0ZA 4Q3HA 5HEDA 2I1NA 3R69A 1UITA 3L4FD 5D13A 1W9EA 1TQ3A 2EDPA 2D8IA 4JJ3A 2PKTA 3RL8A 1GQ5A 5HFCA 2KYLA 5E1YA 4JOGA 1X9ZA 4KFWA 1W9QA 4Q2QA 3PV5A 3DJ3A 1UJVA 5HDYA 1WFGA 2QKTA 2OGPA 1WI2A 2OMJA 3SHWA 3O46A 4NNLA 5G1DA 4RI0A 2MHOA 3DORA 4NMPA 2EJYA 2EEGA 1U3BA 3QJNA 1NF3C 1V62A 4Q2OA 2AWWA 2G2LA 2KA9A 2PDZA 3CYYA 2V1WA 3DIWA 1KEFA 3QJMA 1UM1A 4NNMA 4NMVA 2H3MA 2VZ5A 1N7TA 4JL7A 1QAVB 1Y7NA 4NXRA 2DMZA 4G69A 2LC7A 3K1RA 1FC7A 5A2PA 1G9OA 3WKLA 2OQSA 4JOPA 5B42A 1QLCA 2FN5A 2LA8A 1LCYA 2REYA 2IWNA 1TP3A 1W9OA 1RGWA 1VCWA 3TSVA 1FCFA 2R4HA 2ZPMA 4REYA 2L4SA 4P0CA 1UEWA 1D5GA 3RL7A 1Q3OA 2DKRA 2KL1A 2EEJA 1SOZA 1TP5A 2EGKA 2V90A 2EXGA 3STJA 3GABA 5E22A 2HE4A 5F67A 3GGEA 4Z8JA 3GDVA 1IU0A 3NCVA 4NMQA 1N6FA 1KY9A 1MFLA 1MFGA 5E11A 1GM1A 2JIKA 4YDPA 2VPHA 2EEHA 5FHTA 2OCSA 2QBWA 2JINA 3PDZA 1WFVA 1RGRA 2D90A 4GVDA 1UJDA 4JOHA 3NFKA 3PV4A 4O06A 1X5RA 1V5LA 2YUBA 3CS0A 3CBXA 2KPKA 5HEBA 3PDVA 3GCNA 1X8SA 2OPGA 1M5ZA 1N7FA 1VAEA 3GJ9A 3TSZA 1X5NA 2VSVA 1UEZA 2M0UA 3I4WA 1X6DA 1UF1A 3MH4A 1V6BA 2VWRA 1OZIA 4E3BA 3HPMA 1OBZA 1N6DA 2H3LA 1UEQA 1N99A 4YYXA 5IL9A 2AINA 1OBXA 1UJUA 2I0LA 2OS6A 5HF1A 2Z9IA 2VSPA 2DC2A 2X7ZA 3HPKA 5FB8C 3ID1A 4JOFA 1IHJA 1GQ4A 1QAVA 2MX6A 3I1EA 2BYGA 2M10A 3K50A 4XHVA 3SHUA 4Q6SA 1P1DA 4Z33A 5G1EA 4K75A 5HEYA 2QG1A 3PV2A 2IWPA 1WI4A 3ID4A 2EAQA 4H11A 3WKMA 1UEPA 2P3WA 4NXPA 3GCOA 2F0AA 3MH7A 5ILBA 5E21A 1WHDA 5F3XA 2EDVA 2EHRA 4Q2NA 3LNXA 4L8NA 1Z87A 5HETA 1Y8TA 2KJKA 4FGMA 2LC6A 5GNDA 2AWUA 3KDKA 3EGHC 3VQGA 4JJ0A 4PQWA 4GVCA 3B76A 2WL7A 3GSLA 1WG6A 3CC0A 1L6OA 2E7KA 4FLNA 2IWOA 1X45A 2DJTA 3CH8A 1B8QA 2Q3GA 1N7EA 1WIFA 2QKUA 1PDRA 1WJLA 1MC7A 2YUYA 3JXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFX A;  2DLU A;  4E34 A;  1Z86 A;  5E6P B;  3DJ1 A;  2PA1 A;  1V5Q A;  2H2C A;  2PKU A;  4K6Y A;  3AXA A;  4P2A B;  1U38 A;  2KOH A;  3SUZ A;  3TSW A;  2DB5 A;  2PZD A;  4UU6 A;  2KJD A;  1Q7X A;  4MPA A;  1XZ9 A;  4OEP A;  1I16 A;  4AMH A;  1VJ6 A;  4N6X A;  4NMR A;  3KZD A;  2JIL A;  1NTE A;  5HFB A;  1SOT A;  2W7R A;  3GDS A;  2KOJ A;  2G5M B;  2CSJ A;  1T2M A;  2KPL A;  5I7Z A;  3KZE A;  3DJA A;  3R68 A;  5EZ0 A;  4R2Z A;  1V1T A;  4JOJ A;  2CS5 A;  2KBS A;  4Q6H A;  3NGH A;  1U39 A;  2OZF A;  5B6L A;  4F8K A;  2CSS A;  2JOA A;  2ZPL A;  3OTP A;  2M0V A;  4HOP B;  2H2B A;  2RRM A;  3I18 A;  4EDJ A;  2F5Y A;  3NFL A;  3QE1 A;  1WF7 A;  1RY4 A;  3CBY A;  2KJP A;  2EEI A;  3SOE A;  4KFV A;  5GLJ A;  4JOR A;  4K72 A;  2LUI A;  4GHN A;  2UZC A;  4NXQ A;  3R0H A;  2EDZ A;  2EGN A;  5HFD A;  2KQF A;  5EYZ A;  1P1E A;  3EGG C;  1R6J A;  4NMO A;  1IU2 A;  2YT8 A;  2I0I A;  1WH1 A;  4OEO A;  1YBO A;  3CBZ A;  2Z17 A;  1WHA A;  4OAJ A;  4WYT A;  3BPU A;  3QO6 A;  2YT7 A;  2AWX A;  1QAU A;  5HFF A;  2KV8 A;  3RLE A;  4WYU A;  1RZX A;  2L4T A;  2KOM A;  5HF4 A;  3PS4 A;  3SFJ A;  1BE9 A;  1ZOK A;  3FY5 A;  1VA8 A;  2I04 A;  2JWE A;  5H3J A;  2LOB A;  2M0T A;  2IWQ A;  2FCF A;  3E17 A;  3O5N A;  2I6V A;  2OSG A;  2M3M A;  2R3Y A;  3QDO A;  3OU0 A;  1TE0 A;  1BFE A;  2ENO A;  2K1Z A;  2KRG A;  4JOK A;  2O2T A;  3QIK A;  2Q9V A;  4K78 A;  1UHP A;  2JXO A;  2FE5 A;  3ID2 A;  4NMT A;  3LNY A;  3MH6 A;  4NMS A;  2L97 A;  2DAZ A;  1UM7 A;  2GZV A;  1OBY A;  3ZRT A;  2DM8 A;  1VB7 A;  2PNT A;  3TMH A;  3HVQ C;  4UU5 A;  2KAW A;  4Q2P A;  3KHF A;  2D92 A;  2HGA A;  2I4S A;  2EGO A;  5DTH A;  2FNE A;  4E35 A;  2QKV A;  2QT5 A;  1K32 A;  1ZUB A;  3K82 A;  1WF8 A;  3GDU A;  3VQF A;  1I92 A;  1N6E A;  1KWA A;  4HOP A;  1U37 A;  2KG2 A;  3QGL A;  2YTW A;  2VRF A;  5HFE A;  2K20 A;  2DLS A;  2EV8 A;  1X5Q A;  4IC6 A;  2W4F A;  5HJ1 A;  4JOE A;  1FC6 A;  1Q3P A;  4K76 A;  2RCZ A;  5JXB A;  3ID3 A;  2HE2 A;  1FC9 A;  4LMM A;  2JRE A;  2M0Z A;  4Q3H A;  5HED A;  2I1N A;  3R69 A;  1UIT A;  3L4F D;  5D13 A;  1W9E A;  1TQ3 A;  2EDP A;  2D8I A;  2PKT A;  3RL8 A;  1GQ5 A;  5HFC A;  2KYL A;  5E1Y A;  4JOG A;  4KFW A;  1W9Q A;  4Q2Q A;  3PV5 A;  3DJ3 A;  1UJV A;  5HDY A;  1WFG A;  2QKT A;  2OGP A;  1WI2 A;  2OMJ A;  3SHW A;  3O46 A;  4NNL A;  5G1D A;  4RI0 A;  2MHO A;  3DOR A;  4NMP A;  2EJY A;  2EEG A;  1U3B A;  3QJN A;  1NF3 C;  1V62 A;  4Q2O A;  2AWW A;  2G2L A;  2KA9 A;  2PDZ A;  3CYY A;  2V1W A;  3DIW A;  1KEF A;  3QJM A;  1UM1 A;  4NNM A;  4NMV A;  2H3M A;  2VZ5 A;  1N7T A;  4JL7 A;  1QAV B;  1Y7N A;  4NXR A;  2DMZ A;  4G69 A;  2LC7 A;  3K1R A;  1FC7 A;  5A2P A;  1G9O A;  3WKL A;  2OQS A;  4JOP A;  1QLC A;  2FN5 A;  2LA8 A;  1LCY A;  2REY A;  2IWN A;  1TP3 A;  1W9O A;  1RGW A;  1VCW A;  3TSV A;  1FCF A;  2R4H A;  2ZPM A;  4REY A;  2L4S A;  4P0C A;  1UEW A;  1D5G A;  3RL7 A;  1Q3O A;  2DKR A;  2KL1 A;  2EEJ A;  1SOZ A;  1TP5 A;  2EGK A;  2V90 A;  2EXG A;  3STJ A;  5E22 A;  2HE4 A;  5F67 A;  3GGE A;  4Z8J A;  3GDV A;  1IU0 A;  4NMQ A;  1N6F A;  1KY9 A;  1MFL A;  1MFG A;  5E11 A;  1GM1 A;  2JIK A;  4YDP A;  2VPH A;  2EEH A;  5FHT A;  2OCS A;  2QBW A;  2JIN A;  3PDZ A;  1WFV A;  1RGR A;  2D90 A;  4GVD A;  1UJD A;  4JOH A;  3NFK A;  3PV4 A;  4O06 A;  1X5R A;  1V5L A;  2YUB A;  3CS0 A;  3CBX A;  2KPK A;  5HEB A;  3PDV A;  3GCN A;  1X8S A;  2OPG A;  1M5Z A;  1N7F A;  1VAE A;  3GJ9 A;  3TSZ A;  1X5N A;  2VSV A;  1UEZ A;  2M0U A;  3I4W A;  1X6D A;  1UF1 A;  3MH4 A;  1V6B A;  2VWR A;  1OZI A;  4E3B A;  3HPM A;  1OBZ A;  1N6D A;  2H3L A;  1UEQ A;  1N99 A;  4YYX A;  2AIN A;  1OBX A;  1UJU A;  2I0L A;  2OS6 A;  5HF1 A;  2Z9I A;  2VSP A;  2DC2 A;  2X7Z A;  3HPK A;  5FB8 C;  3ID1 A;  4JOF A;  1IHJ A;  1GQ4 A;  1QAV A;  2MX6 A;  3I1E A;  2BYG A;  2M10 A;  3K50 A;  4XHV A;  3SHU A;  4Q6S A;  1P1D A;  4Z33 A;  5G1E A;  4K75 A;  5HEY A;  2QG1 A;  3PV2 A;  2IWP A;  1WI4 A;  3ID4 A;  2EAQ A;  4H11 A;  3WKM A;  1UEP A;  2P3W A;  4NXP A;  3GCO A;  2F0A A;  3MH7 A;  5E21 A;  1WHD A;  5F3X A;  2EDV A;  2EHR A;  4Q2N A;  3LNX A;  4L8N A;  1Z87 A;  5HET A;  1Y8T A;  2KJK A;  4FGM A;  2LC6 A;  5GND A;  2AWU A;  3EGH C;  3VQG A;  4PQW A;  4GVC A;  3B76 A;  2WL7 A;  3GSL A;  1WG6 A;  3CC0 A;  1L6O A;  2E7K A;  2IWO A;  1X45 A;  2DJT A;  3CH8 A;  1B8Q A;  2Q3G A;  1N7E A;  1WIF A;  2QKU A;  1PDR A;  1WJL A;  1MC7 A;  2YUY A;  3JXT A; 
#chains in the Genus database with same CATH topology
 1UFX A;  2DLU A;  4E34 A;  1Z86 A;  5E6P B;  3DJ1 A;  2PA1 A;  1V5Q A;  2H2C A;  2PKU A;  4K6Y A;  3AXA A;  4P2A B;  1U38 A;  2KOH A;  3SUZ A;  3TSW A;  2DB5 A;  2PZD A;  4UU6 A;  2KJD A;  1Q7X A;  4MPA A;  1XZ9 A;  4OEP A;  1I16 A;  4AMH A;  1VJ6 A;  4N6X A;  4NMR A;  3KZD A;  2JIL A;  1NTE A;  5HFB A;  1SOT A;  2W7R A;  3GDS A;  2KOJ A;  2G5M B;  2CSJ A;  1T2M A;  2KPL A;  5I7Z A;  3KZE A;  3DJA A;  3R68 A;  5EZ0 A;  4R2Z A;  1V1T A;  4JOJ A;  2CS5 A;  2KBS A;  4Q6H A;  3NGH A;  1U39 A;  2OZF A;  5B6L A;  4F8K A;  2CSS A;  2JOA A;  2ZPL A;  3OTP A;  2M0V A;  4HOP B;  2H2B A;  2RRM A;  3I18 A;  4EDJ A;  2F5Y A;  3NFL A;  3QE1 A;  1WF7 A;  1RY4 A;  3CBY A;  2KJP A;  2EEI A;  3SOE A;  4KFV A;  5GLJ A;  4JOR A;  4K72 A;  2LUI A;  4GHN A;  2GEF A;  2UZC A;  4NXQ A;  3R0H A;  2EDZ A;  2EGN A;  5HFD A;  2KQF A;  5EYZ A;  1P1E A;  3EGG C;  1R6J A;  4NMO A;  3KDG A;  1IU2 A;  2YT8 A;  2I0I A;  1WH1 A;  4OEO A;  1YBO A;  3CBZ A;  2Z17 A;  1WHA A;  4OAJ A;  4WYT A;  3BPU A;  3QO6 A;  2JSN A;  2AWX A;  2YT7 A;  1QAU A;  5HFF A;  2KV8 A;  3RLE A;  4WYU A;  1RZX A;  2L4T A;  2KOM A;  5HF4 A;  3PS4 A;  3SFJ A;  1BE9 A;  1ZOK A;  3FY5 A;  1VA8 A;  2I04 A;  2JWE A;  5H3J A;  2LOB A;  2M0T A;  2IWQ A;  2FCF A;  3E17 A;  3O5N A;  2I6V A;  2OSG A;  2M3M A;  2R3Y A;  3QDO A;  3OU0 A;  1TE0 A;  1BFE A;  2ENO A;  2K1Z A;  2KRG A;  4JOK A;  2O2T A;  3QIK A;  2Q9V A;  4K78 A;  1UHP A;  2JXO A;  2FE5 A;  3ID2 A;  4NMT A;  3LNY A;  3MH6 A;  4NMS A;  2L97 A;  2DAZ A;  1UM7 A;  2GZV A;  1OBY A;  3ZRT A;  2DM8 A;  1VB7 A;  2PNT A;  3TMH A;  3HVQ C;  4UU5 A;  2KAW A;  4Q2P A;  3KHF A;  2D92 A;  2HGA A;  2I4S A;  2EGO A;  5DTH A;  2FNE A;  4E35 A;  2QKV A;  2QT5 A;  1K32 A;  1ZUB A;  3K82 A;  1WF8 A;  3GDU A;  3VQF A;  1I92 A;  1N6E A;  1KWA A;  4HOP A;  1U37 A;  2KG2 A;  3QGL A;  2YTW A;  2VRF A;  5HFE A;  2K20 A;  2DLS A;  2EV8 A;  1X5Q A;  4IC6 A;  2W4F A;  5HJ1 A;  4JOE A;  1FC6 A;  1Q3P A;  4K76 A;  2RCZ A;  5JXB A;  3ID3 A;  2HE2 A;  1FC9 A;  4LMM A;  2JRE A;  2M0Z A;  4Q3H A;  5HED A;  2I1N A;  3R69 A;  1UIT A;  3L4F D;  5D13 A;  1W9E A;  1TQ3 A;  2EDP A;  2D8I A;  4JJ3 A;  2PKT A;  3RL8 A;  1GQ5 A;  5HFC A;  2KYL A;  5E1Y A;  4JOG A;  1X9Z A;  4KFW A;  1W9Q A;  4Q2Q A;  3PV5 A;  3DJ3 A;  1UJV A;  5HDY A;  1WFG A;  2QKT A;  2OGP A;  1WI2 A;  2OMJ A;  3SHW A;  3O46 A;  4NNL A;  5G1D A;  4RI0 A;  2MHO A;  3DOR A;  4NMP A;  2EJY A;  2EEG A;  1U3B A;  3QJN A;  1NF3 C;  1V62 A;  4Q2O A;  2AWW A;  2G2L A;  2KA9 A;  2PDZ A;  3CYY A;  2V1W A;  3DIW A;  1KEF A;  3QJM A;  1UM1 A;  4NNM A;  4NMV A;  2H3M A;  2VZ5 A;  1N7T A;  4JL7 A;  1QAV B;  1Y7N A;  4NXR A;  2DMZ A;  4G69 A;  2LC7 A;  3K1R A;  1FC7 A;  5A2P A;  1G9O A;  3WKL A;  2OQS A;  4JOP A;  5B42 A;  1QLC A;  2FN5 A;  2LA8 A;  1LCY A;  2REY A;  2IWN A;  1TP3 A;  1W9O A;  1RGW A;  1VCW A;  3TSV A;  1FCF A;  2R4H A;  2ZPM A;  4REY A;  2L4S A;  4P0C A;  1UEW A;  1D5G A;  3RL7 A;  1Q3O A;  2DKR A;  2KL1 A;  2EEJ A;  1SOZ A;  1TP5 A;  2EGK A;  2V90 A;  2EXG A;  3STJ A;  3GAB A;  5E22 A;  2HE4 A;  5F67 A;  3GGE A;  4Z8J A;  3GDV A;  1IU0 A;  3NCV A;  4NMQ A;  1N6F A;  1KY9 A;  1MFL A;  1MFG A;  5E11 A;  1GM1 A;  2JIK A;  4YDP A;  2VPH A;  2EEH A;  5FHT A;  2OCS A;  2QBW A;  2JIN A;  3PDZ A;  1WFV A;  1RGR A;  2D90 A;  4GVD A;  1UJD A;  4JOH A;  3NFK A;  3PV4 A;  4O06 A;  1X5R A;  1V5L A;  2YUB A;  3CS0 A;  3CBX A;  2KPK A;  5HEB A;  3PDV A;  3GCN A;  1X8S A;  2OPG A;  1M5Z A;  1N7F A;  1VAE A;  3GJ9 A;  3TSZ A;  1X5N A;  2VSV A;  1UEZ A;  2M0U A;  3I4W A;  1X6D A;  1UF1 A;  3MH4 A;  1V6B A;  2VWR A;  1OZI A;  4E3B A;  3HPM A;  1OBZ A;  1N6D A;  2H3L A;  1UEQ A;  1N99 A;  4YYX A;  5IL9 A;  2AIN A;  1OBX A;  1UJU A;  2I0L A;  2OS6 A;  5HF1 A;  2Z9I A;  2VSP A;  2DC2 A;  2X7Z A;  3HPK A;  5FB8 C;  3ID1 A;  4JOF A;  1IHJ A;  1GQ4 A;  1QAV A;  2MX6 A;  3I1E A;  2BYG A;  2M10 A;  3K50 A;  4XHV A;  3SHU A;  4Q6S A;  1P1D A;  4Z33 A;  5G1E A;  4K75 A;  5HEY A;  2QG1 A;  3PV2 A;  2IWP A;  1WI4 A;  3ID4 A;  2EAQ A;  4H11 A;  3WKM A;  1UEP A;  2P3W A;  4NXP A;  3GCO A;  2F0A A;  3MH7 A;  5ILB A;  5E21 A;  1WHD A;  5F3X A;  2EDV A;  2EHR A;  4Q2N A;  3LNX A;  4L8N A;  1Z87 A;  5HET A;  1Y8T A;  2KJK A;  4FGM A;  2LC6 A;  5GND A;  2AWU A;  3KDK A;  3EGH C;  3VQG A;  4JJ0 A;  4PQW A;  4GVC A;  3B76 A;  2WL7 A;  3GSL A;  1WG6 A;  3CC0 A;  1L6O A;  2E7K A;  4FLN A;  2IWO A;  1X45 A;  2DJT A;  3CH8 A;  1B8Q A;  2Q3G A;  1N7E A;  1WIF A;  2QKU A;  1PDR A;  1WJL A;  1MC7 A;  2YUY A;  3JXT A; 
#chains in the Genus database with same CATH homology
 1UFX A;  2DLU A;  4E34 A;  1Z86 A;  5E6P B;  3DJ1 A;  2PA1 A;  1V5Q A;  2H2C A;  2PKU A;  4K6Y A;  3AXA A;  4P2A B;  1U38 A;  2KOH A;  3SUZ A;  3TSW A;  2DB5 A;  2PZD A;  4UU6 A;  2KJD A;  1Q7X A;  4MPA A;  1XZ9 A;  4OEP A;  1I16 A;  4AMH A;  1VJ6 A;  4N6X A;  4NMR A;  3KZD A;  2JIL A;  1NTE A;  5HFB A;  1SOT A;  2W7R A;  3GDS A;  2KOJ A;  2G5M B;  2CSJ A;  1T2M A;  2KPL A;  5I7Z A;  3KZE A;  3DJA A;  3R68 A;  5EZ0 A;  4R2Z A;  1V1T A;  4JOJ A;  2CS5 A;  2KBS A;  4Q6H A;  3NGH A;  1U39 A;  2OZF A;  5B6L A;  4F8K A;  2CSS A;  2JOA A;  2ZPL A;  3OTP A;  2M0V A;  4HOP B;  2H2B A;  2RRM A;  3I18 A;  4EDJ A;  2F5Y A;  3NFL A;  3QE1 A;  1WF7 A;  1RY4 A;  3CBY A;  2KJP A;  2EEI A;  3SOE A;  4KFV A;  5GLJ A;  4JOR A;  4K72 A;  2LUI A;  4GHN A;  2GEF A;  2UZC A;  4NXQ A;  3R0H A;  2EDZ A;  2EGN A;  5HFD A;  2KQF A;  5EYZ A;  1P1E A;  3EGG C;  1R6J A;  4NMO A;  3KDG A;  1IU2 A;  2YT8 A;  2I0I A;  1WH1 A;  4OEO A;  1YBO A;  3CBZ A;  2Z17 A;  1WHA A;  4OAJ A;  4WYT A;  3BPU A;  3QO6 A;  2JSN A;  2AWX A;  2YT7 A;  1QAU A;  5HFF A;  2KV8 A;  3RLE A;  4WYU A;  1RZX A;  2L4T A;  2KOM A;  5HF4 A;  3PS4 A;  3SFJ A;  1BE9 A;  1ZOK A;  3FY5 A;  1VA8 A;  2I04 A;  2JWE A;  5H3J A;  2LOB A;  2M0T A;  2IWQ A;  2FCF A;  3E17 A;  3O5N A;  2I6V A;  2OSG A;  2M3M A;  2R3Y A;  3QDO A;  3OU0 A;  1TE0 A;  1BFE A;  2ENO A;  2K1Z A;  2KRG A;  4JOK A;  2O2T A;  3QIK A;  2Q9V A;  4K78 A;  1UHP A;  2JXO A;  2FE5 A;  3ID2 A;  4NMT A;  3LNY A;  3MH6 A;  4NMS A;  2L97 A;  2DAZ A;  1UM7 A;  2GZV A;  1OBY A;  3ZRT A;  2DM8 A;  1VB7 A;  2PNT A;  3TMH A;  3HVQ C;  4UU5 A;  2KAW A;  4Q2P A;  3KHF A;  2D92 A;  2HGA A;  2I4S A;  2EGO A;  5DTH A;  2FNE A;  4E35 A;  2QKV A;  2QT5 A;  1K32 A;  1ZUB A;  3K82 A;  1WF8 A;  3GDU A;  3VQF A;  1I92 A;  1N6E A;  1KWA A;  4HOP A;  1U37 A;  2KG2 A;  3QGL A;  2YTW A;  2VRF A;  5HFE A;  2K20 A;  2DLS A;  2EV8 A;  1X5Q A;  4IC6 A;  2W4F A;  5HJ1 A;  4JOE A;  1FC6 A;  1Q3P A;  4K76 A;  2RCZ A;  5JXB A;  3ID3 A;  2HE2 A;  1FC9 A;  4LMM A;  2JRE A;  2M0Z A;  4Q3H A;  5HED A;  2I1N A;  3R69 A;  1UIT A;  3L4F D;  5D13 A;  1W9E A;  1TQ3 A;  2EDP A;  2D8I A;  4JJ3 A;  2PKT A;  3RL8 A;  1GQ5 A;  5HFC A;  2KYL A;  5E1Y A;  4JOG A;  1X9Z A;  4KFW A;  1W9Q A;  4Q2Q A;  3PV5 A;  3DJ3 A;  1UJV A;  5HDY A;  1WFG A;  2QKT A;  2OGP A;  1WI2 A;  2OMJ A;  3SHW A;  3O46 A;  4NNL A;  5G1D A;  4RI0 A;  2MHO A;  3DOR A;  4NMP A;  2EJY A;  2EEG A;  1U3B A;  3QJN A;  1NF3 C;  1V62 A;  4Q2O A;  2AWW A;  2G2L A;  2KA9 A;  2PDZ A;  3CYY A;  2V1W A;  3DIW A;  1KEF A;  3QJM A;  1UM1 A;  4NNM A;  4NMV A;  2H3M A;  2VZ5 A;  1N7T A;  4JL7 A;  1QAV B;  1Y7N A;  4NXR A;  2DMZ A;  4G69 A;  2LC7 A;  3K1R A;  1FC7 A;  5A2P A;  1G9O A;  3WKL A;  2OQS A;  4JOP A;  5B42 A;  1QLC A;  2FN5 A;  2LA8 A;  1LCY A;  2REY A;  2IWN A;  1TP3 A;  1W9O A;  1RGW A;  1VCW A;  3TSV A;  1FCF A;  2R4H A;  2ZPM A;  4REY A;  2L4S A;  4P0C A;  1UEW A;  1D5G A;  3RL7 A;  1Q3O A;  2DKR A;  2KL1 A;  2EEJ A;  1SOZ A;  1TP5 A;  2EGK A;  2V90 A;  2EXG A;  3STJ A;  3GAB A;  5E22 A;  2HE4 A;  5F67 A;  3GGE A;  4Z8J A;  3GDV A;  1IU0 A;  3NCV A;  4NMQ A;  1N6F A;  1KY9 A;  1MFL A;  1MFG A;  5E11 A;  1GM1 A;  2JIK A;  4YDP A;  2VPH A;  2EEH A;  5FHT A;  2OCS A;  2QBW A;  2JIN A;  3PDZ A;  1WFV A;  1RGR A;  2D90 A;  4GVD A;  1UJD A;  4JOH A;  3NFK A;  3PV4 A;  4O06 A;  1X5R A;  1V5L A;  2YUB A;  3CS0 A;  3CBX A;  2KPK A;  5HEB A;  3PDV A;  3GCN A;  1X8S A;  2OPG A;  1M5Z A;  1N7F A;  1VAE A;  3GJ9 A;  3TSZ A;  1X5N A;  2VSV A;  1UEZ A;  2M0U A;  3I4W A;  1X6D A;  1UF1 A;  3MH4 A;  1V6B A;  2VWR A;  1OZI A;  4E3B A;  3HPM A;  1OBZ A;  1N6D A;  2H3L A;  1UEQ A;  1N99 A;  4YYX A;  5IL9 A;  2AIN A;  1OBX A;  1UJU A;  2I0L A;  2OS6 A;  5HF1 A;  2Z9I A;  2VSP A;  2DC2 A;  2X7Z A;  3HPK A;  5FB8 C;  3ID1 A;  4JOF A;  1IHJ A;  1GQ4 A;  1QAV A;  2MX6 A;  3I1E A;  2BYG A;  2M10 A;  3K50 A;  4XHV A;  3SHU A;  4Q6S A;  1P1D A;  4Z33 A;  5G1E A;  4K75 A;  5HEY A;  2QG1 A;  3PV2 A;  2IWP A;  1WI4 A;  3ID4 A;  2EAQ A;  4H11 A;  3WKM A;  1UEP A;  2P3W A;  4NXP A;  3GCO A;  2F0A A;  3MH7 A;  5ILB A;  5E21 A;  1WHD A;  5F3X A;  2EDV A;  2EHR A;  4Q2N A;  3LNX A;  4L8N A;  1Z87 A;  5HET A;  1Y8T A;  2KJK A;  4FGM A;  2LC6 A;  5GND A;  2AWU A;  3KDK A;  3EGH C;  3VQG A;  4JJ0 A;  4PQW A;  4GVC A;  3B76 A;  2WL7 A;  3GSL A;  1WG6 A;  3CC0 A;  1L6O A;  2E7K A;  4FLN A;  2IWO A;  1X45 A;  2DJT A;  3CH8 A;  1B8Q A;  2Q3G A;  1N7E A;  1WIF A;  2QKU A;  1PDR A;  1WJL A;  1MC7 A;  2YUY A;  3JXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...