3R69A

Molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
85
Chain Sequence
SPRVVVIKKGSNGYGFYLRAGPGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKQEAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger r
publication title Identification of the PDZ3 Domain of the Adaptor Protein PDZK1 as a Second, Physiologically Functional Binding Site for the C Terminus of the High Density Lipoprotein Receptor Scavenger Receptor Class B Type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 19
structure length 85
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3r69A00
2W7RA 1ZOKA 3AXAA 2EDZA 1I92A 3DIWA 5F67A 1W9EA 2EEIA 2JILA 3GGEA 2AINA 4K72A 1VB7A 4JOFA 3B76A 5A2PA 3CS0A 3OU0A 1YBOA 2KQFA 1VA8A 1U39A 1UJVA 1Q7XA 2E7KA 2EV8A 2KJPA 4NNLA 2JIKA 3NGHA 3GCNA 1K32A 2EXGA 3TSVA 1V5LA 2ENOA 2D92A 4Z33A 5FHTA 1OBZA 4Q6SA 4K75A 5E6PB 1FC9A 3E17A 2X7ZA 3L4FD 2QKTA 3ZRTA 1N7FA 1MC7A 4REYA 3QJMA 5E22A 3CBZA 4GVDA 3CBYA 4JOHA 4KFVA 1NF3C 3SFJA 2M3MA 2VZ5A 4JOKA 1Y7NA 4OEOA 3ID2A 3PDZA 4JOGA 4L8NA 3CH8A 3PDVA 1OBXA 3KHFA 4NMPA 2QKUA 2R4HA 2DLSA 3PV2A 1TP5A 4K6YA 2V90A 1N7EA 3DORA 2YT8A 2Q3GA 2I04A 2BYGA 1WI4A 1WFGA 4Q2NA 5HF4A 2I4SA 3NFLA 1RGWA 4PQWA 4JOPA 3O5NA 3I4WA 2P3WA 4KFWA 2DAZA 1X6DA 1U3BA 2JINA 5HEDA 1UEQA 2EDPA 3VQGA 4NXPA 1UEWA 4Q2QA 4WYUA 5HEBA 5B6LA 2OS6A 3MH6A 4P0CA 5E21A 5JXBA 2FCFA 3I1EA 2EEJA 2H2CA 2I6VA 2D8IA 1U38A 4E34A 1GQ5A 2IWNA 2F5YA 3QIKA 1VAEA 2KYLA 3K1RA 2KG2A 1UJDA 5G1DA 3DJ1A 4GVCA 5DTHA 1IHJA 2JWEA 5HJ1A 4H11A 3NFKA 1V62A 2YUYA 3CBXA 2PA1A 3RL8A 2V1WA 3BPUA 1QAVB 1XZ9A 1QAVA 3LNXA 5E1YA 3GJ9A 1V5QA 3EGGC 1KWAA 3GSLA 4R2ZA 5HFBA 1WH1A 3EGHC 3CC0A 2O2TA 2G2LA 3QO6A 5HETA 2DB5A 4EDJA 1Y8TA 2D90A 4JOEA 2LUIA 4WYTA 1W9OA 2JOAA 3QE1A 2QT5A 2ZPMA 4NMRA 3SOEA 3WKMA 2PDZA 1WF8A 2EJYA 4F8KA 1L6OA 2PKUA 2PZDA 3GDVA 1UITA 2QBWA 2PNTA 2EHRA 4RI0A 1RZXA 1WFVA 1V6BA 1BFEA 1Q3PA 2I0IA 2JREA 2MX6A 3R69A 4NMVA 1B8QA 1GM1A 3FY5A 4E3BA 5D13A 2KL1A 5HFEA 2CSSA 1N6DA 2M0UA 1TE0A 3RLEA 3HVQC 4Q6HA 5HFDA 1WHAA 3PS4A 3QJNA 2REYA 1WG6A 2LC6A 4XHVA 1X8SA 2G5MB 3WKLA 4NXQA 2I1NA 3KZEA 1N99A 2QG1A 1QLCA 5GNDA 2KOHA 2DJTA 2EGNA 4HOPB 4HOPA 2KJKA 4NNMA 2EGOA 2L4TA 1P1DA 2M10A 2CS5A 3R68A 2AWUA 2QKVA 2DLUA 1TQ3A 1P1EA 2LC7A 2RCZA 5EZ0A 2DC2A 4N6XA 1OBYA 1RY4A 3JXTA 3K82A 1Z86A 2EEGA 2YTWA 4G69A 2FE5A 2KOMA 2R3YA 4O06A 4NMTA 3SUZA 2W4FA 1WIFA 4GHNA 2IWQA 2YT7A 1D5GA 4K78A 1V1TA 4P2AB 4NXRA 2OZFA 4Q2OA 1IU0A 2HGAA 1Z87A 2EDVA 2KPKA 1FCFA 2HE2A 1QAUA 3GDSA 1IU2A 3RL7A 4UU6A 3TSWA 2DKRA 4Q2PA 3LNYA 1OZIA 3OTPA 2CSJA 1U37A 3TSZA 4OAJA 2M0VA 1MFGA 2Z17A 4FGMA 1VJ6A 2KAWA 3DJ3A 3HPMA 2H3MA 4NMQA 2OGPA 2DM8A 1ZUBA 2EEHA 3QGLA 2KPLA 2K1ZA 2Q9VA 1WF7A 1WI2A 2PKTA 4K76A 1MFLA 1R6JA 4OEPA 1N7TA 2IWOA 2H3LA 1I16A 2OMJA 2OQSA 2WL7A 3O46A 2OPGA 4Q3HA 1UM7A 2JXOA 2KRGA 1W9QA 3ID1A 3R0HA 5F3XA 3MH7A 2Z9IA 1N6FA 2AWWA 2YUBA 1WHDA 2RRMA 3HPKA 1BE9A 1G9OA 2EAQA 1UM1A 4E35A 3ID4A 1TP3A 2F0AA 2LA8A 3KZDA 2AWXA 3VQFA 4JL7A 1GQ4A 1N6EA 1UF1A 4Z8JA 5I7ZA 1Q3OA 2OCSA 3PV5A 3QDOA 1FC6A 4YDPA 2KBSA 4JORA 2HE4A 2KV8A 4AMHA 1UEPA 3GDUA 1X5QA 5GLJA 1M5ZA 2H2BA 4LMMA 1KY9A 5H3JA 2GZVA 4UU5A 3DJAA 5HFFA 3STJA 2L97A 5HFCA 1PDRA 1RGRA 2OSGA 1SOTA 4JOJA 5HEYA 1SOZA 3TMHA 2FN5A 1T2MA 1X5NA 5EYZA 1KEFA 5FB8C 3GCOA 2L4SA 2VSPA 1UFXA 2VPHA 1X5RA 2K20A 3ID3A 1FC7A 1VCWA 1WJLA 5HF1A 2M0ZA 3SHWA 2VWRA 5HDYA 3CYYA 4MPAA 2ZPLA 1X45A 3K50A 2I0LA 3SHUA 1UJUA 2KA9A 2VSVA 2KOJA 2FNEA 2LOBA 4IC6A 4NMOA 4NMSA 1UEZA 3MH4A 3I18A 2VRFA 2UZCA 1UHPA 5G1EA 2MHOA 5E11A 1LCYA 2M0TA 2EGKA 1NTEA 2IWPA 4YYXA 3PV4A 2DMZA 2KJDA
chains in the Genus database with same CATH superfamily
2W7RA 3GABA 1ZOKA 3AXAA 2EDZA 1I92A 3DIWA 5F67A 1W9EA 2EEIA 2JILA 3GGEA 2AINA 4K72A 1VB7A 4JOFA 3B76A 5A2PA 3CS0A 3OU0A 1YBOA 2KQFA 1VA8A 1U39A 1UJVA 1Q7XA 2E7KA 2EV8A 2KJPA 4NNLA 2JIKA 3NGHA 3GCNA 1K32A 2EXGA 3TSVA 1V5LA 2ENOA 2D92A 4Z33A 5FHTA 1OBZA 4Q6SA 4K75A 5E6PB 1FC9A 3E17A 2X7ZA 3L4FD 2QKTA 3ZRTA 1N7FA 1MC7A 4REYA 3QJMA 5E22A 3CBZA 4GVDA 3CBYA 4JOHA 4KFVA 1NF3C 3SFJA 2M3MA 2VZ5A 4JOKA 1Y7NA 4OEOA 3ID2A 3PDZA 4JOGA 4L8NA 3CH8A 3PDVA 1OBXA 3KHFA 4NMPA 2QKUA 2R4HA 2DLSA 3PV2A 1TP5A 4K6YA 2V90A 1N7EA 3DORA 2YT8A 2Q3GA 2I04A 2BYGA 1WI4A 1WFGA 4Q2NA 5HF4A 2I4SA 3NFLA 1RGWA 4PQWA 4JOPA 3O5NA 3I4WA 2P3WA 4KFWA 2DAZA 1X6DA 1U3BA 2JINA 5HEDA 1UEQA 2EDPA 3VQGA 2GEFA 4NXPA 1UEWA 4Q2QA 4WYUA 5HEBA 5B6LA 2OS6A 3MH6A 4P0CA 5E21A 5JXBA 2FCFA 3I1EA 2EEJA 2H2CA 2I6VA 2D8IA 1U38A 4E34A 1GQ5A 2IWNA 2F5YA 3QIKA 1VAEA 2KYLA 3K1RA 2KG2A 1UJDA 5G1DA 3DJ1A 4GVCA 5DTHA 1IHJA 2JWEA 2JSNA 5HJ1A 4H11A 4JJ3A 4JJ0A 3NFKA 1V62A 2YUYA 3CBXA 2PA1A 3RL8A 2V1WA 3BPUA 1QAVB 1XZ9A 1QAVA 3LNXA 5E1YA 3GJ9A 1V5QA 3EGGC 1KWAA 3GSLA 4R2ZA 5HFBA 1WH1A 3EGHC 3CC0A 2O2TA 5B42A 2G2LA 3QO6A 5HETA 2DB5A 4EDJA 1Y8TA 2D90A 4JOEA 2LUIA 4WYTA 1W9OA 2JOAA 3QE1A 2QT5A 2ZPMA 4NMRA 3SOEA 3WKMA 2PDZA 1WF8A 2EJYA 4F8KA 1L6OA 2PKUA 2PZDA 3GDVA 1UITA 2QBWA 2PNTA 2EHRA 4RI0A 1RZXA 1WFVA 1V6BA 1BFEA 1Q3PA 2I0IA 2JREA 2MX6A 3R69A 4NMVA 1B8QA 1GM1A 3FY5A 4E3BA 5D13A 2KL1A 5HFEA 2CSSA 1N6DA 2M0UA 1TE0A 3RLEA 3HVQC 4Q6HA 4FLNA 5HFDA 1WHAA 3PS4A 3QJNA 2REYA 1WG6A 2LC6A 4XHVA 1X8SA 2G5MB 3WKLA 4NXQA 2I1NA 3KZEA 1N99A 2QG1A 1QLCA 5GNDA 2KOHA 2DJTA 2EGNA 4HOPB 4HOPA 2KJKA 4NNMA 2EGOA 2L4TA 1P1DA 2M10A 2CS5A 3R68A 2AWUA 2QKVA 2DLUA 1TQ3A 1P1EA 2LC7A 2RCZA 5EZ0A 2DC2A 4N6XA 3KDGA 1OBYA 1RY4A 3JXTA 3K82A 1Z86A 2EEGA 2YTWA 4G69A 2FE5A 2KOMA 2R3YA 4O06A 4NMTA 5ILBA 3SUZA 2W4FA 1WIFA 4GHNA 2IWQA 2YT7A 1D5GA 4K78A 1V1TA 4P2AB 4NXRA 2OZFA 4Q2OA 1IU0A 2HGAA 1Z87A 2EDVA 2KPKA 1FCFA 2HE2A 1QAUA 3GDSA 1IU2A 3RL7A 4UU6A 3TSWA 2DKRA 4Q2PA 3LNYA 1OZIA 3OTPA 2CSJA 1U37A 3TSZA 4OAJA 2M0VA 1MFGA 2Z17A 4FGMA 1VJ6A 2KAWA 3DJ3A 3HPMA 2H3MA 4NMQA 2OGPA 2DM8A 1ZUBA 2EEHA 3QGLA 2KPLA 2K1ZA 2Q9VA 1WF7A 1WI2A 2PKTA 4K76A 1MFLA 5IL9A 1R6JA 4OEPA 1N7TA 2IWOA 2H3LA 1I16A 2OMJA 2OQSA 2WL7A 3O46A 2OPGA 4Q3HA 1UM7A 2JXOA 2KRGA 1W9QA 3ID1A 3R0HA 3NCVA 5F3XA 3MH7A 2Z9IA 1N6FA 2AWWA 2YUBA 1WHDA 2RRMA 3HPKA 1BE9A 1G9OA 2EAQA 1UM1A 4E35A 3ID4A 1TP3A 2F0AA 2LA8A 3KDKA 3KZDA 2AWXA 3VQFA 4JL7A 1GQ4A 1N6EA 1UF1A 4Z8JA 5I7ZA 1Q3OA 2OCSA 3PV5A 3QDOA 1FC6A 4YDPA 2KBSA 4JORA 2HE4A 2KV8A 4AMHA 1UEPA 3GDUA 1X5QA 5GLJA 1M5ZA 2H2BA 4LMMA 1KY9A 5H3JA 2GZVA 4UU5A 3DJAA 5HFFA 3STJA 2L97A 5HFCA 1PDRA 1RGRA 2OSGA 1SOTA 4JOJA 5HEYA 1SOZA 3TMHA 2FN5A 1T2MA 1X5NA 5EYZA 1KEFA 5FB8C 3GCOA 2L4SA 2VSPA 1UFXA 2VPHA 1X5RA 2K20A 3ID3A 1FC7A 1VCWA 1WJLA 5HF1A 2M0ZA 3SHWA 2VWRA 5HDYA 3CYYA 4MPAA 2ZPLA 1X45A 3K50A 2I0LA 3SHUA 1UJUA 2KA9A 2VSVA 1X9ZA 2KOJA 2FNEA 2LOBA 4IC6A 4NMOA 4NMSA 1UEZA 3MH4A 3I18A 2VRFA 2UZCA 1UHPA 5G1EA 2MHOA 5E11A 1LCYA 2M0TA 2EGKA 1NTEA 2IWPA 4YYXA 3PV4A 2DMZA 2KJDA
chains in the Genus database with same CATH topology
2W7RA 3GABA 1ZOKA 3AXAA 2EDZA 1I92A 3DIWA 5F67A 1W9EA 2EEIA 2JILA 3GGEA 2AINA 4K72A 1VB7A 4JOFA 3B76A 5A2PA 3CS0A 3OU0A 1YBOA 2KQFA 1VA8A 1U39A 1UJVA 1Q7XA 2E7KA 2EV8A 2KJPA 4NNLA 2JIKA 3NGHA 3GCNA 1K32A 2EXGA 3TSVA 1V5LA 2ENOA 2D92A 4Z33A 5FHTA 1OBZA 4Q6SA 4K75A 5E6PB 1FC9A 3E17A 2X7ZA 3L4FD 2QKTA 3ZRTA 1N7FA 1MC7A 4REYA 3QJMA 5E22A 3CBZA 4GVDA 3CBYA 4JOHA 4KFVA 1NF3C 3SFJA 2M3MA 2VZ5A 4JOKA 1Y7NA 4OEOA 3ID2A 3PDZA 4JOGA 4L8NA 3CH8A 3PDVA 1OBXA 3KHFA 4NMPA 2QKUA 2R4HA 2DLSA 3PV2A 1TP5A 4K6YA 2V90A 1N7EA 3DORA 2YT8A 2Q3GA 2I04A 2BYGA 1WI4A 1WFGA 4Q2NA 5HF4A 2I4SA 3NFLA 1RGWA 4PQWA 4JOPA 3O5NA 3I4WA 2P3WA 4KFWA 2DAZA 1X6DA 1U3BA 2JINA 5HEDA 1UEQA 2EDPA 3VQGA 2GEFA 4NXPA 1UEWA 4Q2QA 4WYUA 5HEBA 5B6LA 2OS6A 3MH6A 4P0CA 5E21A 5JXBA 2FCFA 3I1EA 2EEJA 2H2CA 2I6VA 2D8IA 1U38A 4E34A 1GQ5A 2IWNA 2F5YA 3QIKA 1VAEA 2KYLA 3K1RA 2KG2A 1UJDA 5G1DA 3DJ1A 4GVCA 5DTHA 1IHJA 2JWEA 2JSNA 5HJ1A 4H11A 4JJ3A 4JJ0A 3NFKA 1V62A 2YUYA 3CBXA 2PA1A 3RL8A 2V1WA 3BPUA 1QAVB 1XZ9A 1QAVA 3LNXA 5E1YA 3GJ9A 1V5QA 3EGGC 1KWAA 3GSLA 4R2ZA 5HFBA 1WH1A 3EGHC 3CC0A 2O2TA 5B42A 2G2LA 3QO6A 5HETA 2DB5A 4EDJA 1Y8TA 2D90A 4JOEA 2LUIA 4WYTA 1W9OA 2JOAA 3QE1A 2QT5A 2ZPMA 4NMRA 3SOEA 3WKMA 2PDZA 1WF8A 2EJYA 4F8KA 1L6OA 2PKUA 2PZDA 3GDVA 1UITA 2QBWA 2PNTA 2EHRA 4RI0A 1RZXA 1WFVA 1V6BA 1BFEA 1Q3PA 2I0IA 2JREA 2MX6A 3R69A 4NMVA 1B8QA 1GM1A 3FY5A 4E3BA 5D13A 2KL1A 5HFEA 2CSSA 1N6DA 2M0UA 1TE0A 3RLEA 3HVQC 4Q6HA 4FLNA 5HFDA 1WHAA 3PS4A 3QJNA 2REYA 1WG6A 2LC6A 4XHVA 1X8SA 2G5MB 3WKLA 4NXQA 2I1NA 3KZEA 1N99A 2QG1A 1QLCA 5GNDA 2KOHA 2DJTA 2EGNA 4HOPB 4HOPA 2KJKA 4NNMA 2EGOA 2L4TA 1P1DA 2M10A 2CS5A 3R68A 2AWUA 2QKVA 2DLUA 1TQ3A 1P1EA 2LC7A 2RCZA 5EZ0A 2DC2A 4N6XA 3KDGA 1OBYA 1RY4A 3JXTA 3K82A 1Z86A 2EEGA 2YTWA 4G69A 2FE5A 2KOMA 2R3YA 4O06A 4NMTA 5ILBA 3SUZA 2W4FA 1WIFA 4GHNA 2IWQA 2YT7A 1D5GA 4K78A 1V1TA 4P2AB 4NXRA 2OZFA 4Q2OA 1IU0A 2HGAA 1Z87A 2EDVA 2KPKA 1FCFA 2HE2A 1QAUA 3GDSA 1IU2A 3RL7A 4UU6A 3TSWA 2DKRA 4Q2PA 3LNYA 1OZIA 3OTPA 2CSJA 1U37A 3TSZA 4OAJA 2M0VA 1MFGA 2Z17A 4FGMA 1VJ6A 2KAWA 3DJ3A 3HPMA 2H3MA 4NMQA 2OGPA 2DM8A 1ZUBA 2EEHA 3QGLA 2KPLA 2K1ZA 2Q9VA 1WF7A 1WI2A 2PKTA 4K76A 1MFLA 5IL9A 1R6JA 4OEPA 1N7TA 2IWOA 2H3LA 1I16A 2OMJA 2OQSA 2WL7A 3O46A 2OPGA 4Q3HA 1UM7A 2JXOA 2KRGA 1W9QA 3ID1A 3R0HA 3NCVA 5F3XA 3MH7A 2Z9IA 1N6FA 2AWWA 2YUBA 1WHDA 2RRMA 3HPKA 1BE9A 1G9OA 2EAQA 1UM1A 4E35A 3ID4A 1TP3A 2F0AA 2LA8A 3KDKA 3KZDA 2AWXA 3VQFA 4JL7A 1GQ4A 1N6EA 1UF1A 4Z8JA 5I7ZA 1Q3OA 2OCSA 3PV5A 3QDOA 1FC6A 4YDPA 2KBSA 4JORA 2HE4A 2KV8A 4AMHA 1UEPA 3GDUA 1X5QA 5GLJA 1M5ZA 2H2BA 4LMMA 1KY9A 5H3JA 2GZVA 4UU5A 3DJAA 5HFFA 3STJA 2L97A 5HFCA 1PDRA 1RGRA 2OSGA 1SOTA 4JOJA 5HEYA 1SOZA 3TMHA 2FN5A 1T2MA 1X5NA 5EYZA 1KEFA 5FB8C 3GCOA 2L4SA 2VSPA 1UFXA 2VPHA 1X5RA 2K20A 3ID3A 1FC7A 1VCWA 1WJLA 5HF1A 2M0ZA 3SHWA 2VWRA 5HDYA 3CYYA 4MPAA 2ZPLA 1X45A 3K50A 2I0LA 3SHUA 1UJUA 2KA9A 2VSVA 1X9ZA 2KOJA 2FNEA 2LOBA 4IC6A 4NMOA 4NMSA 1UEZA 3MH4A 3I18A 2VRFA 2UZCA 1UHPA 5G1EA 2MHOA 5E11A 1LCYA 2M0TA 2EGKA 1NTEA 2IWPA 4YYXA 3PV4A 2DMZA 2KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7R A;  1ZOK A;  3AXA A;  2EDZ A;  1I92 A;  3DIW A;  5F67 A;  1W9E A;  2EEI A;  2JIL A;  3GGE A;  2AIN A;  4K72 A;  1VB7 A;  4JOF A;  3B76 A;  5A2P A;  3CS0 A;  3OU0 A;  1YBO A;  2KQF A;  1VA8 A;  1U39 A;  1UJV A;  1Q7X A;  2E7K A;  2EV8 A;  2KJP A;  4NNL A;  2JIK A;  3NGH A;  3GCN A;  1K32 A;  2EXG A;  3TSV A;  1V5L A;  2ENO A;  2D92 A;  4Z33 A;  5FHT A;  1OBZ A;  4Q6S A;  4K75 A;  5E6P B;  1FC9 A;  3E17 A;  2X7Z A;  3L4F D;  2QKT A;  3ZRT A;  1N7F A;  1MC7 A;  4REY A;  3QJM A;  5E22 A;  3CBZ A;  4GVD A;  3CBY A;  4JOH A;  4KFV A;  1NF3 C;  3SFJ A;  2M3M A;  2VZ5 A;  4JOK A;  1Y7N A;  4OEO A;  3ID2 A;  3PDZ A;  4JOG A;  4L8N A;  3CH8 A;  3PDV A;  1OBX A;  3KHF A;  4NMP A;  2QKU A;  2R4H A;  2DLS A;  3PV2 A;  1TP5 A;  4K6Y A;  2V90 A;  1N7E A;  3DOR A;  2YT8 A;  2Q3G A;  2I04 A;  2BYG A;  1WI4 A;  1WFG A;  4Q2N A;  5HF4 A;  2I4S A;  3NFL A;  1RGW A;  4PQW A;  4JOP A;  3O5N A;  3I4W A;  2P3W A;  4KFW A;  2DAZ A;  1X6D A;  1U3B A;  2JIN A;  5HED A;  1UEQ A;  2EDP A;  3VQG A;  4NXP A;  1UEW A;  4Q2Q A;  4WYU A;  5HEB A;  5B6L A;  2OS6 A;  3MH6 A;  4P0C A;  5E21 A;  5JXB A;  2FCF A;  3I1E A;  2EEJ A;  2H2C A;  2I6V A;  2D8I A;  1U38 A;  4E34 A;  1GQ5 A;  2IWN A;  2F5Y A;  3QIK A;  1VAE A;  2KYL A;  3K1R A;  2KG2 A;  1UJD A;  5G1D A;  3DJ1 A;  4GVC A;  5DTH A;  1IHJ A;  2JWE A;  5HJ1 A;  4H11 A;  3NFK A;  1V62 A;  2YUY A;  3CBX A;  2PA1 A;  3RL8 A;  2V1W A;  3BPU A;  1QAV B;  1XZ9 A;  1QAV A;  3LNX A;  5E1Y A;  3GJ9 A;  1V5Q A;  3EGG C;  1KWA A;  3GSL A;  4R2Z A;  5HFB A;  1WH1 A;  3EGH C;  3CC0 A;  2O2T A;  2G2L A;  3QO6 A;  5HET A;  2DB5 A;  4EDJ A;  1Y8T A;  2D90 A;  4JOE A;  2LUI A;  4WYT A;  1W9O A;  2JOA A;  3QE1 A;  2QT5 A;  2ZPM A;  4NMR A;  3SOE A;  3WKM A;  2PDZ A;  1WF8 A;  2EJY A;  4F8K A;  1L6O A;  2PKU A;  2PZD A;  3GDV A;  1UIT A;  2QBW A;  2PNT A;  2EHR A;  4RI0 A;  1RZX A;  1WFV A;  1V6B A;  1BFE A;  1Q3P A;  2I0I A;  2JRE A;  2MX6 A;  3R69 A;  4NMV A;  1B8Q A;  1GM1 A;  3FY5 A;  4E3B A;  5D13 A;  2KL1 A;  5HFE A;  2CSS A;  1N6D A;  2M0U A;  1TE0 A;  3RLE A;  3HVQ C;  4Q6H A;  5HFD A;  1WHA A;  3PS4 A;  3QJN A;  2REY A;  1WG6 A;  2LC6 A;  4XHV A;  1X8S A;  2G5M B;  3WKL A;  4NXQ A;  2I1N A;  3KZE A;  1N99 A;  2QG1 A;  1QLC A;  5GND A;  2KOH A;  2DJT A;  2EGN A;  4HOP B;  4HOP A;  2KJK A;  4NNM A;  2EGO A;  2L4T A;  1P1D A;  2M10 A;  2CS5 A;  3R68 A;  2AWU A;  2QKV A;  2DLU A;  1TQ3 A;  1P1E A;  2LC7 A;  2RCZ A;  5EZ0 A;  2DC2 A;  4N6X A;  1OBY A;  1RY4 A;  3JXT A;  3K82 A;  1Z86 A;  2EEG A;  2YTW A;  4G69 A;  2FE5 A;  2KOM A;  2R3Y A;  4O06 A;  4NMT A;  3SUZ A;  2W4F A;  1WIF A;  4GHN A;  2IWQ A;  2YT7 A;  1D5G A;  4K78 A;  1V1T A;  4P2A B;  4NXR A;  2OZF A;  4Q2O A;  1IU0 A;  2HGA A;  1Z87 A;  2EDV A;  2KPK A;  1FCF A;  2HE2 A;  1QAU A;  3GDS A;  1IU2 A;  3RL7 A;  4UU6 A;  3TSW A;  2DKR A;  4Q2P A;  3LNY A;  1OZI A;  3OTP A;  2CSJ A;  1U37 A;  3TSZ A;  4OAJ A;  2M0V A;  1MFG A;  2Z17 A;  4FGM A;  1VJ6 A;  2KAW A;  3DJ3 A;  3HPM A;  2H3M A;  4NMQ A;  2OGP A;  2DM8 A;  1ZUB A;  2EEH A;  3QGL A;  2KPL A;  2K1Z A;  2Q9V A;  1WF7 A;  1WI2 A;  2PKT A;  4K76 A;  1MFL A;  1R6J A;  4OEP A;  1N7T A;  2IWO A;  2H3L A;  1I16 A;  2OMJ A;  2OQS A;  2WL7 A;  3O46 A;  2OPG A;  4Q3H A;  1UM7 A;  2JXO A;  2KRG A;  1W9Q A;  3ID1 A;  3R0H A;  5F3X A;  3MH7 A;  2Z9I A;  1N6F A;  2AWW A;  2YUB A;  1WHD A;  2RRM A;  3HPK A;  1BE9 A;  1G9O A;  2EAQ A;  1UM1 A;  4E35 A;  3ID4 A;  1TP3 A;  2F0A A;  2LA8 A;  3KZD A;  2AWX A;  3VQF A;  4JL7 A;  1GQ4 A;  1N6E A;  1UF1 A;  4Z8J A;  5I7Z A;  1Q3O A;  2OCS A;  3PV5 A;  3QDO A;  1FC6 A;  4YDP A;  2KBS A;  4JOR A;  2HE4 A;  2KV8 A;  4AMH A;  1UEP A;  3GDU A;  1X5Q A;  5GLJ A;  1M5Z A;  2H2B A;  4LMM A;  1KY9 A;  5H3J A;  2GZV A;  4UU5 A;  3DJA A;  5HFF A;  3STJ A;  2L97 A;  5HFC A;  1PDR A;  1RGR A;  2OSG A;  1SOT A;  4JOJ A;  5HEY A;  1SOZ A;  3TMH A;  2FN5 A;  1T2M A;  1X5N A;  5EYZ A;  1KEF A;  5FB8 C;  3GCO A;  2L4S A;  2VSP A;  1UFX A;  2VPH A;  1X5R A;  2K20 A;  3ID3 A;  1FC7 A;  1VCW A;  1WJL A;  5HF1 A;  2M0Z A;  3SHW A;  2VWR A;  5HDY A;  3CYY A;  4MPA A;  2ZPL A;  1X45 A;  3K50 A;  2I0L A;  3SHU A;  1UJU A;  2KA9 A;  2VSV A;  2KOJ A;  2FNE A;  2LOB A;  4IC6 A;  4NMO A;  4NMS A;  1UEZ A;  3MH4 A;  3I18 A;  2VRF A;  2UZC A;  1UHP A;  5G1E A;  2MHO A;  5E11 A;  1LCY A;  2M0T A;  2EGK A;  1NTE A;  2IWP A;  4YYX A;  3PV4 A;  2DMZ A;  2KJD A; 
#chains in the Genus database with same CATH topology
 2W7R A;  3GAB A;  1ZOK A;  3AXA A;  2EDZ A;  1I92 A;  3DIW A;  5F67 A;  1W9E A;  2EEI A;  2JIL A;  3GGE A;  2AIN A;  4K72 A;  1VB7 A;  4JOF A;  3B76 A;  5A2P A;  3CS0 A;  3OU0 A;  1YBO A;  2KQF A;  1VA8 A;  1U39 A;  1UJV A;  1Q7X A;  2E7K A;  2EV8 A;  2KJP A;  4NNL A;  2JIK A;  3NGH A;  3GCN A;  1K32 A;  2EXG A;  3TSV A;  1V5L A;  2ENO A;  2D92 A;  4Z33 A;  5FHT A;  1OBZ A;  4Q6S A;  4K75 A;  5E6P B;  1FC9 A;  3E17 A;  2X7Z A;  3L4F D;  2QKT A;  3ZRT A;  1N7F A;  1MC7 A;  4REY A;  3QJM A;  5E22 A;  3CBZ A;  4GVD A;  3CBY A;  4JOH A;  4KFV A;  1NF3 C;  3SFJ A;  2M3M A;  2VZ5 A;  4JOK A;  1Y7N A;  4OEO A;  3ID2 A;  3PDZ A;  4JOG A;  4L8N A;  3CH8 A;  3PDV A;  1OBX A;  3KHF A;  4NMP A;  2QKU A;  2R4H A;  2DLS A;  3PV2 A;  1TP5 A;  4K6Y A;  2V90 A;  1N7E A;  3DOR A;  2YT8 A;  2Q3G A;  2I04 A;  2BYG A;  1WI4 A;  1WFG A;  4Q2N A;  5HF4 A;  2I4S A;  3NFL A;  1RGW A;  4PQW A;  4JOP A;  3O5N A;  3I4W A;  2P3W A;  4KFW A;  2DAZ A;  1X6D A;  1U3B A;  2JIN A;  5HED A;  1UEQ A;  2EDP A;  3VQG A;  2GEF A;  4NXP A;  1UEW A;  4Q2Q A;  4WYU A;  5HEB A;  5B6L A;  2OS6 A;  3MH6 A;  4P0C A;  5E21 A;  5JXB A;  2FCF A;  3I1E A;  2EEJ A;  2H2C A;  2I6V A;  2D8I A;  1U38 A;  4E34 A;  1GQ5 A;  2IWN A;  2F5Y A;  3QIK A;  1VAE A;  2KYL A;  3K1R A;  2KG2 A;  1UJD A;  5G1D A;  3DJ1 A;  4GVC A;  5DTH A;  1IHJ A;  2JWE A;  2JSN A;  5HJ1 A;  4H11 A;  4JJ3 A;  4JJ0 A;  3NFK A;  1V62 A;  2YUY A;  3CBX A;  2PA1 A;  3RL8 A;  2V1W A;  3BPU A;  1QAV B;  1XZ9 A;  1QAV A;  3LNX A;  5E1Y A;  3GJ9 A;  1V5Q A;  3EGG C;  1KWA A;  3GSL A;  4R2Z A;  5HFB A;  1WH1 A;  3EGH C;  3CC0 A;  2O2T A;  5B42 A;  2G2L A;  3QO6 A;  5HET A;  2DB5 A;  4EDJ A;  1Y8T A;  2D90 A;  4JOE A;  2LUI A;  4WYT A;  1W9O A;  2JOA A;  3QE1 A;  2QT5 A;  2ZPM A;  4NMR A;  3SOE A;  3WKM A;  2PDZ A;  1WF8 A;  2EJY A;  4F8K A;  1L6O A;  2PKU A;  2PZD A;  3GDV A;  1UIT A;  2QBW A;  2PNT A;  2EHR A;  4RI0 A;  1RZX A;  1WFV A;  1V6B A;  1BFE A;  1Q3P A;  2I0I A;  2JRE A;  2MX6 A;  3R69 A;  4NMV A;  1B8Q A;  1GM1 A;  3FY5 A;  4E3B A;  5D13 A;  2KL1 A;  5HFE A;  2CSS A;  1N6D A;  2M0U A;  1TE0 A;  3RLE A;  3HVQ C;  4Q6H A;  4FLN A;  5HFD A;  1WHA A;  3PS4 A;  3QJN A;  2REY A;  1WG6 A;  2LC6 A;  4XHV A;  1X8S A;  2G5M B;  3WKL A;  4NXQ A;  2I1N A;  3KZE A;  1N99 A;  2QG1 A;  1QLC A;  5GND A;  2KOH A;  2DJT A;  2EGN A;  4HOP B;  4HOP A;  2KJK A;  4NNM A;  2EGO A;  2L4T A;  1P1D A;  2M10 A;  2CS5 A;  3R68 A;  2AWU A;  2QKV A;  2DLU A;  1TQ3 A;  1P1E A;  2LC7 A;  2RCZ A;  5EZ0 A;  2DC2 A;  4N6X A;  3KDG A;  1OBY A;  1RY4 A;  3JXT A;  3K82 A;  1Z86 A;  2EEG A;  2YTW A;  4G69 A;  2FE5 A;  2KOM A;  2R3Y A;  4O06 A;  4NMT A;  5ILB A;  3SUZ A;  2W4F A;  1WIF A;  4GHN A;  2IWQ A;  2YT7 A;  1D5G A;  4K78 A;  1V1T A;  4P2A B;  4NXR A;  2OZF A;  4Q2O A;  1IU0 A;  2HGA A;  1Z87 A;  2EDV A;  2KPK A;  1FCF A;  2HE2 A;  1QAU A;  3GDS A;  1IU2 A;  3RL7 A;  4UU6 A;  3TSW A;  2DKR A;  4Q2P A;  3LNY A;  1OZI A;  3OTP A;  2CSJ A;  1U37 A;  3TSZ A;  4OAJ A;  2M0V A;  1MFG A;  2Z17 A;  4FGM A;  1VJ6 A;  2KAW A;  3DJ3 A;  3HPM A;  2H3M A;  4NMQ A;  2OGP A;  2DM8 A;  1ZUB A;  2EEH A;  3QGL A;  2KPL A;  2K1Z A;  2Q9V A;  1WF7 A;  1WI2 A;  2PKT A;  4K76 A;  1MFL A;  5IL9 A;  1R6J A;  4OEP A;  1N7T A;  2IWO A;  2H3L A;  1I16 A;  2OMJ A;  2OQS A;  2WL7 A;  3O46 A;  2OPG A;  4Q3H A;  1UM7 A;  2JXO A;  2KRG A;  1W9Q A;  3ID1 A;  3R0H A;  3NCV A;  5F3X A;  3MH7 A;  2Z9I A;  1N6F A;  2AWW A;  2YUB A;  1WHD A;  2RRM A;  3HPK A;  1BE9 A;  1G9O A;  2EAQ A;  1UM1 A;  4E35 A;  3ID4 A;  1TP3 A;  2F0A A;  2LA8 A;  3KDK A;  3KZD A;  2AWX A;  3VQF A;  4JL7 A;  1GQ4 A;  1N6E A;  1UF1 A;  4Z8J A;  5I7Z A;  1Q3O A;  2OCS A;  3PV5 A;  3QDO A;  1FC6 A;  4YDP A;  2KBS A;  4JOR A;  2HE4 A;  2KV8 A;  4AMH A;  1UEP A;  3GDU A;  1X5Q A;  5GLJ A;  1M5Z A;  2H2B A;  4LMM A;  1KY9 A;  5H3J A;  2GZV A;  4UU5 A;  3DJA A;  5HFF A;  3STJ A;  2L97 A;  5HFC A;  1PDR A;  1RGR A;  2OSG A;  1SOT A;  4JOJ A;  5HEY A;  1SOZ A;  3TMH A;  2FN5 A;  1T2M A;  1X5N A;  5EYZ A;  1KEF A;  5FB8 C;  3GCO A;  2L4S A;  2VSP A;  1UFX A;  2VPH A;  1X5R A;  2K20 A;  3ID3 A;  1FC7 A;  1VCW A;  1WJL A;  5HF1 A;  2M0Z A;  3SHW A;  2VWR A;  5HDY A;  3CYY A;  4MPA A;  2ZPL A;  1X45 A;  3K50 A;  2I0L A;  3SHU A;  1UJU A;  2KA9 A;  2VSV A;  1X9Z A;  2KOJ A;  2FNE A;  2LOB A;  4IC6 A;  4NMO A;  4NMS A;  1UEZ A;  3MH4 A;  3I18 A;  2VRF A;  2UZC A;  1UHP A;  5G1E A;  2MHO A;  5E11 A;  1LCY A;  2M0T A;  2EGK A;  1NTE A;  2IWP A;  4YYX A;  3PV4 A;  2DMZ A;  2KJD A; 
#chains in the Genus database with same CATH homology
 2W7R A;  3GAB A;  1ZOK A;  3AXA A;  2EDZ A;  1I92 A;  3DIW A;  5F67 A;  1W9E A;  2EEI A;  2JIL A;  3GGE A;  2AIN A;  4K72 A;  1VB7 A;  4JOF A;  3B76 A;  5A2P A;  3CS0 A;  3OU0 A;  1YBO A;  2KQF A;  1VA8 A;  1U39 A;  1UJV A;  1Q7X A;  2E7K A;  2EV8 A;  2KJP A;  4NNL A;  2JIK A;  3NGH A;  3GCN A;  1K32 A;  2EXG A;  3TSV A;  1V5L A;  2ENO A;  2D92 A;  4Z33 A;  5FHT A;  1OBZ A;  4Q6S A;  4K75 A;  5E6P B;  1FC9 A;  3E17 A;  2X7Z A;  3L4F D;  2QKT A;  3ZRT A;  1N7F A;  1MC7 A;  4REY A;  3QJM A;  5E22 A;  3CBZ A;  4GVD A;  3CBY A;  4JOH A;  4KFV A;  1NF3 C;  3SFJ A;  2M3M A;  2VZ5 A;  4JOK A;  1Y7N A;  4OEO A;  3ID2 A;  3PDZ A;  4JOG A;  4L8N A;  3CH8 A;  3PDV A;  1OBX A;  3KHF A;  4NMP A;  2QKU A;  2R4H A;  2DLS A;  3PV2 A;  1TP5 A;  4K6Y A;  2V90 A;  1N7E A;  3DOR A;  2YT8 A;  2Q3G A;  2I04 A;  2BYG A;  1WI4 A;  1WFG A;  4Q2N A;  5HF4 A;  2I4S A;  3NFL A;  1RGW A;  4PQW A;  4JOP A;  3O5N A;  3I4W A;  2P3W A;  4KFW A;  2DAZ A;  1X6D A;  1U3B A;  2JIN A;  5HED A;  1UEQ A;  2EDP A;  3VQG A;  2GEF A;  4NXP A;  1UEW A;  4Q2Q A;  4WYU A;  5HEB A;  5B6L A;  2OS6 A;  3MH6 A;  4P0C A;  5E21 A;  5JXB A;  2FCF A;  3I1E A;  2EEJ A;  2H2C A;  2I6V A;  2D8I A;  1U38 A;  4E34 A;  1GQ5 A;  2IWN A;  2F5Y A;  3QIK A;  1VAE A;  2KYL A;  3K1R A;  2KG2 A;  1UJD A;  5G1D A;  3DJ1 A;  4GVC A;  5DTH A;  1IHJ A;  2JWE A;  2JSN A;  5HJ1 A;  4H11 A;  4JJ3 A;  4JJ0 A;  3NFK A;  1V62 A;  2YUY A;  3CBX A;  2PA1 A;  3RL8 A;  2V1W A;  3BPU A;  1QAV B;  1XZ9 A;  1QAV A;  3LNX A;  5E1Y A;  3GJ9 A;  1V5Q A;  3EGG C;  1KWA A;  3GSL A;  4R2Z A;  5HFB A;  1WH1 A;  3EGH C;  3CC0 A;  2O2T A;  5B42 A;  2G2L A;  3QO6 A;  5HET A;  2DB5 A;  4EDJ A;  1Y8T A;  2D90 A;  4JOE A;  2LUI A;  4WYT A;  1W9O A;  2JOA A;  3QE1 A;  2QT5 A;  2ZPM A;  4NMR A;  3SOE A;  3WKM A;  2PDZ A;  1WF8 A;  2EJY A;  4F8K A;  1L6O A;  2PKU A;  2PZD A;  3GDV A;  1UIT A;  2QBW A;  2PNT A;  2EHR A;  4RI0 A;  1RZX A;  1WFV A;  1V6B A;  1BFE A;  1Q3P A;  2I0I A;  2JRE A;  2MX6 A;  3R69 A;  4NMV A;  1B8Q A;  1GM1 A;  3FY5 A;  4E3B A;  5D13 A;  2KL1 A;  5HFE A;  2CSS A;  1N6D A;  2M0U A;  1TE0 A;  3RLE A;  3HVQ C;  4Q6H A;  4FLN A;  5HFD A;  1WHA A;  3PS4 A;  3QJN A;  2REY A;  1WG6 A;  2LC6 A;  4XHV A;  1X8S A;  2G5M B;  3WKL A;  4NXQ A;  2I1N A;  3KZE A;  1N99 A;  2QG1 A;  1QLC A;  5GND A;  2KOH A;  2DJT A;  2EGN A;  4HOP B;  4HOP A;  2KJK A;  4NNM A;  2EGO A;  2L4T A;  1P1D A;  2M10 A;  2CS5 A;  3R68 A;  2AWU A;  2QKV A;  2DLU A;  1TQ3 A;  1P1E A;  2LC7 A;  2RCZ A;  5EZ0 A;  2DC2 A;  4N6X A;  3KDG A;  1OBY A;  1RY4 A;  3JXT A;  3K82 A;  1Z86 A;  2EEG A;  2YTW A;  4G69 A;  2FE5 A;  2KOM A;  2R3Y A;  4O06 A;  4NMT A;  5ILB A;  3SUZ A;  2W4F A;  1WIF A;  4GHN A;  2IWQ A;  2YT7 A;  1D5G A;  4K78 A;  1V1T A;  4P2A B;  4NXR A;  2OZF A;  4Q2O A;  1IU0 A;  2HGA A;  1Z87 A;  2EDV A;  2KPK A;  1FCF A;  2HE2 A;  1QAU A;  3GDS A;  1IU2 A;  3RL7 A;  4UU6 A;  3TSW A;  2DKR A;  4Q2P A;  3LNY A;  1OZI A;  3OTP A;  2CSJ A;  1U37 A;  3TSZ A;  4OAJ A;  2M0V A;  1MFG A;  2Z17 A;  4FGM A;  1VJ6 A;  2KAW A;  3DJ3 A;  3HPM A;  2H3M A;  4NMQ A;  2OGP A;  2DM8 A;  1ZUB A;  2EEH A;  3QGL A;  2KPL A;  2K1Z A;  2Q9V A;  1WF7 A;  1WI2 A;  2PKT A;  4K76 A;  1MFL A;  5IL9 A;  1R6J A;  4OEP A;  1N7T A;  2IWO A;  2H3L A;  1I16 A;  2OMJ A;  2OQS A;  2WL7 A;  3O46 A;  2OPG A;  4Q3H A;  1UM7 A;  2JXO A;  2KRG A;  1W9Q A;  3ID1 A;  3R0H A;  3NCV A;  5F3X A;  3MH7 A;  2Z9I A;  1N6F A;  2AWW A;  2YUB A;  1WHD A;  2RRM A;  3HPK A;  1BE9 A;  1G9O A;  2EAQ A;  1UM1 A;  4E35 A;  3ID4 A;  1TP3 A;  2F0A A;  2LA8 A;  3KDK A;  3KZD A;  2AWX A;  3VQF A;  4JL7 A;  1GQ4 A;  1N6E A;  1UF1 A;  4Z8J A;  5I7Z A;  1Q3O A;  2OCS A;  3PV5 A;  3QDO A;  1FC6 A;  4YDP A;  2KBS A;  4JOR A;  2HE4 A;  2KV8 A;  4AMH A;  1UEP A;  3GDU A;  1X5Q A;  5GLJ A;  1M5Z A;  2H2B A;  4LMM A;  1KY9 A;  5H3J A;  2GZV A;  4UU5 A;  3DJA A;  5HFF A;  3STJ A;  2L97 A;  5HFC A;  1PDR A;  1RGR A;  2OSG A;  1SOT A;  4JOJ A;  5HEY A;  1SOZ A;  3TMH A;  2FN5 A;  1T2M A;  1X5N A;  5EYZ A;  1KEF A;  5FB8 C;  3GCO A;  2L4S A;  2VSP A;  1UFX A;  2VPH A;  1X5R A;  2K20 A;  3ID3 A;  1FC7 A;  1VCW A;  1WJL A;  5HF1 A;  2M0Z A;  3SHW A;  2VWR A;  5HDY A;  3CYY A;  4MPA A;  2ZPL A;  1X45 A;  3K50 A;  2I0L A;  3SHU A;  1UJU A;  2KA9 A;  2VSV A;  1X9Z A;  2KOJ A;  2FNE A;  2LOB A;  4IC6 A;  4NMO A;  4NMS A;  1UEZ A;  3MH4 A;  3I18 A;  2VRF A;  2UZC A;  1UHP A;  5G1E A;  2MHO A;  5E11 A;  1LCY A;  2M0T A;  2EGK A;  1NTE A;  2IWP A;  4YYX A;  3PV4 A;  2DMZ A;  2KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...