4P2AB

Structure of mouse vps26a bound to rat snx27 pdz domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
97
structure length
97
Chain Sequence
b'GSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 26A
publication title A unique PDZ domain and arrestin-like fold interaction reveals mechanistic details of endocytic recycling by SNX27-retromer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 19
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4p2aB00
1GQ5A 2I04A 2YTWA 3PV4A 3NGHA 3SUZA 4Z33A 1NF3C 1B8QA 1KWAA 1WJLA 2KRGA 4OEOA 4HOPB 4XHVA 1IHJA 3GDUA 1WHDA 4N6XA 2GZVA 3GCOA 4K78A 4P2AB 3I18A 4E3BA 3ID2A 4REYA 1N7EA 3MH4A 3CS0A 2EHRA 2EGNA 1X8SA 5E21A 1G9OA 4MPAA 4YDPA 4JOPA 2KL1A 1YBOA 5F3XA 1NTEA 2IWOA 1OBYA 5F67A 4HOPA 2KJKA 4Q2OA 3B76A 2D90A 1P1EA 2VSVA 4JOKA 2CSJA 4YYXA 1GM1A 2DJTA 3K82A 4F8KA 2F0AA 1VJ6A 1Q3PA 2D8IA 1V1TA 5E6PB 4Z8JA 3RL7A 3DIWA 2KJDA 2EV8A 2WL7A 4Q2PA 1Z87A 1KY9A 2I0IA 2H2BA 1I92A 2JXOA 3TSZA 3KZEA 4Q2NA 2BYGA 3OU0A 3PDZA 1QLCA 1WIFA 2EEIA 3CBZA 5G1EA 3E17A 2JINA 1U39A 2OGPA 5HDYA 1UFXA 2PA1A 5HEBA 5A2PA 3CYYA 2KG2A 5HFEA 1V5LA 1ZUBA 3PV2A 3SHWA 4L8NA 2OSGA 5HF4A 2KOHA 2PKTA 1Y8TA 2KYLA 2VRFA 1SOZA 3SFJA 1UF1A 4NMRA 1TP3A 2H3LA 5E22A 3RL8A 2DM8A 2EEHA 3DJ1A 4JOJA 2OS6A 1ZOKA 2L4TA 2VSPA 4WYUA 1WF8A 5HFFA 3DORA 1UITA 3QGLA 2PZDA 1TE0A 5D13A 2KOMA 3QO6A 5EYZA 2EDPA 5B6LA 2MHOA 1RY4A 3CC0A 3MH7A 4K76A 4JOGA 4GHNA 4RI0A 1VA8A 1SOTA 2VWRA 1D5GA 5EZ0A 2FE5A 3DJAA 1MC7A 2OMJA 4JOHA 1FC6A 2YT7A 3QJMA 3GSLA 4R2ZA 3ZRTA 4JOFA 2QKTA 3KHFA 3HVQC 2R3YA 3I4WA 3O46A 1N99A 4KFWA 2AWWA 2K1ZA 2KAWA 2OCSA 2W4FA 2G5MB 2DLUA 1UJDA 1WHAA 2EEGA 1N6DA 3TMHA 1WFVA 1Y7NA 4NMSA 1N7FA 5HFCA 1Q7XA 1U3BA 1N6FA 2REYA 2HGAA 3QIKA 3GJ9A 2EJYA 2KV8A 4O06A 4NXRA 3GCNA 2FNEA 2JILA 4UU6A 2EGKA 1RGWA 1OBZA 2V1WA 2YUBA 1RZXA 2I4SA 1M5ZA 2CS5A 2EGOA 2KOJA 1W9EA 1GQ4A 2EDZA 2KA9A 2R4HA 2YUYA 1X45A 3GGEA 4WYTA 3KZDA 1VB7A 1Q3OA 1V62A 2ENOA 2QT5A 2LA8A 3NFLA 1UEWA 1OZIA 5E1YA 3SOEA 2E7KA 3QE1A 2DKRA 1N6EA 5HEYA 1FCFA 4K6YA 2Q9VA 4K72A 2V90A 5GNDA 3K1RA 3SHUA 1OBXA 3R0HA 4UU5A 2ZPLA 2ZPMA 1WI2A 1V6BA 1UM7A 2LC6A 3I1EA 2OQSA 1UHPA 1VCWA 2M0UA 2W7RA 5HFDA 2LUIA 2QBWA 2HE2A 2UZCA 5H3JA 3ID1A 1FC9A 1UM1A 5I7ZA 4GVCA 2Z17A 3WKMA 2M3MA 3ID4A 5HF1A 1R6JA 2PNTA 4FGMA 2Z9IA 1MFLA 4JOEA 2FCFA 3CBXA 2F5YA 1X5NA 3MH6A 1UEPA 1UJVA 1U38A 3RLEA 1I16A 2G2LA 5HFBA 1TP5A 2KPLA 3LNXA 3LNYA 2O2TA 3R69A 1UJUA 1W9OA 3DJ3A 3EGGC 3TSWA 3HPMA 2JIKA 2H3MA 4JORA 4IC6A 4NMPA 1X5QA 1MFGA 2QKVA 2YT8A 2DAZA 2I6VA 1U37A 3HPKA 1X6DA 2HE4A 1L6OA 5DTHA 3NFKA 2EXGA 2L97A 2I1NA 2EDVA 1UEZA 2M0VA 1KEFA 3GDSA 1UEQA 2QG1A 1WF7A 2KPKA 2M0TA 4OAJA 4NMQA 3BPUA 4P0CA 2KQFA 2EEJA 5G1DA 4NXQA 4GVDA 3AXAA 2P3WA 1PDRA 3TSVA 3CBYA 2IWNA 1QAVB 4Q2QA 1RGRA 2AWUA 2VPHA 2OZFA 2DMZA 4EDJA 2OPGA 1P1DA 3VQFA 4NXPA 1IU2A 3PS4A 3PDVA 2QKUA 2M10A 3PV5A 1VAEA 3R68A 2I0LA 4NNMA 1XZ9A 1FC7A 2KJPA 2MX6A 2Q3GA 2KBSA 1WG6A 2AWXA 2FN5A 1QAVA 4H11A 4E34A 1BE9A 2X7ZA 2M0ZA 1IU0A 1W9QA 1WH1A 3STJA 2EAQA 4NMVA 1QAUA 1V5QA 4NMTA 2IWPA 4Q6HA 4OEPA 5GLJA 3FY5A 2JREA 4AMHA 2IWQA 3EGHC 2DLSA 2RCZA 4G69A 2H2CA 4LMMA 4E35A 2LOBA 3QDOA 5E11A 2AINA 1TQ3A 2JOAA 1WI4A 2PKUA 2L4SA 4K75A 1Z86A 2JWEA 4NMOA 2DC2A 2DB5A 3CH8A 2CSSA 2RRMA 3VQGA 4JL7A 3ID3A 5FHTA 4PQWA 5FB8C 4Q3HA 3K50A 3WKLA 3O5NA 1K32A 5HJ1A 5HEDA 3L4FD 2PDZA 1BFEA 2VZ5A 2K20A 1WFGA 1T2MA 3QJNA 4KFVA 2LC7A 4NNLA 1LCYA 3OTPA 5HETA 1N7TA 2D92A 3JXTA 3GDVA 4Q6SA 1X5RA 5JXBA
chains in the Genus database with same CATH superfamily
1GQ5A 2I04A 2YTWA 3PV4A 3NGHA 3SUZA 4Z33A 1NF3C 1B8QA 1KWAA 1WJLA 2KRGA 4OEOA 4HOPB 4XHVA 1IHJA 3GDUA 1WHDA 4N6XA 2GZVA 3GCOA 4K78A 4P2AB 3I18A 4E3BA 3ID2A 4REYA 1N7EA 3MH4A 3CS0A 2EHRA 2EGNA 1X8SA 5E21A 1G9OA 4MPAA 4YDPA 4JOPA 2KL1A 1YBOA 5F3XA 1NTEA 2IWOA 1OBYA 5F67A 4HOPA 2KJKA 4Q2OA 3B76A 2D90A 1P1EA 2VSVA 4JOKA 2CSJA 4YYXA 1GM1A 2DJTA 3K82A 4F8KA 2F0AA 1VJ6A 1Q3PA 2D8IA 1V1TA 5E6PB 4Z8JA 3RL7A 3DIWA 2KJDA 2EV8A 2WL7A 4Q2PA 1Z87A 1KY9A 2I0IA 2H2BA 1I92A 4FLNA 2JXOA 3TSZA 3KZEA 4Q2NA 5IL9A 2BYGA 3OU0A 3PDZA 1QLCA 1WIFA 2EEIA 3CBZA 5G1EA 3E17A 2JINA 1U39A 2OGPA 5HDYA 1UFXA 2PA1A 5HEBA 5A2PA 3CYYA 2KG2A 5HFEA 1V5LA 1ZUBA 3PV2A 3SHWA 4L8NA 2OSGA 5HF4A 2KOHA 2PKTA 1Y8TA 2KYLA 2VRFA 1SOZA 3SFJA 1UF1A 4NMRA 1TP3A 2H3LA 5E22A 3RL8A 2DM8A 2EEHA 3DJ1A 4JOJA 2OS6A 1ZOKA 2L4TA 2VSPA 4WYUA 1WF8A 5HFFA 3DORA 1UITA 3QGLA 2PZDA 3KDGA 1TE0A 4JJ0A 5D13A 2KOMA 3QO6A 5EYZA 2EDPA 4JJ3A 5B6LA 2MHOA 1RY4A 3CC0A 3MH7A 4K76A 4JOGA 4GHNA 4RI0A 1VA8A 1SOTA 2VWRA 1D5GA 5EZ0A 2FE5A 3DJAA 1MC7A 2OMJA 4JOHA 1FC6A 2YT7A 3QJMA 3GSLA 4R2ZA 3ZRTA 4JOFA 2QKTA 3KHFA 5B42A 3HVQC 2R3YA 3I4WA 3O46A 1N99A 2JSNA 4KFWA 2AWWA 2K1ZA 2KAWA 2OCSA 2W4FA 2G5MB 2DLUA 1UJDA 1WHAA 2EEGA 1N6DA 3TMHA 1WFVA 1Y7NA 4NMSA 1N7FA 5HFCA 1Q7XA 1U3BA 1N6FA 2REYA 2HGAA 3QIKA 3GJ9A 2EJYA 2KV8A 4O06A 4NXRA 3GCNA 2FNEA 2JILA 4UU6A 2EGKA 1RGWA 1OBZA 2V1WA 2YUBA 1RZXA 2I4SA 1M5ZA 2CS5A 2EGOA 2KOJA 1W9EA 1GQ4A 2EDZA 2KA9A 2R4HA 2YUYA 1X45A 3GGEA 4WYTA 3KZDA 1VB7A 1Q3OA 1V62A 2ENOA 2QT5A 2LA8A 3NFLA 1UEWA 1OZIA 5E1YA 3SOEA 2E7KA 3QE1A 2DKRA 1N6EA 5HEYA 1FCFA 4K6YA 2Q9VA 4K72A 2V90A 5GNDA 3K1RA 3SHUA 1OBXA 3R0HA 4UU5A 2ZPLA 2ZPMA 1WI2A 1V6BA 1UM7A 2LC6A 3I1EA 2OQSA 1UHPA 1VCWA 2M0UA 2W7RA 5HFDA 2LUIA 2QBWA 2HE2A 2UZCA 5H3JA 3ID1A 1FC9A 1UM1A 5I7ZA 4GVCA 2Z17A 3WKMA 2M3MA 3ID4A 5HF1A 3NCVA 1R6JA 2PNTA 4FGMA 2Z9IA 1MFLA 4JOEA 2FCFA 3CBXA 2F5YA 1X5NA 3MH6A 1UEPA 1UJVA 1U38A 3RLEA 2GEFA 2G2LA 5HFBA 1I16A 1TP5A 2KPLA 3LNXA 3LNYA 2O2TA 3R69A 1UJUA 1W9OA 3DJ3A 3EGGC 3TSWA 3HPMA 2JIKA 2H3MA 4JORA 4IC6A 4NMPA 1X5QA 1MFGA 2QKVA 2YT8A 2DAZA 2I6VA 1U37A 3HPKA 1X6DA 2HE4A 1L6OA 5DTHA 3NFKA 2EXGA 2L97A 2I1NA 2EDVA 1UEZA 2M0VA 1KEFA 3GDSA 1UEQA 2QG1A 5ILBA 1WF7A 2KPKA 2M0TA 4OAJA 4NMQA 3BPUA 4P0CA 2KQFA 2EEJA 5G1DA 4NXQA 4GVDA 3AXAA 2P3WA 1PDRA 3TSVA 3CBYA 3GABA 2IWNA 1QAVB 4Q2QA 1RGRA 2AWUA 2VPHA 2OZFA 2DMZA 4EDJA 2OPGA 1P1DA 3VQFA 4NXPA 1IU2A 3PS4A 3PDVA 2QKUA 2M10A 3PV5A 1VAEA 3R68A 2I0LA 4NNMA 1XZ9A 1FC7A 2KJPA 2MX6A 2Q3GA 2KBSA 1WG6A 2AWXA 2FN5A 1QAVA 4H11A 4E34A 1BE9A 2X7ZA 2M0ZA 1IU0A 1W9QA 1WH1A 3STJA 2EAQA 4NMVA 1QAUA 1V5QA 4NMTA 2IWPA 4Q6HA 4OEPA 5GLJA 3FY5A 2JREA 4AMHA 2IWQA 3EGHC 2DLSA 2RCZA 4G69A 2H2CA 4LMMA 4E35A 2LOBA 3QDOA 5E11A 2AINA 1TQ3A 2JOAA 1WI4A 2PKUA 2L4SA 4K75A 1Z86A 2JWEA 4NMOA 2DC2A 2DB5A 3CH8A 2CSSA 2RRMA 3VQGA 4JL7A 3ID3A 5FHTA 4PQWA 3KDKA 5FB8C 4Q3HA 3K50A 3WKLA 3O5NA 1K32A 5HJ1A 5HEDA 3L4FD 2PDZA 1BFEA 2VZ5A 2K20A 1WFGA 1T2MA 3QJNA 4KFVA 2LC7A 4NNLA 1LCYA 3OTPA 5HETA 1N7TA 2D92A 1X9ZA 3JXTA 3GDVA 4Q6SA 1X5RA 5JXBA
chains in the Genus database with same CATH topology
1GQ5A 2I04A 2YTWA 3PV4A 3NGHA 3SUZA 4Z33A 1NF3C 1B8QA 1KWAA 1WJLA 2KRGA 4OEOA 4HOPB 4XHVA 1IHJA 3GDUA 1WHDA 4N6XA 2GZVA 3GCOA 4K78A 4P2AB 3I18A 4E3BA 3ID2A 4REYA 1N7EA 3MH4A 3CS0A 2EHRA 2EGNA 1X8SA 5E21A 1G9OA 4MPAA 4YDPA 4JOPA 2KL1A 1YBOA 5F3XA 1NTEA 2IWOA 1OBYA 5F67A 4HOPA 2KJKA 4Q2OA 3B76A 2D90A 1P1EA 2VSVA 4JOKA 2CSJA 4YYXA 1GM1A 2DJTA 3K82A 4F8KA 2F0AA 1VJ6A 1Q3PA 2D8IA 1V1TA 5E6PB 4Z8JA 3RL7A 3DIWA 2KJDA 2EV8A 2WL7A 4Q2PA 1Z87A 1KY9A 2I0IA 2H2BA 1I92A 4FLNA 2JXOA 3TSZA 3KZEA 4Q2NA 5IL9A 2BYGA 3OU0A 3PDZA 1QLCA 1WIFA 2EEIA 3CBZA 5G1EA 3E17A 2JINA 1U39A 2OGPA 5HDYA 1UFXA 2PA1A 5HEBA 5A2PA 3CYYA 2KG2A 5HFEA 1V5LA 1ZUBA 3PV2A 3SHWA 4L8NA 2OSGA 5HF4A 2KOHA 2PKTA 1Y8TA 2KYLA 2VRFA 1SOZA 3SFJA 1UF1A 4NMRA 1TP3A 2H3LA 5E22A 3RL8A 2DM8A 2EEHA 3DJ1A 4JOJA 2OS6A 1ZOKA 2L4TA 2VSPA 4WYUA 1WF8A 5HFFA 3DORA 1UITA 3QGLA 2PZDA 3KDGA 1TE0A 4JJ0A 5D13A 2KOMA 3QO6A 5EYZA 2EDPA 4JJ3A 5B6LA 2MHOA 1RY4A 3CC0A 3MH7A 4K76A 4JOGA 4GHNA 4RI0A 1VA8A 1SOTA 2VWRA 1D5GA 5EZ0A 2FE5A 3DJAA 1MC7A 2OMJA 4JOHA 1FC6A 2YT7A 3QJMA 3GSLA 4R2ZA 3ZRTA 4JOFA 2QKTA 3KHFA 5B42A 3HVQC 2R3YA 3I4WA 3O46A 1N99A 2JSNA 4KFWA 2AWWA 2K1ZA 2KAWA 2OCSA 2W4FA 2G5MB 2DLUA 1UJDA 1WHAA 2EEGA 1N6DA 3TMHA 1WFVA 1Y7NA 4NMSA 1N7FA 5HFCA 1Q7XA 1U3BA 1N6FA 2REYA 2HGAA 3QIKA 3GJ9A 2EJYA 2KV8A 4O06A 4NXRA 3GCNA 2FNEA 2JILA 4UU6A 2EGKA 1RGWA 1OBZA 2V1WA 2YUBA 1RZXA 2I4SA 1M5ZA 2CS5A 2EGOA 2KOJA 1W9EA 1GQ4A 2EDZA 2KA9A 2R4HA 2YUYA 1X45A 3GGEA 4WYTA 3KZDA 1VB7A 1Q3OA 1V62A 2ENOA 2QT5A 2LA8A 3NFLA 1UEWA 1OZIA 5E1YA 3SOEA 2E7KA 3QE1A 2DKRA 1N6EA 5HEYA 1FCFA 4K6YA 2Q9VA 4K72A 2V90A 5GNDA 3K1RA 3SHUA 1OBXA 3R0HA 4UU5A 2ZPLA 2ZPMA 1WI2A 1V6BA 1UM7A 2LC6A 3I1EA 2OQSA 1UHPA 1VCWA 2M0UA 2W7RA 5HFDA 2LUIA 2QBWA 2HE2A 2UZCA 5H3JA 3ID1A 1FC9A 1UM1A 5I7ZA 4GVCA 2Z17A 3WKMA 2M3MA 3ID4A 5HF1A 3NCVA 1R6JA 2PNTA 4FGMA 2Z9IA 1MFLA 4JOEA 2FCFA 3CBXA 2F5YA 1X5NA 3MH6A 1UEPA 1UJVA 1U38A 3RLEA 2GEFA 2G2LA 5HFBA 1I16A 1TP5A 2KPLA 3LNXA 3LNYA 2O2TA 3R69A 1UJUA 1W9OA 3DJ3A 3EGGC 3TSWA 3HPMA 2JIKA 2H3MA 4JORA 4IC6A 4NMPA 1X5QA 1MFGA 2QKVA 2YT8A 2DAZA 2I6VA 1U37A 3HPKA 1X6DA 2HE4A 1L6OA 5DTHA 3NFKA 2EXGA 2L97A 2I1NA 2EDVA 1UEZA 2M0VA 1KEFA 3GDSA 1UEQA 2QG1A 5ILBA 1WF7A 2KPKA 2M0TA 4OAJA 4NMQA 3BPUA 4P0CA 2KQFA 2EEJA 5G1DA 4NXQA 4GVDA 3AXAA 2P3WA 1PDRA 3TSVA 3CBYA 3GABA 2IWNA 1QAVB 4Q2QA 1RGRA 2AWUA 2VPHA 2OZFA 2DMZA 4EDJA 2OPGA 1P1DA 3VQFA 4NXPA 1IU2A 3PS4A 3PDVA 2QKUA 2M10A 3PV5A 1VAEA 3R68A 2I0LA 4NNMA 1XZ9A 1FC7A 2KJPA 2MX6A 2Q3GA 2KBSA 1WG6A 2AWXA 2FN5A 1QAVA 4H11A 4E34A 1BE9A 2X7ZA 2M0ZA 1IU0A 1W9QA 1WH1A 3STJA 2EAQA 4NMVA 1QAUA 1V5QA 4NMTA 2IWPA 4Q6HA 4OEPA 5GLJA 3FY5A 2JREA 4AMHA 2IWQA 3EGHC 2DLSA 2RCZA 4G69A 2H2CA 4LMMA 4E35A 2LOBA 3QDOA 5E11A 2AINA 1TQ3A 2JOAA 1WI4A 2PKUA 2L4SA 4K75A 1Z86A 2JWEA 4NMOA 2DC2A 2DB5A 3CH8A 2CSSA 2RRMA 3VQGA 4JL7A 3ID3A 5FHTA 4PQWA 3KDKA 5FB8C 4Q3HA 3K50A 3WKLA 3O5NA 1K32A 5HJ1A 5HEDA 3L4FD 2PDZA 1BFEA 2VZ5A 2K20A 1WFGA 1T2MA 3QJNA 4KFVA 2LC7A 4NNLA 1LCYA 3OTPA 5HETA 1N7TA 2D92A 1X9ZA 3JXTA 3GDVA 4Q6SA 1X5RA 5JXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ5 A;  2I04 A;  2YTW A;  3PV4 A;  3NGH A;  3SUZ A;  4Z33 A;  1NF3 C;  1B8Q A;  1KWA A;  1WJL A;  2KRG A;  4OEO A;  4HOP B;  4XHV A;  1IHJ A;  3GDU A;  1WHD A;  4N6X A;  2GZV A;  3GCO A;  4K78 A;  4P2A B;  3I18 A;  4E3B A;  3ID2 A;  4REY A;  1N7E A;  3MH4 A;  3CS0 A;  2EHR A;  2EGN A;  1X8S A;  5E21 A;  1G9O A;  4MPA A;  4YDP A;  4JOP A;  2KL1 A;  1YBO A;  5F3X A;  1NTE A;  2IWO A;  1OBY A;  5F67 A;  4HOP A;  2KJK A;  4Q2O A;  3B76 A;  2D90 A;  1P1E A;  2VSV A;  4JOK A;  2CSJ A;  4YYX A;  1GM1 A;  2DJT A;  3K82 A;  4F8K A;  2F0A A;  1VJ6 A;  1Q3P A;  2D8I A;  1V1T A;  5E6P B;  4Z8J A;  3RL7 A;  3DIW A;  2KJD A;  2EV8 A;  2WL7 A;  4Q2P A;  1Z87 A;  1KY9 A;  2I0I A;  2H2B A;  1I92 A;  2JXO A;  3TSZ A;  3KZE A;  4Q2N A;  2BYG A;  3OU0 A;  3PDZ A;  1QLC A;  1WIF A;  2EEI A;  3CBZ A;  5G1E A;  3E17 A;  2JIN A;  1U39 A;  2OGP A;  5HDY A;  1UFX A;  2PA1 A;  5HEB A;  5A2P A;  3CYY A;  2KG2 A;  5HFE A;  1V5L A;  1ZUB A;  3PV2 A;  3SHW A;  4L8N A;  2OSG A;  5HF4 A;  2KOH A;  2PKT A;  1Y8T A;  2KYL A;  2VRF A;  1SOZ A;  3SFJ A;  1UF1 A;  4NMR A;  1TP3 A;  2H3L A;  5E22 A;  3RL8 A;  2DM8 A;  2EEH A;  3DJ1 A;  4JOJ A;  2OS6 A;  1ZOK A;  2L4T A;  2VSP A;  4WYU A;  1WF8 A;  5HFF A;  3DOR A;  1UIT A;  3QGL A;  2PZD A;  1TE0 A;  5D13 A;  2KOM A;  3QO6 A;  5EYZ A;  2EDP A;  5B6L A;  2MHO A;  1RY4 A;  3CC0 A;  3MH7 A;  4K76 A;  4JOG A;  4GHN A;  4RI0 A;  1VA8 A;  1SOT A;  2VWR A;  1D5G A;  5EZ0 A;  2FE5 A;  3DJA A;  1MC7 A;  2OMJ A;  4JOH A;  1FC6 A;  2YT7 A;  3QJM A;  3GSL A;  4R2Z A;  3ZRT A;  4JOF A;  2QKT A;  3KHF A;  3HVQ C;  2R3Y A;  3I4W A;  3O46 A;  1N99 A;  4KFW A;  2AWW A;  2K1Z A;  2KAW A;  2OCS A;  2W4F A;  2G5M B;  2DLU A;  1UJD A;  1WHA A;  2EEG A;  1N6D A;  3TMH A;  1WFV A;  1Y7N A;  4NMS A;  1N7F A;  5HFC A;  1Q7X A;  1U3B A;  1N6F A;  2REY A;  2HGA A;  3QIK A;  3GJ9 A;  2EJY A;  2KV8 A;  4O06 A;  4NXR A;  3GCN A;  2FNE A;  2JIL A;  4UU6 A;  2EGK A;  1RGW A;  1OBZ A;  2V1W A;  2YUB A;  1RZX A;  2I4S A;  1M5Z A;  2CS5 A;  2EGO A;  2KOJ A;  1W9E A;  1GQ4 A;  2EDZ A;  2KA9 A;  2R4H A;  2YUY A;  1X45 A;  3GGE A;  4WYT A;  3KZD A;  1VB7 A;  1Q3O A;  1V62 A;  2ENO A;  2QT5 A;  2LA8 A;  3NFL A;  1UEW A;  1OZI A;  5E1Y A;  3SOE A;  2E7K A;  3QE1 A;  2DKR A;  1N6E A;  5HEY A;  1FCF A;  4K6Y A;  2Q9V A;  4K72 A;  2V90 A;  5GND A;  3K1R A;  3SHU A;  1OBX A;  3R0H A;  4UU5 A;  2ZPL A;  2ZPM A;  1WI2 A;  1V6B A;  1UM7 A;  2LC6 A;  3I1E A;  2OQS A;  1UHP A;  1VCW A;  2M0U A;  2W7R A;  5HFD A;  2LUI A;  2QBW A;  2HE2 A;  2UZC A;  5H3J A;  3ID1 A;  1FC9 A;  1UM1 A;  5I7Z A;  4GVC A;  2Z17 A;  3WKM A;  2M3M A;  3ID4 A;  5HF1 A;  1R6J A;  2PNT A;  4FGM A;  2Z9I A;  1MFL A;  4JOE A;  2FCF A;  3CBX A;  2F5Y A;  1X5N A;  3MH6 A;  1UEP A;  1UJV A;  1U38 A;  3RLE A;  1I16 A;  2G2L A;  5HFB A;  1TP5 A;  2KPL A;  3LNX A;  3LNY A;  2O2T A;  3R69 A;  1UJU A;  1W9O A;  3DJ3 A;  3EGG C;  3TSW A;  3HPM A;  2JIK A;  2H3M A;  4JOR A;  4IC6 A;  4NMP A;  1X5Q A;  1MFG A;  2QKV A;  2YT8 A;  2DAZ A;  2I6V A;  1U37 A;  3HPK A;  1X6D A;  2HE4 A;  1L6O A;  5DTH A;  3NFK A;  2EXG A;  2L97 A;  2I1N A;  2EDV A;  1UEZ A;  2M0V A;  1KEF A;  3GDS A;  1UEQ A;  2QG1 A;  1WF7 A;  2KPK A;  2M0T A;  4OAJ A;  4NMQ A;  3BPU A;  4P0C A;  2KQF A;  2EEJ A;  5G1D A;  4NXQ A;  4GVD A;  3AXA A;  2P3W A;  1PDR A;  3TSV A;  3CBY A;  2IWN A;  1QAV B;  4Q2Q A;  1RGR A;  2AWU A;  2VPH A;  2OZF A;  2DMZ A;  4EDJ A;  2OPG A;  1P1D A;  3VQF A;  4NXP A;  1IU2 A;  3PS4 A;  3PDV A;  2QKU A;  2M10 A;  3PV5 A;  1VAE A;  3R68 A;  2I0L A;  4NNM A;  1XZ9 A;  1FC7 A;  2KJP A;  2MX6 A;  2Q3G A;  2KBS A;  1WG6 A;  2AWX A;  2FN5 A;  1QAV A;  4H11 A;  4E34 A;  1BE9 A;  2X7Z A;  2M0Z A;  1IU0 A;  1W9Q A;  1WH1 A;  3STJ A;  2EAQ A;  4NMV A;  1QAU A;  1V5Q A;  4NMT A;  2IWP A;  4Q6H A;  4OEP A;  5GLJ A;  3FY5 A;  2JRE A;  4AMH A;  2IWQ A;  3EGH C;  2DLS A;  2RCZ A;  4G69 A;  2H2C A;  4LMM A;  4E35 A;  2LOB A;  3QDO A;  5E11 A;  2AIN A;  1TQ3 A;  2JOA A;  1WI4 A;  2PKU A;  2L4S A;  4K75 A;  1Z86 A;  2JWE A;  4NMO A;  2DC2 A;  2DB5 A;  3CH8 A;  2CSS A;  2RRM A;  3VQG A;  4JL7 A;  3ID3 A;  5FHT A;  4PQW A;  5FB8 C;  4Q3H A;  3K50 A;  3WKL A;  3O5N A;  1K32 A;  5HJ1 A;  5HED A;  3L4F D;  2PDZ A;  1BFE A;  2VZ5 A;  2K20 A;  1WFG A;  1T2M A;  3QJN A;  4KFV A;  2LC7 A;  4NNL A;  1LCY A;  3OTP A;  5HET A;  1N7T A;  2D92 A;  3JXT A;  3GDV A;  4Q6S A;  1X5R A;  5JXB A; 
#chains in the Genus database with same CATH topology
 1GQ5 A;  2I04 A;  2YTW A;  3PV4 A;  3NGH A;  3SUZ A;  4Z33 A;  1NF3 C;  1B8Q A;  1KWA A;  1WJL A;  2KRG A;  4OEO A;  4HOP B;  4XHV A;  1IHJ A;  3GDU A;  1WHD A;  4N6X A;  2GZV A;  3GCO A;  4K78 A;  4P2A B;  3I18 A;  4E3B A;  3ID2 A;  4REY A;  1N7E A;  3MH4 A;  3CS0 A;  2EHR A;  2EGN A;  1X8S A;  5E21 A;  1G9O A;  4MPA A;  4YDP A;  4JOP A;  2KL1 A;  1YBO A;  5F3X A;  1NTE A;  2IWO A;  1OBY A;  5F67 A;  4HOP A;  2KJK A;  4Q2O A;  3B76 A;  2D90 A;  1P1E A;  2VSV A;  4JOK A;  2CSJ A;  4YYX A;  1GM1 A;  2DJT A;  3K82 A;  4F8K A;  2F0A A;  1VJ6 A;  1Q3P A;  2D8I A;  1V1T A;  5E6P B;  4Z8J A;  3RL7 A;  3DIW A;  2KJD A;  2EV8 A;  2WL7 A;  4Q2P A;  1Z87 A;  1KY9 A;  2I0I A;  2H2B A;  1I92 A;  4FLN A;  2JXO A;  3TSZ A;  3KZE A;  4Q2N A;  5IL9 A;  2BYG A;  3OU0 A;  3PDZ A;  1QLC A;  1WIF A;  2EEI A;  3CBZ A;  5G1E A;  3E17 A;  2JIN A;  1U39 A;  2OGP A;  5HDY A;  1UFX A;  2PA1 A;  5HEB A;  5A2P A;  3CYY A;  2KG2 A;  5HFE A;  1V5L A;  1ZUB A;  3PV2 A;  3SHW A;  4L8N A;  2OSG A;  5HF4 A;  2KOH A;  2PKT A;  1Y8T A;  2KYL A;  2VRF A;  1SOZ A;  3SFJ A;  1UF1 A;  4NMR A;  1TP3 A;  2H3L A;  5E22 A;  3RL8 A;  2DM8 A;  2EEH A;  3DJ1 A;  4JOJ A;  2OS6 A;  1ZOK A;  2L4T A;  2VSP A;  4WYU A;  1WF8 A;  5HFF A;  3DOR A;  1UIT A;  3QGL A;  2PZD A;  3KDG A;  1TE0 A;  4JJ0 A;  5D13 A;  2KOM A;  3QO6 A;  5EYZ A;  2EDP A;  4JJ3 A;  5B6L A;  2MHO A;  1RY4 A;  3CC0 A;  3MH7 A;  4K76 A;  4JOG A;  4GHN A;  4RI0 A;  1VA8 A;  1SOT A;  2VWR A;  1D5G A;  5EZ0 A;  2FE5 A;  3DJA A;  1MC7 A;  2OMJ A;  4JOH A;  1FC6 A;  2YT7 A;  3QJM A;  3GSL A;  4R2Z A;  3ZRT A;  4JOF A;  2QKT A;  3KHF A;  5B42 A;  3HVQ C;  2R3Y A;  3I4W A;  3O46 A;  1N99 A;  2JSN A;  4KFW A;  2AWW A;  2K1Z A;  2KAW A;  2OCS A;  2W4F A;  2G5M B;  2DLU A;  1UJD A;  1WHA A;  2EEG A;  1N6D A;  3TMH A;  1WFV A;  1Y7N A;  4NMS A;  1N7F A;  5HFC A;  1Q7X A;  1U3B A;  1N6F A;  2REY A;  2HGA A;  3QIK A;  3GJ9 A;  2EJY A;  2KV8 A;  4O06 A;  4NXR A;  3GCN A;  2FNE A;  2JIL A;  4UU6 A;  2EGK A;  1RGW A;  1OBZ A;  2V1W A;  2YUB A;  1RZX A;  2I4S A;  1M5Z A;  2CS5 A;  2EGO A;  2KOJ A;  1W9E A;  1GQ4 A;  2EDZ A;  2KA9 A;  2R4H A;  2YUY A;  1X45 A;  3GGE A;  4WYT A;  3KZD A;  1VB7 A;  1Q3O A;  1V62 A;  2ENO A;  2QT5 A;  2LA8 A;  3NFL A;  1UEW A;  1OZI A;  5E1Y A;  3SOE A;  2E7K A;  3QE1 A;  2DKR A;  1N6E A;  5HEY A;  1FCF A;  4K6Y A;  2Q9V A;  4K72 A;  2V90 A;  5GND A;  3K1R A;  3SHU A;  1OBX A;  3R0H A;  4UU5 A;  2ZPL A;  2ZPM A;  1WI2 A;  1V6B A;  1UM7 A;  2LC6 A;  3I1E A;  2OQS A;  1UHP A;  1VCW A;  2M0U A;  2W7R A;  5HFD A;  2LUI A;  2QBW A;  2HE2 A;  2UZC A;  5H3J A;  3ID1 A;  1FC9 A;  1UM1 A;  5I7Z A;  4GVC A;  2Z17 A;  3WKM A;  2M3M A;  3ID4 A;  5HF1 A;  3NCV A;  1R6J A;  2PNT A;  4FGM A;  2Z9I A;  1MFL A;  4JOE A;  2FCF A;  3CBX A;  2F5Y A;  1X5N A;  3MH6 A;  1UEP A;  1UJV A;  1U38 A;  3RLE A;  2GEF A;  2G2L A;  5HFB A;  1I16 A;  1TP5 A;  2KPL A;  3LNX A;  3LNY A;  2O2T A;  3R69 A;  1UJU A;  1W9O A;  3DJ3 A;  3EGG C;  3TSW A;  3HPM A;  2JIK A;  2H3M A;  4JOR A;  4IC6 A;  4NMP A;  1X5Q A;  1MFG A;  2QKV A;  2YT8 A;  2DAZ A;  2I6V A;  1U37 A;  3HPK A;  1X6D A;  2HE4 A;  1L6O A;  5DTH A;  3NFK A;  2EXG A;  2L97 A;  2I1N A;  2EDV A;  1UEZ A;  2M0V A;  1KEF A;  3GDS A;  1UEQ A;  2QG1 A;  5ILB A;  1WF7 A;  2KPK A;  2M0T A;  4OAJ A;  4NMQ A;  3BPU A;  4P0C A;  2KQF A;  2EEJ A;  5G1D A;  4NXQ A;  4GVD A;  3AXA A;  2P3W A;  1PDR A;  3TSV A;  3CBY A;  3GAB A;  2IWN A;  1QAV B;  4Q2Q A;  1RGR A;  2AWU A;  2VPH A;  2OZF A;  2DMZ A;  4EDJ A;  2OPG A;  1P1D A;  3VQF A;  4NXP A;  1IU2 A;  3PS4 A;  3PDV A;  2QKU A;  2M10 A;  3PV5 A;  1VAE A;  3R68 A;  2I0L A;  4NNM A;  1XZ9 A;  1FC7 A;  2KJP A;  2MX6 A;  2Q3G A;  2KBS A;  1WG6 A;  2AWX A;  2FN5 A;  1QAV A;  4H11 A;  4E34 A;  1BE9 A;  2X7Z A;  2M0Z A;  1IU0 A;  1W9Q A;  1WH1 A;  3STJ A;  2EAQ A;  4NMV A;  1QAU A;  1V5Q A;  4NMT A;  2IWP A;  4Q6H A;  4OEP A;  5GLJ A;  3FY5 A;  2JRE A;  4AMH A;  2IWQ A;  3EGH C;  2DLS A;  2RCZ A;  4G69 A;  2H2C A;  4LMM A;  4E35 A;  2LOB A;  3QDO A;  5E11 A;  2AIN A;  1TQ3 A;  2JOA A;  1WI4 A;  2PKU A;  2L4S A;  4K75 A;  1Z86 A;  2JWE A;  4NMO A;  2DC2 A;  2DB5 A;  3CH8 A;  2CSS A;  2RRM A;  3VQG A;  4JL7 A;  3ID3 A;  5FHT A;  4PQW A;  3KDK A;  5FB8 C;  4Q3H A;  3K50 A;  3WKL A;  3O5N A;  1K32 A;  5HJ1 A;  5HED A;  3L4F D;  2PDZ A;  1BFE A;  2VZ5 A;  2K20 A;  1WFG A;  1T2M A;  3QJN A;  4KFV A;  2LC7 A;  4NNL A;  1LCY A;  3OTP A;  5HET A;  1N7T A;  2D92 A;  1X9Z A;  3JXT A;  3GDV A;  4Q6S A;  1X5R A;  5JXB A; 
#chains in the Genus database with same CATH homology
 1GQ5 A;  2I04 A;  2YTW A;  3PV4 A;  3NGH A;  3SUZ A;  4Z33 A;  1NF3 C;  1B8Q A;  1KWA A;  1WJL A;  2KRG A;  4OEO A;  4HOP B;  4XHV A;  1IHJ A;  3GDU A;  1WHD A;  4N6X A;  2GZV A;  3GCO A;  4K78 A;  4P2A B;  3I18 A;  4E3B A;  3ID2 A;  4REY A;  1N7E A;  3MH4 A;  3CS0 A;  2EHR A;  2EGN A;  1X8S A;  5E21 A;  1G9O A;  4MPA A;  4YDP A;  4JOP A;  2KL1 A;  1YBO A;  5F3X A;  1NTE A;  2IWO A;  1OBY A;  5F67 A;  4HOP A;  2KJK A;  4Q2O A;  3B76 A;  2D90 A;  1P1E A;  2VSV A;  4JOK A;  2CSJ A;  4YYX A;  1GM1 A;  2DJT A;  3K82 A;  4F8K A;  2F0A A;  1VJ6 A;  1Q3P A;  2D8I A;  1V1T A;  5E6P B;  4Z8J A;  3RL7 A;  3DIW A;  2KJD A;  2EV8 A;  2WL7 A;  4Q2P A;  1Z87 A;  1KY9 A;  2I0I A;  2H2B A;  1I92 A;  4FLN A;  2JXO A;  3TSZ A;  3KZE A;  4Q2N A;  5IL9 A;  2BYG A;  3OU0 A;  3PDZ A;  1QLC A;  1WIF A;  2EEI A;  3CBZ A;  5G1E A;  3E17 A;  2JIN A;  1U39 A;  2OGP A;  5HDY A;  1UFX A;  2PA1 A;  5HEB A;  5A2P A;  3CYY A;  2KG2 A;  5HFE A;  1V5L A;  1ZUB A;  3PV2 A;  3SHW A;  4L8N A;  2OSG A;  5HF4 A;  2KOH A;  2PKT A;  1Y8T A;  2KYL A;  2VRF A;  1SOZ A;  3SFJ A;  1UF1 A;  4NMR A;  1TP3 A;  2H3L A;  5E22 A;  3RL8 A;  2DM8 A;  2EEH A;  3DJ1 A;  4JOJ A;  2OS6 A;  1ZOK A;  2L4T A;  2VSP A;  4WYU A;  1WF8 A;  5HFF A;  3DOR A;  1UIT A;  3QGL A;  2PZD A;  3KDG A;  1TE0 A;  4JJ0 A;  5D13 A;  2KOM A;  3QO6 A;  5EYZ A;  2EDP A;  4JJ3 A;  5B6L A;  2MHO A;  1RY4 A;  3CC0 A;  3MH7 A;  4K76 A;  4JOG A;  4GHN A;  4RI0 A;  1VA8 A;  1SOT A;  2VWR A;  1D5G A;  5EZ0 A;  2FE5 A;  3DJA A;  1MC7 A;  2OMJ A;  4JOH A;  1FC6 A;  2YT7 A;  3QJM A;  3GSL A;  4R2Z A;  3ZRT A;  4JOF A;  2QKT A;  3KHF A;  5B42 A;  3HVQ C;  2R3Y A;  3I4W A;  3O46 A;  1N99 A;  2JSN A;  4KFW A;  2AWW A;  2K1Z A;  2KAW A;  2OCS A;  2W4F A;  2G5M B;  2DLU A;  1UJD A;  1WHA A;  2EEG A;  1N6D A;  3TMH A;  1WFV A;  1Y7N A;  4NMS A;  1N7F A;  5HFC A;  1Q7X A;  1U3B A;  1N6F A;  2REY A;  2HGA A;  3QIK A;  3GJ9 A;  2EJY A;  2KV8 A;  4O06 A;  4NXR A;  3GCN A;  2FNE A;  2JIL A;  4UU6 A;  2EGK A;  1RGW A;  1OBZ A;  2V1W A;  2YUB A;  1RZX A;  2I4S A;  1M5Z A;  2CS5 A;  2EGO A;  2KOJ A;  1W9E A;  1GQ4 A;  2EDZ A;  2KA9 A;  2R4H A;  2YUY A;  1X45 A;  3GGE A;  4WYT A;  3KZD A;  1VB7 A;  1Q3O A;  1V62 A;  2ENO A;  2QT5 A;  2LA8 A;  3NFL A;  1UEW A;  1OZI A;  5E1Y A;  3SOE A;  2E7K A;  3QE1 A;  2DKR A;  1N6E A;  5HEY A;  1FCF A;  4K6Y A;  2Q9V A;  4K72 A;  2V90 A;  5GND A;  3K1R A;  3SHU A;  1OBX A;  3R0H A;  4UU5 A;  2ZPL A;  2ZPM A;  1WI2 A;  1V6B A;  1UM7 A;  2LC6 A;  3I1E A;  2OQS A;  1UHP A;  1VCW A;  2M0U A;  2W7R A;  5HFD A;  2LUI A;  2QBW A;  2HE2 A;  2UZC A;  5H3J A;  3ID1 A;  1FC9 A;  1UM1 A;  5I7Z A;  4GVC A;  2Z17 A;  3WKM A;  2M3M A;  3ID4 A;  5HF1 A;  3NCV A;  1R6J A;  2PNT A;  4FGM A;  2Z9I A;  1MFL A;  4JOE A;  2FCF A;  3CBX A;  2F5Y A;  1X5N A;  3MH6 A;  1UEP A;  1UJV A;  1U38 A;  3RLE A;  2GEF A;  2G2L A;  5HFB A;  1I16 A;  1TP5 A;  2KPL A;  3LNX A;  3LNY A;  2O2T A;  3R69 A;  1UJU A;  1W9O A;  3DJ3 A;  3EGG C;  3TSW A;  3HPM A;  2JIK A;  2H3M A;  4JOR A;  4IC6 A;  4NMP A;  1X5Q A;  1MFG A;  2QKV A;  2YT8 A;  2DAZ A;  2I6V A;  1U37 A;  3HPK A;  1X6D A;  2HE4 A;  1L6O A;  5DTH A;  3NFK A;  2EXG A;  2L97 A;  2I1N A;  2EDV A;  1UEZ A;  2M0V A;  1KEF A;  3GDS A;  1UEQ A;  2QG1 A;  5ILB A;  1WF7 A;  2KPK A;  2M0T A;  4OAJ A;  4NMQ A;  3BPU A;  4P0C A;  2KQF A;  2EEJ A;  5G1D A;  4NXQ A;  4GVD A;  3AXA A;  2P3W A;  1PDR A;  3TSV A;  3CBY A;  3GAB A;  2IWN A;  1QAV B;  4Q2Q A;  1RGR A;  2AWU A;  2VPH A;  2OZF A;  2DMZ A;  4EDJ A;  2OPG A;  1P1D A;  3VQF A;  4NXP A;  1IU2 A;  3PS4 A;  3PDV A;  2QKU A;  2M10 A;  3PV5 A;  1VAE A;  3R68 A;  2I0L A;  4NNM A;  1XZ9 A;  1FC7 A;  2KJP A;  2MX6 A;  2Q3G A;  2KBS A;  1WG6 A;  2AWX A;  2FN5 A;  1QAV A;  4H11 A;  4E34 A;  1BE9 A;  2X7Z A;  2M0Z A;  1IU0 A;  1W9Q A;  1WH1 A;  3STJ A;  2EAQ A;  4NMV A;  1QAU A;  1V5Q A;  4NMT A;  2IWP A;  4Q6H A;  4OEP A;  5GLJ A;  3FY5 A;  2JRE A;  4AMH A;  2IWQ A;  3EGH C;  2DLS A;  2RCZ A;  4G69 A;  2H2C A;  4LMM A;  4E35 A;  2LOB A;  3QDO A;  5E11 A;  2AIN A;  1TQ3 A;  2JOA A;  1WI4 A;  2PKU A;  2L4S A;  4K75 A;  1Z86 A;  2JWE A;  4NMO A;  2DC2 A;  2DB5 A;  3CH8 A;  2CSS A;  2RRM A;  3VQG A;  4JL7 A;  3ID3 A;  5FHT A;  4PQW A;  3KDK A;  5FB8 C;  4Q3H A;  3K50 A;  3WKL A;  3O5N A;  1K32 A;  5HJ1 A;  5HED A;  3L4F D;  2PDZ A;  1BFE A;  2VZ5 A;  2K20 A;  1WFG A;  1T2M A;  3QJN A;  4KFV A;  2LC7 A;  4NNL A;  1LCY A;  3OTP A;  5HET A;  1N7T A;  2D92 A;  1X9Z A;  3JXT A;  3GDV A;  4Q6S A;  1X5R A;  5JXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...