1VJ6A

Pdz2 from ptp-bl in complex with the c-terminal ligand from the apc protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
b'MKPGDTFEVELAKTDGSLGISVTGGVNTSVRHGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein-tyrosine-phosphatase (nonreceptor type 13)
publication title Demonstration of long-range interactions in a PDZ domain by NMR, kinetics, and protein engineering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/signaling protein
total genus 15
structure length 95
sequence length 95
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1vj6A00
1UM1A 1XZ9A 1KWAA 1UEWA 1UJUA 1GQ5A 3O5NA 2JINA 3DJAA 2I6VA 1VAEA 1U3BA 4OEPA 1NF3C 2JREA 1R6JA 2AWWA 3KHFA 3EGGC 5E6PB 1TP5A 3GCNA 3HVQC 5HFCA 1KEFA 4NXQA 1T2MA 2EHRA 5FB8C 2H2BA 2I0IA 1RGWA 4NMRA 2FE5A 2KRGA 3ID1A 3R69A 3VQGA 4FGMA 1IHJA 1VCWA 3QO6A 4K72A 2EV8A 1BE9A 2OZFA 4EDJA 5HDYA 1WH1A 3LNYA 1UITA 2KOMA 4E34A 1WHAA 5F67A 1LCYA 4K78A 4UU5A 1RGRA 2QG1A 2AWXA 1OBZA 4Q2QA 4K75A 2G2LA 2EDVA 3SHWA 4MPAA 3GCOA 2UZCA 4P0CA 2EEHA 4YDPA 3FY5A 2KJPA 2KL1A 3BPUA 2YT8A 2LA8A 2EDPA 2DAZA 4Q6HA 2I04A 4OEOA 3WKMA 2EXGA 2VPHA 2KJDA 2L4SA 5HFFA 3PV4A 2F5YA 1N7TA 3SUZA 1W9EA 2KAWA 2DM8A 5GLJA 5A2PA 1TE0A 2F0AA 2PZDA 4JOEA 2DJTA 5HJ1A 1MFGA 2O2TA 2P3WA 1WG6A 2R3YA 5H3JA 1QAVA 4HOPB 3QIKA 1PDRA 2YUYA 2JOAA 4NNMA 2QBWA 2PDZA 4NXPA 3GJ9A 2V90A 1P1EA 1W9OA 2L4TA 1N6EA 2QKVA 1WF7A 2ENOA 1Z86A 3KZEA 1NTEA 1OZIA 2EEJA 1X5RA 5D13A 4WYTA 1K32A 2AWUA 4UU6A 2YTWA 2QKTA 1Q3OA 1W9QA 2OSGA 3STJA 3QE1A 5HF1A 3DIWA 4Q2PA 4P2AB 1ZOKA 2ZPLA 1MC7A 2X7ZA 3ID4A 1X6DA 2Q3GA 2FCFA 3E17A 4GHNA 4JORA 2EGNA 4JOHA 2W7RA 1FC7A 2KBSA 1UJVA 1BFEA 4K76A 2MX6A 3HPKA 2OCSA 3R68A 2KPKA 3HPMA 2YT7A 2EEGA 3DJ3A 2M0UA 2HE2A 1UHPA 2R4HA 5F3XA 3ID2A 1GQ4A 2HE4A 1WHDA 1U38A 1V1TA 1I92A 2CSJA 4XHVA 2DLSA 2V1WA 4F8KA 1SOZA 3EGHC 4Q2OA 1V6BA 3MH6A 1FCFA 4NMQA 2FNEA 2PKTA 1UEQA 2KG2A 2PA1A 4GVCA 4O06A 3NGHA 3CBXA 2EEIA 3SHUA 2BYGA 3GDVA 5GNDA 4G69A 3CYYA 1U37A 1GM1A 2LOBA 5E22A 3RLEA 2CSSA 1WIFA 3O46A 1D5GA 4JOPA 4HOPA 1WFVA 2JILA 1U39A 3PV5A 2VZ5A 1FC9A 1N6FA 3R0HA 2M3MA 1VA8A 1N6DA 5B6LA 2I0LA 2M0VA 5HFDA 4Q2NA 4JL7A 3I1EA 2KQFA 1RY4A 1UF1A 2M0TA 2HGAA 2KYLA 2VSPA 1FC6A 1WJLA 4YYXA 1MFLA 1OBXA 2M10A 4E35A 1N7EA 5HFBA 1V62A 2JXOA 2KA9A 3PV2A 3QJNA 1M5ZA 3VQFA 3OTPA 4REYA 4PQWA 4Z8JA 2G5MB 3NFKA 2D8IA 1RZXA 3NFLA 1X8SA 2MHOA 4WYUA 3B76A 3AXAA 3GDUA 2H3LA 3I18A 3ID3A 2QT5A 5G1EA 1UJDA 5EZ0A 2E7KA 2AINA 3ZRTA 1Z87A 2KOHA 5HEBA 3I4WA 1I16A 4R2ZA 5E1YA 2EGOA 2H3MA 3PS4A 2LC7A 2JWEA 4Z33A 3WKLA 5E11A 2EGKA 2KOJA 1UM7A 4Q3HA 4GVDA 2LC6A 1ZUBA 3MH4A 2CS5A 1QAUA 2OS6A 2IWPA 2EJYA 2IWOA 4IC6A 3SOEA 3TSVA 2VRFA 2RCZA 2EAQA 5I7ZA 4JOKA 2KV8A 3CH8A 2D90A 2K20A 2K1ZA 3CBZA 3LNXA 2M0ZA 4RI0A 4N6XA 3DJ1A 2VWRA 4NMVA 3RL8A 3PDVA 1UEPA 2IWNA 3DORA 2Z9IA 2W4FA 1X5QA 1Y7NA 2DKRA 1Q7XA 1B8QA 1WI4A 4NMOA 2KJKA 4NXRA 1WI2A 4NMPA 1VB7A 1OBYA 2PNTA 1N7FA 1N99A 5HF4A 3TSZA 1IU0A 4Q6SA 5HEYA 3GGEA 4H11A 3TMHA 2QKUA 2Z17A 4NMSA 2YUBA 4JOFA 3KZDA 5HFEA 4L8NA 2LUIA 2OQSA 3QGLA 1P1DA 1V5QA 4AMHA 1UFXA 2OGPA 2JIKA 1Q3PA 3RL7A 3PDZA 3CC0A 1TP3A 1YBOA 3JXTA 2DC2A 3GDSA 1WF8A 2OMJA 4K6YA 3QJMA 2GZVA 2VSVA 2WL7A 4LMMA 2DLUA 3OU0A 3TSWA 4JOJA 5EYZA 5G1DA 2L97A 1QLCA 1SOTA 4KFWA 2KPLA 5E21A 3L4FD 5JXBA 1IU2A 5HETA 3MH7A 3K1RA 1QAVB 2D92A 2FN5A 5FHTA 3CBYA 2DB5A 2EDZA 1UEZA 3SFJA 4NNLA 3K50A 4OAJA 1V5LA 3K82A 2REYA 2OPGA 4JOGA 2H2CA 5HEDA 1KY9A 2IWQA 1TQ3A 1G9OA 3QDOA 4NMTA 5DTHA 1L6OA 1X5NA 2PKUA 2Q9VA 1VJ6A 4KFVA 2ZPMA 4E3BA 3GSLA 2RRMA 2I1NA 2DMZA 1Y8TA 3CS0A 1WFGA 1X45A 2I4SA
chains in the Genus database with same CATH superfamily
1UM1A 1XZ9A 1KWAA 1UEWA 1UJUA 1GQ5A 3O5NA 2JINA 3DJAA 2I6VA 1VAEA 1U3BA 4OEPA 1NF3C 2JREA 1R6JA 2AWWA 3NCVA 3KHFA 3EGGC 5E6PB 1TP5A 3GCNA 3HVQC 5HFCA 1KEFA 4NXQA 1T2MA 2EHRA 5FB8C 2H2BA 2I0IA 1RGWA 4NMRA 2FE5A 2KRGA 3ID1A 3R69A 3VQGA 4FGMA 1IHJA 1VCWA 3QO6A 4K72A 2EV8A 1BE9A 2OZFA 4EDJA 5HDYA 1WH1A 3LNYA 1UITA 2KOMA 4E34A 1WHAA 5F67A 1LCYA 4K78A 4UU5A 1RGRA 2QG1A 2AWXA 1OBZA 4Q2QA 4K75A 2G2LA 2EDVA 3SHWA 4MPAA 3GCOA 2UZCA 4P0CA 2EEHA 4YDPA 3FY5A 2KJPA 2KL1A 3BPUA 2YT8A 2LA8A 2EDPA 2DAZA 4Q6HA 2I04A 4OEOA 3WKMA 2EXGA 2VPHA 2KJDA 2L4SA 5HFFA 3PV4A 2F5YA 1N7TA 3SUZA 1W9EA 2KAWA 3KDGA 2DM8A 5GLJA 5A2PA 1TE0A 2F0AA 2PZDA 4JJ3A 4JOEA 2DJTA 5HJ1A 1MFGA 2O2TA 2P3WA 1WG6A 2R3YA 5H3JA 1QAVA 4HOPB 3QIKA 1PDRA 2YUYA 2JOAA 4NNMA 2QBWA 2PDZA 4NXPA 3GJ9A 2V90A 1P1EA 1W9OA 2L4TA 1N6EA 2QKVA 1WF7A 2ENOA 1Z86A 3KZEA 1NTEA 1OZIA 2EEJA 1X5RA 5D13A 5IL9A 4WYTA 1K32A 2AWUA 4UU6A 2YTWA 2QKTA 1Q3OA 1W9QA 2OSGA 3GABA 3STJA 3QE1A 5HF1A 3DIWA 4Q2PA 4P2AB 1ZOKA 2ZPLA 1MC7A 2X7ZA 3ID4A 1X6DA 2Q3GA 1X9ZA 2FCFA 3E17A 4GHNA 4JORA 2EGNA 4JOHA 2W7RA 1FC7A 4FLNA 2KBSA 1UJVA 1BFEA 4K76A 2MX6A 3HPKA 2OCSA 3R68A 2KPKA 3HPMA 2YT7A 2EEGA 3DJ3A 2M0UA 2HE2A 1UHPA 2R4HA 5F3XA 3ID2A 1GQ4A 2HE4A 1WHDA 3KDKA 1U38A 1V1TA 1I92A 2JSNA 2CSJA 4XHVA 2DLSA 2V1WA 4F8KA 1SOZA 3EGHC 4Q2OA 1V6BA 3MH6A 1FCFA 4NMQA 2FNEA 2PKTA 1UEQA 2KG2A 2PA1A 4GVCA 4O06A 3NGHA 3CBXA 2EEIA 3SHUA 2BYGA 3GDVA 5GNDA 4G69A 3CYYA 1U37A 1GM1A 2LOBA 5E22A 3RLEA 2CSSA 1WIFA 3O46A 1D5GA 4JOPA 4HOPA 1WFVA 2JILA 1U39A 3PV5A 2VZ5A 1FC9A 1N6FA 3R0HA 2M3MA 1VA8A 1N6DA 5B6LA 2I0LA 2M0VA 5HFDA 4Q2NA 4JL7A 3I1EA 2KQFA 1RY4A 1UF1A 2M0TA 2HGAA 2KYLA 2VSPA 1FC6A 1WJLA 4YYXA 1MFLA 1OBXA 2M10A 4E35A 1N7EA 5HFBA 1V62A 2JXOA 2KA9A 3PV2A 3QJNA 1M5ZA 3VQFA 3OTPA 4REYA 4PQWA 4Z8JA 2G5MB 3NFKA 2D8IA 1RZXA 3NFLA 1X8SA 2MHOA 4WYUA 3B76A 3AXAA 3GDUA 2H3LA 3I18A 3ID3A 2QT5A 5G1EA 1UJDA 5EZ0A 2E7KA 2AINA 3ZRTA 1Z87A 2KOHA 5HEBA 3I4WA 1I16A 4R2ZA 5E1YA 2EGOA 2H3MA 3PS4A 2LC7A 2JWEA 4Z33A 3WKLA 5E11A 2EGKA 2KOJA 1UM7A 4Q3HA 4GVDA 2LC6A 1ZUBA 3MH4A 2CS5A 1QAUA 2OS6A 2IWPA 2EJYA 2IWOA 4IC6A 3SOEA 3TSVA 2VRFA 2RCZA 2EAQA 5I7ZA 4JOKA 2KV8A 3CH8A 2D90A 2K20A 2K1ZA 3CBZA 3LNXA 2M0ZA 4RI0A 4N6XA 3DJ1A 2VWRA 4NMVA 3RL8A 3PDVA 1UEPA 2IWNA 3DORA 2Z9IA 2W4FA 1X5QA 1Y7NA 2DKRA 1Q7XA 1B8QA 1WI4A 4NMOA 2KJKA 4NXRA 1WI2A 4NMPA 1VB7A 1OBYA 2PNTA 1N7FA 1N99A 5HF4A 3TSZA 1IU0A 4Q6SA 5HEYA 2GEFA 3GGEA 4H11A 3TMHA 4JJ0A 2QKUA 2Z17A 4NMSA 2YUBA 5B42A 4JOFA 3KZDA 5HFEA 4L8NA 2LUIA 2OQSA 3QGLA 1P1DA 1V5QA 4AMHA 1UFXA 2OGPA 2JIKA 1Q3PA 3RL7A 3PDZA 5ILBA 3CC0A 1TP3A 1YBOA 3JXTA 2DC2A 3GDSA 1WF8A 2OMJA 4K6YA 3QJMA 2GZVA 2VSVA 2WL7A 4LMMA 2DLUA 3OU0A 3TSWA 4JOJA 5EYZA 5G1DA 2L97A 1QLCA 1SOTA 4KFWA 2KPLA 5E21A 3L4FD 5JXBA 1IU2A 5HETA 3MH7A 3K1RA 1QAVB 2D92A 2FN5A 5FHTA 3CBYA 2DB5A 2EDZA 1UEZA 3SFJA 4NNLA 3K50A 4OAJA 1V5LA 3K82A 2REYA 2OPGA 4JOGA 2H2CA 5HEDA 1KY9A 2IWQA 1TQ3A 1G9OA 3QDOA 4NMTA 5DTHA 1L6OA 1X5NA 2PKUA 2Q9VA 1VJ6A 4KFVA 2ZPMA 4E3BA 3GSLA 2RRMA 2I1NA 2DMZA 1Y8TA 3CS0A 1WFGA 1X45A 2I4SA
chains in the Genus database with same CATH topology
1UM1A 1XZ9A 1KWAA 1UEWA 1UJUA 1GQ5A 3O5NA 2JINA 3DJAA 2I6VA 1VAEA 1U3BA 4OEPA 1NF3C 2JREA 1R6JA 2AWWA 3NCVA 3KHFA 3EGGC 5E6PB 1TP5A 3GCNA 3HVQC 5HFCA 1KEFA 4NXQA 1T2MA 2EHRA 5FB8C 2H2BA 2I0IA 1RGWA 4NMRA 2FE5A 2KRGA 3ID1A 3R69A 3VQGA 4FGMA 1IHJA 1VCWA 3QO6A 4K72A 2EV8A 1BE9A 2OZFA 4EDJA 5HDYA 1WH1A 3LNYA 1UITA 2KOMA 4E34A 1WHAA 5F67A 1LCYA 4K78A 4UU5A 1RGRA 2QG1A 2AWXA 1OBZA 4Q2QA 4K75A 2G2LA 2EDVA 3SHWA 4MPAA 3GCOA 2UZCA 4P0CA 2EEHA 4YDPA 3FY5A 2KJPA 2KL1A 3BPUA 2YT8A 2LA8A 2EDPA 2DAZA 4Q6HA 2I04A 4OEOA 3WKMA 2EXGA 2VPHA 2KJDA 2L4SA 5HFFA 3PV4A 2F5YA 1N7TA 3SUZA 1W9EA 2KAWA 3KDGA 2DM8A 5GLJA 5A2PA 1TE0A 2F0AA 2PZDA 4JJ3A 4JOEA 2DJTA 5HJ1A 1MFGA 2O2TA 2P3WA 1WG6A 2R3YA 5H3JA 1QAVA 4HOPB 3QIKA 1PDRA 2YUYA 2JOAA 4NNMA 2QBWA 2PDZA 4NXPA 3GJ9A 2V90A 1P1EA 1W9OA 2L4TA 1N6EA 2QKVA 1WF7A 2ENOA 1Z86A 3KZEA 1NTEA 1OZIA 2EEJA 1X5RA 5D13A 5IL9A 4WYTA 1K32A 2AWUA 4UU6A 2YTWA 2QKTA 1Q3OA 1W9QA 2OSGA 3GABA 3STJA 3QE1A 5HF1A 3DIWA 4Q2PA 4P2AB 1ZOKA 2ZPLA 1MC7A 2X7ZA 3ID4A 1X6DA 2Q3GA 1X9ZA 2FCFA 3E17A 4GHNA 4JORA 2EGNA 4JOHA 2W7RA 1FC7A 4FLNA 2KBSA 1UJVA 1BFEA 4K76A 2MX6A 3HPKA 2OCSA 3R68A 2KPKA 3HPMA 2YT7A 2EEGA 3DJ3A 2M0UA 2HE2A 1UHPA 2R4HA 5F3XA 3ID2A 1GQ4A 2HE4A 1WHDA 3KDKA 1U38A 1V1TA 1I92A 2JSNA 2CSJA 4XHVA 2DLSA 2V1WA 4F8KA 1SOZA 3EGHC 4Q2OA 1V6BA 3MH6A 1FCFA 4NMQA 2FNEA 2PKTA 1UEQA 2KG2A 2PA1A 4GVCA 4O06A 3NGHA 3CBXA 2EEIA 3SHUA 2BYGA 3GDVA 5GNDA 4G69A 3CYYA 1U37A 1GM1A 2LOBA 5E22A 3RLEA 2CSSA 1WIFA 3O46A 1D5GA 4JOPA 4HOPA 1WFVA 2JILA 1U39A 3PV5A 2VZ5A 1FC9A 1N6FA 3R0HA 2M3MA 1VA8A 1N6DA 5B6LA 2I0LA 2M0VA 5HFDA 4Q2NA 4JL7A 3I1EA 2KQFA 1RY4A 1UF1A 2M0TA 2HGAA 2KYLA 2VSPA 1FC6A 1WJLA 4YYXA 1MFLA 1OBXA 2M10A 4E35A 1N7EA 5HFBA 1V62A 2JXOA 2KA9A 3PV2A 3QJNA 1M5ZA 3VQFA 3OTPA 4REYA 4PQWA 4Z8JA 2G5MB 3NFKA 2D8IA 1RZXA 3NFLA 1X8SA 2MHOA 4WYUA 3B76A 3AXAA 3GDUA 2H3LA 3I18A 3ID3A 2QT5A 5G1EA 1UJDA 5EZ0A 2E7KA 2AINA 3ZRTA 1Z87A 2KOHA 5HEBA 3I4WA 1I16A 4R2ZA 5E1YA 2EGOA 2H3MA 3PS4A 2LC7A 2JWEA 4Z33A 3WKLA 5E11A 2EGKA 2KOJA 1UM7A 4Q3HA 4GVDA 2LC6A 1ZUBA 3MH4A 2CS5A 1QAUA 2OS6A 2IWPA 2EJYA 2IWOA 4IC6A 3SOEA 3TSVA 2VRFA 2RCZA 2EAQA 5I7ZA 4JOKA 2KV8A 3CH8A 2D90A 2K20A 2K1ZA 3CBZA 3LNXA 2M0ZA 4RI0A 4N6XA 3DJ1A 2VWRA 4NMVA 3RL8A 3PDVA 1UEPA 2IWNA 3DORA 2Z9IA 2W4FA 1X5QA 1Y7NA 2DKRA 1Q7XA 1B8QA 1WI4A 4NMOA 2KJKA 4NXRA 1WI2A 4NMPA 1VB7A 1OBYA 2PNTA 1N7FA 1N99A 5HF4A 3TSZA 1IU0A 4Q6SA 5HEYA 2GEFA 3GGEA 4H11A 3TMHA 4JJ0A 2QKUA 2Z17A 4NMSA 2YUBA 5B42A 4JOFA 3KZDA 5HFEA 4L8NA 2LUIA 2OQSA 3QGLA 1P1DA 1V5QA 4AMHA 1UFXA 2OGPA 2JIKA 1Q3PA 3RL7A 3PDZA 5ILBA 3CC0A 1TP3A 1YBOA 3JXTA 2DC2A 3GDSA 1WF8A 2OMJA 4K6YA 3QJMA 2GZVA 2VSVA 2WL7A 4LMMA 2DLUA 3OU0A 3TSWA 4JOJA 5EYZA 5G1DA 2L97A 1QLCA 1SOTA 4KFWA 2KPLA 5E21A 3L4FD 5JXBA 1IU2A 5HETA 3MH7A 3K1RA 1QAVB 2D92A 2FN5A 5FHTA 3CBYA 2DB5A 2EDZA 1UEZA 3SFJA 4NNLA 3K50A 4OAJA 1V5LA 3K82A 2REYA 2OPGA 4JOGA 2H2CA 5HEDA 1KY9A 2IWQA 1TQ3A 1G9OA 3QDOA 4NMTA 5DTHA 1L6OA 1X5NA 2PKUA 2Q9VA 1VJ6A 4KFVA 2ZPMA 4E3BA 3GSLA 2RRMA 2I1NA 2DMZA 1Y8TA 3CS0A 1WFGA 1X45A 2I4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UM1 A;  1XZ9 A;  1KWA A;  1UEW A;  1UJU A;  1GQ5 A;  3O5N A;  2JIN A;  3DJA A;  2I6V A;  1VAE A;  1U3B A;  4OEP A;  1NF3 C;  2JRE A;  1R6J A;  2AWW A;  3KHF A;  3EGG C;  5E6P B;  1TP5 A;  3GCN A;  3HVQ C;  5HFC A;  1KEF A;  4NXQ A;  1T2M A;  2EHR A;  5FB8 C;  2H2B A;  2I0I A;  1RGW A;  4NMR A;  2FE5 A;  2KRG A;  3ID1 A;  3R69 A;  3VQG A;  4FGM A;  1IHJ A;  1VCW A;  3QO6 A;  4K72 A;  2EV8 A;  1BE9 A;  2OZF A;  4EDJ A;  5HDY A;  1WH1 A;  3LNY A;  1UIT A;  2KOM A;  4E34 A;  1WHA A;  5F67 A;  1LCY A;  4K78 A;  4UU5 A;  1RGR A;  2QG1 A;  2AWX A;  1OBZ A;  4Q2Q A;  4K75 A;  2G2L A;  2EDV A;  3SHW A;  4MPA A;  3GCO A;  2UZC A;  4P0C A;  2EEH A;  4YDP A;  3FY5 A;  2KJP A;  2KL1 A;  3BPU A;  2YT8 A;  2LA8 A;  2EDP A;  2DAZ A;  4Q6H A;  2I04 A;  4OEO A;  3WKM A;  2EXG A;  2VPH A;  2KJD A;  2L4S A;  5HFF A;  3PV4 A;  2F5Y A;  1N7T A;  3SUZ A;  1W9E A;  2KAW A;  2DM8 A;  5GLJ A;  5A2P A;  1TE0 A;  2F0A A;  2PZD A;  4JOE A;  2DJT A;  5HJ1 A;  1MFG A;  2O2T A;  2P3W A;  1WG6 A;  2R3Y A;  5H3J A;  1QAV A;  4HOP B;  3QIK A;  1PDR A;  2YUY A;  2JOA A;  4NNM A;  2QBW A;  2PDZ A;  4NXP A;  3GJ9 A;  2V90 A;  1P1E A;  1W9O A;  2L4T A;  1N6E A;  2QKV A;  1WF7 A;  2ENO A;  1Z86 A;  3KZE A;  1NTE A;  1OZI A;  2EEJ A;  1X5R A;  5D13 A;  4WYT A;  1K32 A;  2AWU A;  4UU6 A;  2YTW A;  2QKT A;  1Q3O A;  1W9Q A;  2OSG A;  3STJ A;  3QE1 A;  5HF1 A;  3DIW A;  4Q2P A;  4P2A B;  1ZOK A;  2ZPL A;  1MC7 A;  2X7Z A;  3ID4 A;  1X6D A;  2Q3G A;  2FCF A;  3E17 A;  4GHN A;  4JOR A;  2EGN A;  4JOH A;  2W7R A;  1FC7 A;  2KBS A;  1UJV A;  1BFE A;  4K76 A;  2MX6 A;  3HPK A;  2OCS A;  3R68 A;  2KPK A;  3HPM A;  2YT7 A;  2EEG A;  3DJ3 A;  2M0U A;  2HE2 A;  1UHP A;  2R4H A;  5F3X A;  3ID2 A;  1GQ4 A;  2HE4 A;  1WHD A;  1U38 A;  1V1T A;  1I92 A;  2CSJ A;  4XHV A;  2DLS A;  2V1W A;  4F8K A;  1SOZ A;  3EGH C;  4Q2O A;  1V6B A;  3MH6 A;  1FCF A;  4NMQ A;  2FNE A;  2PKT A;  1UEQ A;  2KG2 A;  2PA1 A;  4GVC A;  4O06 A;  3NGH A;  3CBX A;  2EEI A;  3SHU A;  2BYG A;  3GDV A;  5GND A;  4G69 A;  3CYY A;  1U37 A;  1GM1 A;  2LOB A;  5E22 A;  3RLE A;  2CSS A;  1WIF A;  3O46 A;  1D5G A;  4JOP A;  4HOP A;  1WFV A;  2JIL A;  1U39 A;  3PV5 A;  2VZ5 A;  1FC9 A;  1N6F A;  3R0H A;  2M3M A;  1VA8 A;  1N6D A;  5B6L A;  2I0L A;  2M0V A;  5HFD A;  4Q2N A;  4JL7 A;  3I1E A;  2KQF A;  1RY4 A;  1UF1 A;  2M0T A;  2HGA A;  2KYL A;  2VSP A;  1FC6 A;  1WJL A;  4YYX A;  1MFL A;  1OBX A;  2M10 A;  4E35 A;  1N7E A;  5HFB A;  1V62 A;  2JXO A;  2KA9 A;  3PV2 A;  3QJN A;  1M5Z A;  3VQF A;  3OTP A;  4REY A;  4PQW A;  4Z8J A;  2G5M B;  3NFK A;  2D8I A;  1RZX A;  3NFL A;  1X8S A;  2MHO A;  4WYU A;  3B76 A;  3AXA A;  3GDU A;  2H3L A;  3I18 A;  3ID3 A;  2QT5 A;  5G1E A;  1UJD A;  5EZ0 A;  2E7K A;  2AIN A;  3ZRT A;  1Z87 A;  2KOH A;  5HEB A;  3I4W A;  1I16 A;  4R2Z A;  5E1Y A;  2EGO A;  2H3M A;  3PS4 A;  2LC7 A;  2JWE A;  4Z33 A;  3WKL A;  5E11 A;  2EGK A;  2KOJ A;  1UM7 A;  4Q3H A;  4GVD A;  2LC6 A;  1ZUB A;  3MH4 A;  2CS5 A;  1QAU A;  2OS6 A;  2IWP A;  2EJY A;  2IWO A;  4IC6 A;  3SOE A;  3TSV A;  2VRF A;  2RCZ A;  2EAQ A;  5I7Z A;  4JOK A;  2KV8 A;  3CH8 A;  2D90 A;  2K20 A;  2K1Z A;  3CBZ A;  3LNX A;  2M0Z A;  4RI0 A;  4N6X A;  3DJ1 A;  2VWR A;  4NMV A;  3RL8 A;  3PDV A;  1UEP A;  2IWN A;  3DOR A;  2Z9I A;  2W4F A;  1X5Q A;  1Y7N A;  2DKR A;  1Q7X A;  1B8Q A;  1WI4 A;  4NMO A;  2KJK A;  4NXR A;  1WI2 A;  4NMP A;  1VB7 A;  1OBY A;  2PNT A;  1N7F A;  1N99 A;  5HF4 A;  3TSZ A;  1IU0 A;  4Q6S A;  5HEY A;  3GGE A;  4H11 A;  3TMH A;  2QKU A;  2Z17 A;  4NMS A;  2YUB A;  4JOF A;  3KZD A;  5HFE A;  4L8N A;  2LUI A;  2OQS A;  3QGL A;  1P1D A;  1V5Q A;  4AMH A;  1UFX A;  2OGP A;  2JIK A;  1Q3P A;  3RL7 A;  3PDZ A;  3CC0 A;  1TP3 A;  1YBO A;  3JXT A;  2DC2 A;  3GDS A;  1WF8 A;  2OMJ A;  4K6Y A;  3QJM A;  2GZV A;  2VSV A;  2WL7 A;  4LMM A;  2DLU A;  3OU0 A;  3TSW A;  4JOJ A;  5EYZ A;  5G1D A;  2L97 A;  1QLC A;  1SOT A;  4KFW A;  2KPL A;  5E21 A;  3L4F D;  5JXB A;  1IU2 A;  5HET A;  3MH7 A;  3K1R A;  1QAV B;  2D92 A;  2FN5 A;  5FHT A;  3CBY A;  2DB5 A;  2EDZ A;  1UEZ A;  3SFJ A;  4NNL A;  3K50 A;  4OAJ A;  1V5L A;  3K82 A;  2REY A;  2OPG A;  4JOG A;  2H2C A;  5HED A;  1KY9 A;  2IWQ A;  1TQ3 A;  1G9O A;  3QDO A;  4NMT A;  5DTH A;  1L6O A;  1X5N A;  2PKU A;  2Q9V A;  1VJ6 A;  4KFV A;  2ZPM A;  4E3B A;  3GSL A;  2RRM A;  2I1N A;  2DMZ A;  1Y8T A;  3CS0 A;  1WFG A;  1X45 A;  2I4S A; 
#chains in the Genus database with same CATH topology
 1UM1 A;  1XZ9 A;  1KWA A;  1UEW A;  1UJU A;  1GQ5 A;  3O5N A;  2JIN A;  3DJA A;  2I6V A;  1VAE A;  1U3B A;  4OEP A;  1NF3 C;  2JRE A;  1R6J A;  2AWW A;  3NCV A;  3KHF A;  3EGG C;  5E6P B;  1TP5 A;  3GCN A;  3HVQ C;  5HFC A;  1KEF A;  4NXQ A;  1T2M A;  2EHR A;  5FB8 C;  2H2B A;  2I0I A;  1RGW A;  4NMR A;  2FE5 A;  2KRG A;  3ID1 A;  3R69 A;  3VQG A;  4FGM A;  1IHJ A;  1VCW A;  3QO6 A;  4K72 A;  2EV8 A;  1BE9 A;  2OZF A;  4EDJ A;  5HDY A;  1WH1 A;  3LNY A;  1UIT A;  2KOM A;  4E34 A;  1WHA A;  5F67 A;  1LCY A;  4K78 A;  4UU5 A;  1RGR A;  2QG1 A;  2AWX A;  1OBZ A;  4Q2Q A;  4K75 A;  2G2L A;  2EDV A;  3SHW A;  4MPA A;  3GCO A;  2UZC A;  4P0C A;  2EEH A;  4YDP A;  3FY5 A;  2KJP A;  2KL1 A;  3BPU A;  2YT8 A;  2LA8 A;  2EDP A;  2DAZ A;  4Q6H A;  2I04 A;  4OEO A;  3WKM A;  2EXG A;  2VPH A;  2KJD A;  2L4S A;  5HFF A;  3PV4 A;  2F5Y A;  1N7T A;  3SUZ A;  1W9E A;  2KAW A;  3KDG A;  2DM8 A;  5GLJ A;  5A2P A;  1TE0 A;  2F0A A;  2PZD A;  4JJ3 A;  4JOE A;  2DJT A;  5HJ1 A;  1MFG A;  2O2T A;  2P3W A;  1WG6 A;  2R3Y A;  5H3J A;  1QAV A;  4HOP B;  3QIK A;  1PDR A;  2YUY A;  2JOA A;  4NNM A;  2QBW A;  2PDZ A;  4NXP A;  3GJ9 A;  2V90 A;  1P1E A;  1W9O A;  2L4T A;  1N6E A;  2QKV A;  1WF7 A;  2ENO A;  1Z86 A;  3KZE A;  1NTE A;  1OZI A;  2EEJ A;  1X5R A;  5D13 A;  5IL9 A;  4WYT A;  1K32 A;  2AWU A;  4UU6 A;  2YTW A;  2QKT A;  1Q3O A;  1W9Q A;  2OSG A;  3GAB A;  3STJ A;  3QE1 A;  5HF1 A;  3DIW A;  4Q2P A;  4P2A B;  1ZOK A;  2ZPL A;  1MC7 A;  2X7Z A;  3ID4 A;  1X6D A;  2Q3G A;  1X9Z A;  2FCF A;  3E17 A;  4GHN A;  4JOR A;  2EGN A;  4JOH A;  2W7R A;  1FC7 A;  4FLN A;  2KBS A;  1UJV A;  1BFE A;  4K76 A;  2MX6 A;  3HPK A;  2OCS A;  3R68 A;  2KPK A;  3HPM A;  2YT7 A;  2EEG A;  3DJ3 A;  2M0U A;  2HE2 A;  1UHP A;  2R4H A;  5F3X A;  3ID2 A;  1GQ4 A;  2HE4 A;  1WHD A;  3KDK A;  1U38 A;  1V1T A;  1I92 A;  2JSN A;  2CSJ A;  4XHV A;  2DLS A;  2V1W A;  4F8K A;  1SOZ A;  3EGH C;  4Q2O A;  1V6B A;  3MH6 A;  1FCF A;  4NMQ A;  2FNE A;  2PKT A;  1UEQ A;  2KG2 A;  2PA1 A;  4GVC A;  4O06 A;  3NGH A;  3CBX A;  2EEI A;  3SHU A;  2BYG A;  3GDV A;  5GND A;  4G69 A;  3CYY A;  1U37 A;  1GM1 A;  2LOB A;  5E22 A;  3RLE A;  2CSS A;  1WIF A;  3O46 A;  1D5G A;  4JOP A;  4HOP A;  1WFV A;  2JIL A;  1U39 A;  3PV5 A;  2VZ5 A;  1FC9 A;  1N6F A;  3R0H A;  2M3M A;  1VA8 A;  1N6D A;  5B6L A;  2I0L A;  2M0V A;  5HFD A;  4Q2N A;  4JL7 A;  3I1E A;  2KQF A;  1RY4 A;  1UF1 A;  2M0T A;  2HGA A;  2KYL A;  2VSP A;  1FC6 A;  1WJL A;  4YYX A;  1MFL A;  1OBX A;  2M10 A;  4E35 A;  1N7E A;  5HFB A;  1V62 A;  2JXO A;  2KA9 A;  3PV2 A;  3QJN A;  1M5Z A;  3VQF A;  3OTP A;  4REY A;  4PQW A;  4Z8J A;  2G5M B;  3NFK A;  2D8I A;  1RZX A;  3NFL A;  1X8S A;  2MHO A;  4WYU A;  3B76 A;  3AXA A;  3GDU A;  2H3L A;  3I18 A;  3ID3 A;  2QT5 A;  5G1E A;  1UJD A;  5EZ0 A;  2E7K A;  2AIN A;  3ZRT A;  1Z87 A;  2KOH A;  5HEB A;  3I4W A;  1I16 A;  4R2Z A;  5E1Y A;  2EGO A;  2H3M A;  3PS4 A;  2LC7 A;  2JWE A;  4Z33 A;  3WKL A;  5E11 A;  2EGK A;  2KOJ A;  1UM7 A;  4Q3H A;  4GVD A;  2LC6 A;  1ZUB A;  3MH4 A;  2CS5 A;  1QAU A;  2OS6 A;  2IWP A;  2EJY A;  2IWO A;  4IC6 A;  3SOE A;  3TSV A;  2VRF A;  2RCZ A;  2EAQ A;  5I7Z A;  4JOK A;  2KV8 A;  3CH8 A;  2D90 A;  2K20 A;  2K1Z A;  3CBZ A;  3LNX A;  2M0Z A;  4RI0 A;  4N6X A;  3DJ1 A;  2VWR A;  4NMV A;  3RL8 A;  3PDV A;  1UEP A;  2IWN A;  3DOR A;  2Z9I A;  2W4F A;  1X5Q A;  1Y7N A;  2DKR A;  1Q7X A;  1B8Q A;  1WI4 A;  4NMO A;  2KJK A;  4NXR A;  1WI2 A;  4NMP A;  1VB7 A;  1OBY A;  2PNT A;  1N7F A;  1N99 A;  5HF4 A;  3TSZ A;  1IU0 A;  4Q6S A;  5HEY A;  2GEF A;  3GGE A;  4H11 A;  3TMH A;  4JJ0 A;  2QKU A;  2Z17 A;  4NMS A;  2YUB A;  5B42 A;  4JOF A;  3KZD A;  5HFE A;  4L8N A;  2LUI A;  2OQS A;  3QGL A;  1P1D A;  1V5Q A;  4AMH A;  1UFX A;  2OGP A;  2JIK A;  1Q3P A;  3RL7 A;  3PDZ A;  5ILB A;  3CC0 A;  1TP3 A;  1YBO A;  3JXT A;  2DC2 A;  3GDS A;  1WF8 A;  2OMJ A;  4K6Y A;  3QJM A;  2GZV A;  2VSV A;  2WL7 A;  4LMM A;  2DLU A;  3OU0 A;  3TSW A;  4JOJ A;  5EYZ A;  5G1D A;  2L97 A;  1QLC A;  1SOT A;  4KFW A;  2KPL A;  5E21 A;  3L4F D;  5JXB A;  1IU2 A;  5HET A;  3MH7 A;  3K1R A;  1QAV B;  2D92 A;  2FN5 A;  5FHT A;  3CBY A;  2DB5 A;  2EDZ A;  1UEZ A;  3SFJ A;  4NNL A;  3K50 A;  4OAJ A;  1V5L A;  3K82 A;  2REY A;  2OPG A;  4JOG A;  2H2C A;  5HED A;  1KY9 A;  2IWQ A;  1TQ3 A;  1G9O A;  3QDO A;  4NMT A;  5DTH A;  1L6O A;  1X5N A;  2PKU A;  2Q9V A;  1VJ6 A;  4KFV A;  2ZPM A;  4E3B A;  3GSL A;  2RRM A;  2I1N A;  2DMZ A;  1Y8T A;  3CS0 A;  1WFG A;  1X45 A;  2I4S A; 
#chains in the Genus database with same CATH homology
 1UM1 A;  1XZ9 A;  1KWA A;  1UEW A;  1UJU A;  1GQ5 A;  3O5N A;  2JIN A;  3DJA A;  2I6V A;  1VAE A;  1U3B A;  4OEP A;  1NF3 C;  2JRE A;  1R6J A;  2AWW A;  3NCV A;  3KHF A;  3EGG C;  5E6P B;  1TP5 A;  3GCN A;  3HVQ C;  5HFC A;  1KEF A;  4NXQ A;  1T2M A;  2EHR A;  5FB8 C;  2H2B A;  2I0I A;  1RGW A;  4NMR A;  2FE5 A;  2KRG A;  3ID1 A;  3R69 A;  3VQG A;  4FGM A;  1IHJ A;  1VCW A;  3QO6 A;  4K72 A;  2EV8 A;  1BE9 A;  2OZF A;  4EDJ A;  5HDY A;  1WH1 A;  3LNY A;  1UIT A;  2KOM A;  4E34 A;  1WHA A;  5F67 A;  1LCY A;  4K78 A;  4UU5 A;  1RGR A;  2QG1 A;  2AWX A;  1OBZ A;  4Q2Q A;  4K75 A;  2G2L A;  2EDV A;  3SHW A;  4MPA A;  3GCO A;  2UZC A;  4P0C A;  2EEH A;  4YDP A;  3FY5 A;  2KJP A;  2KL1 A;  3BPU A;  2YT8 A;  2LA8 A;  2EDP A;  2DAZ A;  4Q6H A;  2I04 A;  4OEO A;  3WKM A;  2EXG A;  2VPH A;  2KJD A;  2L4S A;  5HFF A;  3PV4 A;  2F5Y A;  1N7T A;  3SUZ A;  1W9E A;  2KAW A;  3KDG A;  2DM8 A;  5GLJ A;  5A2P A;  1TE0 A;  2F0A A;  2PZD A;  4JJ3 A;  4JOE A;  2DJT A;  5HJ1 A;  1MFG A;  2O2T A;  2P3W A;  1WG6 A;  2R3Y A;  5H3J A;  1QAV A;  4HOP B;  3QIK A;  1PDR A;  2YUY A;  2JOA A;  4NNM A;  2QBW A;  2PDZ A;  4NXP A;  3GJ9 A;  2V90 A;  1P1E A;  1W9O A;  2L4T A;  1N6E A;  2QKV A;  1WF7 A;  2ENO A;  1Z86 A;  3KZE A;  1NTE A;  1OZI A;  2EEJ A;  1X5R A;  5D13 A;  5IL9 A;  4WYT A;  1K32 A;  2AWU A;  4UU6 A;  2YTW A;  2QKT A;  1Q3O A;  1W9Q A;  2OSG A;  3GAB A;  3STJ A;  3QE1 A;  5HF1 A;  3DIW A;  4Q2P A;  4P2A B;  1ZOK A;  2ZPL A;  1MC7 A;  2X7Z A;  3ID4 A;  1X6D A;  2Q3G A;  1X9Z A;  2FCF A;  3E17 A;  4GHN A;  4JOR A;  2EGN A;  4JOH A;  2W7R A;  1FC7 A;  4FLN A;  2KBS A;  1UJV A;  1BFE A;  4K76 A;  2MX6 A;  3HPK A;  2OCS A;  3R68 A;  2KPK A;  3HPM A;  2YT7 A;  2EEG A;  3DJ3 A;  2M0U A;  2HE2 A;  1UHP A;  2R4H A;  5F3X A;  3ID2 A;  1GQ4 A;  2HE4 A;  1WHD A;  3KDK A;  1U38 A;  1V1T A;  1I92 A;  2JSN A;  2CSJ A;  4XHV A;  2DLS A;  2V1W A;  4F8K A;  1SOZ A;  3EGH C;  4Q2O A;  1V6B A;  3MH6 A;  1FCF A;  4NMQ A;  2FNE A;  2PKT A;  1UEQ A;  2KG2 A;  2PA1 A;  4GVC A;  4O06 A;  3NGH A;  3CBX A;  2EEI A;  3SHU A;  2BYG A;  3GDV A;  5GND A;  4G69 A;  3CYY A;  1U37 A;  1GM1 A;  2LOB A;  5E22 A;  3RLE A;  2CSS A;  1WIF A;  3O46 A;  1D5G A;  4JOP A;  4HOP A;  1WFV A;  2JIL A;  1U39 A;  3PV5 A;  2VZ5 A;  1FC9 A;  1N6F A;  3R0H A;  2M3M A;  1VA8 A;  1N6D A;  5B6L A;  2I0L A;  2M0V A;  5HFD A;  4Q2N A;  4JL7 A;  3I1E A;  2KQF A;  1RY4 A;  1UF1 A;  2M0T A;  2HGA A;  2KYL A;  2VSP A;  1FC6 A;  1WJL A;  4YYX A;  1MFL A;  1OBX A;  2M10 A;  4E35 A;  1N7E A;  5HFB A;  1V62 A;  2JXO A;  2KA9 A;  3PV2 A;  3QJN A;  1M5Z A;  3VQF A;  3OTP A;  4REY A;  4PQW A;  4Z8J A;  2G5M B;  3NFK A;  2D8I A;  1RZX A;  3NFL A;  1X8S A;  2MHO A;  4WYU A;  3B76 A;  3AXA A;  3GDU A;  2H3L A;  3I18 A;  3ID3 A;  2QT5 A;  5G1E A;  1UJD A;  5EZ0 A;  2E7K A;  2AIN A;  3ZRT A;  1Z87 A;  2KOH A;  5HEB A;  3I4W A;  1I16 A;  4R2Z A;  5E1Y A;  2EGO A;  2H3M A;  3PS4 A;  2LC7 A;  2JWE A;  4Z33 A;  3WKL A;  5E11 A;  2EGK A;  2KOJ A;  1UM7 A;  4Q3H A;  4GVD A;  2LC6 A;  1ZUB A;  3MH4 A;  2CS5 A;  1QAU A;  2OS6 A;  2IWP A;  2EJY A;  2IWO A;  4IC6 A;  3SOE A;  3TSV A;  2VRF A;  2RCZ A;  2EAQ A;  5I7Z A;  4JOK A;  2KV8 A;  3CH8 A;  2D90 A;  2K20 A;  2K1Z A;  3CBZ A;  3LNX A;  2M0Z A;  4RI0 A;  4N6X A;  3DJ1 A;  2VWR A;  4NMV A;  3RL8 A;  3PDV A;  1UEP A;  2IWN A;  3DOR A;  2Z9I A;  2W4F A;  1X5Q A;  1Y7N A;  2DKR A;  1Q7X A;  1B8Q A;  1WI4 A;  4NMO A;  2KJK A;  4NXR A;  1WI2 A;  4NMP A;  1VB7 A;  1OBY A;  2PNT A;  1N7F A;  1N99 A;  5HF4 A;  3TSZ A;  1IU0 A;  4Q6S A;  5HEY A;  2GEF A;  3GGE A;  4H11 A;  3TMH A;  4JJ0 A;  2QKU A;  2Z17 A;  4NMS A;  2YUB A;  5B42 A;  4JOF A;  3KZD A;  5HFE A;  4L8N A;  2LUI A;  2OQS A;  3QGL A;  1P1D A;  1V5Q A;  4AMH A;  1UFX A;  2OGP A;  2JIK A;  1Q3P A;  3RL7 A;  3PDZ A;  5ILB A;  3CC0 A;  1TP3 A;  1YBO A;  3JXT A;  2DC2 A;  3GDS A;  1WF8 A;  2OMJ A;  4K6Y A;  3QJM A;  2GZV A;  2VSV A;  2WL7 A;  4LMM A;  2DLU A;  3OU0 A;  3TSW A;  4JOJ A;  5EYZ A;  5G1D A;  2L97 A;  1QLC A;  1SOT A;  4KFW A;  2KPL A;  5E21 A;  3L4F D;  5JXB A;  1IU2 A;  5HET A;  3MH7 A;  3K1R A;  1QAV B;  2D92 A;  2FN5 A;  5FHT A;  3CBY A;  2DB5 A;  2EDZ A;  1UEZ A;  3SFJ A;  4NNL A;  3K50 A;  4OAJ A;  1V5L A;  3K82 A;  2REY A;  2OPG A;  4JOG A;  2H2C A;  5HED A;  1KY9 A;  2IWQ A;  1TQ3 A;  1G9O A;  3QDO A;  4NMT A;  5DTH A;  1L6O A;  1X5N A;  2PKU A;  2Q9V A;  1VJ6 A;  4KFV A;  2ZPM A;  4E3B A;  3GSL A;  2RRM A;  2I1N A;  2DMZ A;  1Y8T A;  3CS0 A;  1WFG A;  1X45 A;  2I4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...