3GCNA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with omp peptide (yqf)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
300
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Protease degS
publication title Mechanisms of allosteric activation of the DegS protease by OMP-peptide binding and protein-substrate binding
rcsb
source organism Escherichia coli
total genus 59
structure length 300
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcnA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA01
4A5TS 1UTJA 5C5OA 4I8HA 3UFAA 2L4TA 1EUFA 1O2KA 4E3BA 2FX6A 1EAUA 4F4OC 1MCVA 2FYQA 1WBGB 2SGAA 5G1EA 1DWEH 5DJ7A 2YOLA 1C5TA 4ABJA 1O3FA 5E1YA 2ZC9H 4NA9H 4XE4A 1GI2A 1AO5A 3BG8A 1Y8TA 3M7UA 2EJYA 1F0RA 4NA7A 1TRMA 2GCTC 3BTTE 3F9GA 1ARCA 1OYQA 2TGDA 1NU7B 3M5MA 4F8KA 3TH2H 5IYTA 3PB1E 4ZHLU 3TGIE 4MLFB 2FOCA 4BANB 1S6HA 3SNBA 4AX9H 2BDHA 2R2WU 1O39A 3RXKA 1MZDA 2JXOA 1GI1A 2BDYA 5EQRA 1EPTC 5A8XA 1XUGA 1TBZH 2FE5A 1EPTB 3ATWA 3TIUA 2FOAA 4FU7A 4YM9A 1ZPBA 3RL8A 4BOHA 2QKUA 3MNXA 1WFGA 1VITH 3K6ZA 1CBWC 3E8LA 1Z6JH 2Q6DA 1CBWB 4UFGH 1V2UT 2KJDA 4DJZB 3RLEA 3A8BA 2ANMH 1KDQB 4UU5A 3P8FA 1O2HA 1SMFE 1NF3C 2SGQE 1QL7A 1FY1A 4BAQB 3QJMA 2H9HA 4HZHA 3ZZ7A 1OS8A 1U39A 1FONA 1A5IA 2DAZA 1DY8A 1DXPA 2RA0A 4DT7B 1EP6A 4Y11E 4AGKA 4TY7A 1TFXA 2PGQB 3CENA 2SFAA 2H5CA 3MO9A 1LHEH 2HNTC 3PS4A 1YPEH 2X7ZA 3ZVDA 5LGOA 2TBSA 3STJA 2ZU5A 1K32A 2PTCE 1O2NA 3AW1A 3E17A 4FUJA 1INCA 3ID2A 2PSYA 1L6OA 4CH2B 1QURH 1UCYH 3CS7A 2A4OA 4OS6A 5GXPA 1SGNE 2ZPMA 2H2ZA 1HXEH 1AHTH 3MNBA 2RRMA 4FGMA 3O5NA 1C5VA 2A5AA 2ZHWH 3ESTA 3MU5A 4NZLA 4ABIA 1O2QA 2XC0A 2YNAA 4D76A 1C5MD 4MNXA 5GIBA 3EGGC 5E2PA 1C2FA 2FI5E 3MU4A 2HVXA 5EW2H 4X1RU 3HATH 2VRFA 1BJVA 2W7RA 1IQIA 2ZDMA 1YYY1 5TCAA 1HUTH 1OP2A 5FCKA 5C1XA 3UPEA 2LNCA 2OCVB 1NROH 2QYIA 1TA6A 1GMCG 3T62A 2IJOB 2F9VA 5EGMA 1NESE 4FVDA 1N7EA 1O3OA 4H4FA 1O2MA 1XVOA 3RXQA 1K21H 4YZUA 2NU2E 1UVPA 1G9OA 4WXVA 2EEGA 1V5QA 3ZYDA 1FMGA 1HXFH 1GM1A 2QG1A 3F9FA 1A5HA 2RCEA 4OGXA 2GKVE 3TJUA 1MUEB 2UWPA 4AFSA 4XBCA 2EDPA 2KYLA 5JDUB 1S82A 1SOZA 3PTNA 4D7FA 1ESBA 1UVUH 2R0KA 1FPHH 2GV6A 2Y80A 2ZFSA 4INLA 3A89A 3HVQC 1TRYA 2IOTA 5H3JA 4UFDH 4BTUB 4BTIB 3GDSA 2ANKH 2VVUA 3NCLA 1TYNA 3RC5A 3ZVFA 2XCFA 1SI5H 3NFLA 1AD8H 3GISB 1UK3A 1IQJA 1TPAE 1HAVA 1QL9A 4K8YA 3RP2A 3T25A 1GVLA 2AGIX 2WPIS 3CYYA 3L4FD 2OQUA 3RUOA 2ZWLH 3S9AA 4FVBA 2CGAA 2H2CA 2BD8A 4IC5A 1UK2A 4JMYA 3EGKH 3ELAH 2EA3A 5E8EH 1MKXH 3SGBE 1V2VT 4AN7A 2QXGA 1QBNA 2UUKB 1XKBC 3H7OA 3I4WA 1FIZA 3UNQA 1BFEA 4Y8XA 2R4HA 1DDJA 1GHAG 4Z0KA 2MHOA 1HBTH 4KFVA 4NIVA 1C5SA 2ZGCA 4INKA 2OXSA 1LQEA 2DE8A 1UVSH 1X8SA 2QT5A 1OXGA 1EJMA 2BY9X 2FM2A 3LOXA 3FP6E 1GCDA 1ZHRA 5K0HA 1K1OA 2CN0H 3OY5U 2ZHQH 1EPTA 2ZHEH 1N6XA 3KF2A 3SHCH 1GI5A 3RMLH 4NWLA 5T6GA 4I7YH 1C1SA 5F6MA 3DJ1A 4CR9A 4CRBA 1AE5A 1N7FA 1LKAA 2ASUB 1MBQA 2D90A 2G5VA 2HWLB 4FUFA 1RGWA 1V6BA 1KDQA 2P95A 1PQ5A 1DPOA 2P3UB 2DM8A 3SUZA 1FY3A 2J38A 3QN7A 4Q7YA 3OSYA 2ZNKH 4L8NA 4GVCA 3PMHB 2FLBH 3PLKA 1GJ4H 5EOKA 5AVDA 4K78A 1P04A 2BVRH 1O5EH 2YNBA 1GDNA 1Y5UT 2ZDVH 8GCHG 5GCHF 2I0IA 4CHAC 2ZCHP 3SJ9A 5DP9A 1S0RA 3SU3A 3ID3A 4U2WA 1XMNB 2ZU2A 1BBRK 1O3BA 4GCHF 2G4TA 3LC3A 3QZQA 2ZTYA 4JYUH 4B76A 1Y7NA 2PKTA 3I18A 4NNMA 2NU4E 2ZECA 4ZXXH 1NRQH 1P1DA 5F67A 1JOUB 2XTTB 1WG6A 1ESAA 4X0WU 1XUJA 4E06H 1IHSH 4PROA 1DFPA 1EB2A 4WF8A 4KKDA 1BIOA 2HPQH 1KWAA 1OBZA 4X6NA 2SGDE 4O06A 3NK8A 2I6SA 1UTLM 4IGDA 1NRPH 3VGCC 4AGJA 1TPSA 2LC6A 4GSOA 1WV7H 3VGCB 2OPGA 1P1EA 2YT8A 5E21A 1GDQA 3GJ9A 3RXJA 2GZ8A 1JXPA 2BD5A 2W7UA 1BTYA 1F0UA 1O3LA 1MD7A 1UCYE 2FOFA 1BZXE 2FWWA 3IG6B 1HGTH 1K1NA 1MKWK 2G52A 2M0ZA 3I78A 4MDSA 1U37A 3STIA 3SUDA 1P3CA 2H5DA 3SV6A 3MH6A 2ZGJA 1OKXA 1BBRH 3R68A 1Z8GA 2BVSH 4FUHA 1TGBA 1PFXC 1CHGA 1E34B 4NXPA 1HAHH 2PTNA 3O8CA 2HNTE 1QRZA 1ZMNA 1HLTH 4HOPB 1QAUA 1N6DA 1TONA 1UHBB 2CF8H 1ELCA 1G3EA 1ZGVA 1O5FH 1E37B 3EGHC 1GBBA 4H11A 4Y71A 4ISIH 2ZU1A 1ZJKA 1EJAA 4REYA 3BIUH 2WPHS 4Y0ZE 3BTKE 1WFVA 3U8TH 3QIKA 1ZJDA 3RXFA 3EE0B 1CGJE 2GGVB 1Y3YA 2Z9KA 4TY6A 1T32A 5I46H 1P2JA 1TGNA 1FNIA 5GJ4B 1NY22 1RD3B 1O38A 4X6MA 1NN6A 1Z8RA 3VPKA 1GI4A 3HPTB 1GVKB 2JETC 2JETB 1K1MA 1MKWH 1TMTH 4ZKSU 2XCNA 2LPRA 2BDGA 1AZZA 3D65E 1P3EA 1AWHB 4HFPB 5DTHA 3SI4H 4KTSA 1AWFH 2Q1JA 3BEFB 1AUJA 4FUDA 4ZMAH 4WJG2 4AFQA 2OTVA 2OC0A 5EPYA 1A4WH 2H2BA 2CMYA 1C4V2 4LZ4B 1A61H 1GI0A 4KTUA 1XUKA 1ZHPA 3BF6H 3P92A 5E6PB 3TSZA 2EAQA 1A46H 1C2LA 1GPZA 1M9UA 1GHWH 1ZR0A 1Q31A 2A1DB 2F9UA 2ZI2H 3URCA 3BTDE 1FCFA 3M7QA 3HGNA 2ZTZA 4NMVA 2R2MB 4B71A 2V90A 1A1RA 2P16A 1C5RA 2BVXH 1GMDG 1J9CH 3CP7A 1A5GH 3KQCA 1W2KH 1C1NA 2FXRA 3N7OA 5ESBA 4JK5A 2FN5A 4NIYA 1O5CB 3RXOA 3SHWA 4X8TH 2PDZA 1EX3A 3A83A 3RU4E 4D8NA 2ANYA 1UVTH 1O34A 1ZSLA 2F9OA 2FPZA 1ABJH 1DS2E 1NFYA 2OCSA 2A4RA 2JH0D 3ZZDA 3AAUA 1C1UH 1YCPM 1JMOH 2VWOA 2BD7A 2XWBI 4X1PU 1WCZA 1VITF 3VB7A 1WI4A 1UEZA 3EA7A 4O3UA 2OP9A 1GBEA 4MPAA 3DIWA 1QBOA 1EQ9A 4YO9A 4K3JA 2H3LA 4Y7BA 2BXTH 3M5NA 3RU4D 5AFZH 1B5GH 1BMAA 1O37A 1C5UA 1V2RT 1GHYH 3KQEA 1VJ9U 1GI3A 2TIOA 1MTNC 2KAWA 1F92A 1DANH 1MTNB 1WSSH 2BLQA 1AZ8A 1CO7E 1D3TB 3BSQA 3NWUA 1WHDA 1MFGA 1SFQB 4I8LA 1TLDA 1PDRA 3U8OH 3LGYA 1FC9A 2C90B 2I4SA 1TIOA 5HJ1A 3SORA 1C1PA 1O3EA 1O3DA 4MNYA 2OC7A 4E34A 3CBXA 4K76A 5EXNA 1MU6B 5FB8C 1XKAC 2GP9B 1OX1A 3LIWA 4X6OA 2K20A 4HOPA 1LVBA 2P59A 3FFGA 3K6YA 1BOQA 1JIMA 1UHBA 4ZUHA 5HFBA 1DWBH 2GT8A 2P94A 4MPUA 1BTZA 1C2KA 2BZ6H 1BTUA 2XBVA 1UJVA 1W9EA 3SNEA 2C8ZB 1FN6A 3RXVA 2BLVA 2A7JA 1HB0B 3QJNA 5DPAA 1O2VA 3LH1A 3SQHE 2AMPA 2NWNA 2CF9H 4ABAA 1HJAC 1SQTA 2YUYA 2TGTA 4X1NU 1DUEA 3L33A 1MAYA 2LUIA 1RZXA 1ZTKA 2B9LA 3PLPA 1WHAA 1SGFA 1QTFA 2Y5GA 1W8BH 4OGYA 5B6OA 2PKSC 1O2YA 2IWNA 4ZXYH 3QGLA 4LMMA 2HGTH 3CC0A 2PKSB 3A80A 1AVWA 2E7KA 3SUEA 1IOEA 2CSSA 4YESB 5C5NA 2FIRH 2XNIA 4DIHH 1W0ZU 3DT0H 2GDEH 3PDVA 4YDPA 4OS5A 1GHXH 1O3CA 1VJ6A 1NRSH 3T27A 1MTWA 4ISNA 5LPRA 1I92A 1QCPA 1O3IA 1SSXA 4GPGA 2QA9E 1M5ZA 1G3CA 1WH1A 5G1DA 2BY8X 4X8VH 3UTUH 4H6TA 2DC2A 4OAJA 3QK1A 4YYXA 1SBWA 2PW8H 1GBIA 4OS7A 5DP3A 1MTSA 1GMHF 3BTFE 1TX8A 3A87A 4WYUA 4Q2OA 4O3TA 2R0LA 3Q77A 3OX7U 3O8BA 4FUGA 2P8OC 2ZPLA 4DVAU 3D62A 3RMNH 1YBWA 4I8KA 2QKVA 1QB6A 1SGCA 4BTTB 1UTMA 1SC8U 2A5KA 2WPMS 1P01A 3U1IB 1BRAA 1Y5BT 1RS0A 1Z7KA 4ZROA 1V5LA 3Q00A 2NU1E 2W4FA 2PR3A 5FX6A 1AB9C 2HALA 1O32A 1GCTC 1AB9B 1TGCA 1C2IA 1RGRA 1K9OE 1B7XB 1F5KU 2IN2A 4D7GA 2F91A 3ID4A 2JIKA 2VIVA 1ETSH 1L0ZA 1J16A 2TRMA 3SV9A 3P6ZB 3UQOA 1GQ4A 3AXAA 2EI7A 1EXFA 1YPHE 2J9NA 2EEHA 2I1NA 2O9QA 3MH4A 1MQ5A 3E0NB 1SLWB 3VB6A 4UFFH 4DW2U 1MBMA 2XC5A 2VINA 2AMQA 1S0QA 4IN2A 4WMFA 1G3DA 1S85A 2KOMA 3M61U 3RC6A 2HRVA 1HJ8A 1UJDA 2A31A 4BAOB 1O2OA 1C2MA 1BA8B 9ESTA 3GCHC 1DUAA 3MWIU 3MNCA 3GCHB 1AU8A 4R8TB 2EXGA 3P95A 2YT7A 3RXBA 3BIVH 3WY8A 2Z3CA 1ZTLA 1KEFA 2BXUH 1P02A 4I32A 3ZZ3A 1ZUBA 1DWDH 1K1JA 4LXBH 4DGJA 1HIAA 2GX4A 4B2BA 2AMDA 2BY5X 3L6PA 1LPKB 3LC5A 3TU7H 1LTOA 4NMPA 4OS2A 2DMZA 4MQAA 3ZZAA 1C9TA 4JZIA 4Q2KA 1ZPCA 1ZHMA 1HAXB 1LQDB 3D23A 3A7XA 1DICA 1W0YH 1EZXC 1KY9A 1QQUA 4HTCH 1V2QT 3U1JB 1U38A 2I6VA 1TB6H 2B8OH 2NU0E 1KSNA 2D8WA 1WQVH 3A86A 1O31A 2AYWA 2GTBA 1C5OH 1T4VH 1TNHA 2BX4A 4Q6HA 3DJAA 4JOFA 1UM7A 2FOHA 3G01A 1VJAU 3ZVAA 5L30H 2ZDLA 2ZFPH 2XYAA 1TPPA 1DITH 5L2ZH 1QB1A 2BOKA 1N6EA 4NGAH 4AB8A 1O2ZA 5C2ZA 1ORFA 1AGJA 1SGFG 3SQEE 4IS5A 1AE8H 3TMHA 2AEIH 4TWYA 2PNTA 2EC9H 4NA8A 3FAOA 1Q3XA 1B0EA 1XX9A 4BNRA 1AKSB 3EAJA 2MX6A 2WV4A 5FBEA 2UUYA 1Q7XA 1CVWH 4MPVA 2LOBA 2WPLS 2H9EH 2VH0A 3MH7A 3RL7A 1SFIA 2KOHA 1GBDA 2ZF0H 3BTEE 3DA9B 4WH8A 3GCTF 2PSXA 3PROA 1CT0E 3UR9A 3V0XA 2J95A 1J14A 1DXWA 1C2DA 2QN5T 1L1GA 1AFQB 2XRCA 2PGBB 2YTWA 1SLVB 3V3MA 3BV9B 1O5DH 4WXIA 2YUBA 1HDTH 1PPBH 3KCGH 5DP6A 4RSPA 2Q9VA 3ZZ5A 1RY4A 3PO1C 1IQHA 1UVOA 3PO1B 2FNEA 1C1QA 5DP4A 5C20A 1O0DH 3SI3H 4BXSA 4MPWA 2J4IA 2JWEA 5EODA 3VXFH 5HYOA 1DE7H 5C67A 1GI8B 1OWHA 5HFCA 5F03A 5FHTA 2JH6D 4ABHA 1BJUA 5HM9A 2FZZA 1P57B 3RXTA 2P3FH 2STAE 5JBTA 4P0CA 2OZFA 2HLCA 1YPKH 4X8SH 2FOEA 4JOGA 3RMMH 3SV7A 2FS8A 2Y81A 3R3GB 1BUIA 2BHGA 3HK3B 1AMHA 1EATA 4B73A 5B6LA 2BY6X 1ANEA 2ZFRH 1KLJH 2BQWB 1ACBE 1GBTA 4I31A 2M5TA 1B0FA 2JH5D 3LGUA 5FBIA 1W3CA 1VCWA 4OEOA 1WQSA 2DE9A 1VB7A 3SU2A 3A7YA 1QRXA 6GCHF 1OOKB 3GOVB 2BZAA 1OBXA 1WIFA 3GYMA 1PPHE 3K2UA 5EQQA 1E36B 1BTWA 3GY2A 5HETA 1F5RA 1MFLA 1JIRA 1S83A 1TNGA 4UONA 2VNTA 3BTQE 3TGKE 1O30A 3VB5A 1G2LA 1FI8A 3LT3A 3FP8E 1PPZA 3F9HA 4IMZA 3BEIB 1IHJA 5DO4H 2STBE 4FUCA 1O3HA 4FUIA 2VGCC 5ESTE 2G4UA 3MU8A 1P8VC 2VGCB 2WPKS 3QX5H 3C1KA 3ZYEA 3SBKA 1A3EH 2ZZUH 3BTWE 5GCHG 4NCYA 1CA8B 1V2MT 5GLJA 2HPPH 3Q76A 4ZHAA 4A1VA 4GCHG 2DJTA 3K1RA 7LPRA 4NSYA 1Z1IA 3TSVA 3OTJE 4I33A 1LMWB 2GCHF 1HAZB 3RXRA 4WVPE 4JZFH 2QKTA 1GBAA 1D3QB 1IQNA 4A92A 1PPCE 2ZFTA 1SGYE 1YGCH 5HEBA 1FJSA 1LDTT 1V2JT 1KIGH 1AY6H 1CA0C 1S81A 4WYTA 1CT4E 1CA0B 3LGTA 2AH4X 4B2CA 4JL7A 1O2IA 1AKSA 2HE2A 4NMTA 4YOIA 1Z87A 5C1YA 4YOJA 3LH3A 5E0HA 2V3HH 2KV8A 4U32A 1LPGB 3TJVA 1ANDA 3BTHE 1SVPA 1NFWA 2AWWA 5TJXA 3PYHA 3E1XB 3DD2H 2RG3A 1HAYB 4Q3HA 1NT1A 4YOGA 1UTQA 3RC4A 1ZRKA 2BX3A 8LPRA 2ZKSA 1JRTA 4UD9H 3V7TA 5FCRA 1V6DA 1TQ3A 3RU4T 2VSVA 3B9FH 5IDKA 1G3BA 1QR3E 1ID5H 2GZ9A 5HXFA 1O35A 1WTGH 1WTHD 5I7ZA 4DURA 3HPMA 2AGGX 3MI4A 1SGEE 3U9AH 1QAVB 4KP0A 3T28A 3GY7A 1QFKH 1BDAA 2UUFB 2PUXB 2PWXA 3RXSA 4BXWA 3SV2H 2XBYA 1OYTH 2JKHA 3RDZA 1O2SA 3F1SB 1WJLA 2VIOA 3IITA 4I8GA 1T8OA 3SFJA 1D3DB 1MMJN 3W94A 4EDJA 5JB9S 1LO6A 4E35A 4IBLH 1HAPH 3URDA 3ODFA 1OWEA 1A0LA 1TALA 3MNSA 5DP5A 2O8WA 1BRUP 1GJ8B 2THFB 2H1UA 4RKJB 1S84A 2ZCLP 4RKOB 1B8QA 1ZMLA 4Z6AH 1IQFA 2BLWA 3K65B 4AG2A 1F0TA 1C5YB 1HAIH 3EDXB 3E6PH 4O03A 1QA0A 1XVMA 4E7NA 4DIIH 1TMUH 3RXMA 3SU4A 1F5LA 2ZTXA 2FCFA 5AHGH 1L1JA 1TABE 3AW0A 2A4GA 4K69A 4WY3A 2G81E 2QF0A 1KTSB 3EA8A 1UTKA 1BHXF 2ZA5A 4DY7B 5BPEA 4X2VA 2O8MA 2G5NA 4K6YA 3VB3A 3DFJA 2FLRH 2AIQA 7GCHF 1YLCA 2Z7FE 1UEWA 1BRBE 1NRNH 4RI0A 2A0QB 1DSTA 1NTPA 3SU6A 3GCOA 3TJNA 4AG1A 2OBOA 1GL0E 2Z94A 1BQYA 1UO6A 3GY5A 1K1IA 1KXBA 4E7RG 2W5EA 3M36A 2Z9JA 1ARBA 2EGOA 3ENSB 2P93A 5E11A 3U8RH 1QRWA 3A7ZA 1RIWB 1ZMJA 2K1QA 2V6NA 3RXCA 2ULLA 1GJ7B 1ZTJA 2BD2A 2FMJA 2PZDA 2A7HA 2SNWA 3A81A 4LK4A 4X6PA 2EEKA 4A1TA 3QE1A 2SGPE 2G2LA 1UITA 3ATMA 1P9SA 3S9CA 1V2ST 2QAAA 4B1TA 2Z3DA 2VIPA 4IMQA 1W12U 1W10U 1T31A 2F83A 2P3TB 1X5QA 1J15A 3ZVEA 1KLTA 2FOMB 1VITG 2ZIQH 1YPHC 3MU1A 4CBOA 1IAUA 7KMEH 1UJ1A 2G55A 1P11E 1PJPA 1T8MA 1T8NA 2VJ1A 3R69A 1DOJA 4NIXA 3CS0A 1NFUA 4J1YA 2VU8E 4X8UH 2PV9B 2ILNA 2XBXA 1X5RA 2G00A 2V3OH 4CBNA 2VWLA 1JBUH 2FX4A 1ELDE 1SGQE 1BMLA 3M35A 2M0TA 4RN6A 3VB4A 3I1EA 1O2XA 4CRAA 3NPSA 2OD3B 1ANBA 3VEQB 4J2YB 3TGJE 3MMGA 1QIXB 1P2KA 3NZIA 5H4IB 4AYYB 3UIRA 2IPHA 2AWXA 3ZRTA 1KYNA 1V2PT 1DWCH 1NO9H 2A2QH 2OUAA 3LONA 3M5LA 2BDIA 2FTLE 5FPTA 5JXBA 3VQGA 1G9IE 1C1OA 1HYLA 4TPYA 1N7TA 2V35A 4TWWA 2BQ7B 1XZ9A 3E16B 2ODQA 1EAIA 4X1QU 1TNKA 3ZZ6A 2UZCA 5AF9H 1DY9A 2O8LA 3MHWU 4BAMB 1IQEA 2F3CE 2VPHA 3TK6A 1MQ6A 1ELGA 5HEYA 4CREA 1IU2A 2UWLA 2C3SA 1MU8B 1V2WT 5HFEA 1DSUA 4GHNA 5JBCS 3AAVA 3RMOH 4Y76A 1AIXH 1MTUA 1Y3VA 1GL1A 2ZCKP 2L97A 2M10A 1DX5M 1SQAA 3UQVA 3LGVA 1ZYOA 2AWUA 1GGDC 2J94A 4Y7AA 1THSH 1QJ1B 3PTBA 1ANCA 2J2UA 1C5WB 1GGDB 2Q3GA 3A8DA 4VGCC 5E0GA 3TJOA 2H9TH 1P9UA 4VGCB 4OEPA 4MNWA 3UNRA 3SV8A 1Z6EA 3KZEA 2VIDA 1XM1A 1L4DA 1G36A 2K1ZA 3WKMA 2Y7XA 4ZKRU 1EASA 3HKJB 3HPKA 3UNSA 1THPB 4X2YA 2PLXA 3UY9A 1GMHG 5CMXH 4XBBA 5JBBS 1FXYA 2CJIA 3PM3A 5EW1H 4WMDA 2ZDAH 2G51A 5E0JA 2BQ6B 1O3JA 1GHBF 4OS4A 3WKLA 1BT7A 4Y0YE 2VWNA 4ABGA 1GJDB 3QWCH 4K1TA 2Y7ZA 1HJ9A 3M37A 2FTMA 3DJ3A 1C1RA 1RTFB 3O46A 4CRCA 1EZUC 1BBRE 1UTOA 1QA7A 2JREA 5EU8A 1GJ6A 1IQLA 4NXRA 1O3KA 4IC6A 1SB1H 5HFDA 3ATIA 1TOMH 3SGQE 9LPRA 2KJPA 2PKUA 1XXFA 1OPHB 2Z9IA 4WMEA 5EG4A 2WYJA 3KIDU 1P12E 1TQ0B 2QCYA 5AFYH 1TNLA 2HE4A 1W9OA 1YLDA 1P10A 4E05H 1P05A 1UHPA 1NC6A 4CH8B 5FPYA 4NMSA 2ODPA 3UWJH 1MTVA 1SLUB 1KXEA 1HAOH 1BTPA 1A7SA 4NFEA 5F8XA 1NM6A 4U01A 1BHXB 1RGQA 3GDVA 3TH4H 2ALVA 1D3PB 4MVNA 4AZ2B 1NS3A 3LNYA 1H1BA 2Y82A 4I8JA 1UMAH 2IWQA 4INHA 4K2YA 5EXLA 4KTCA 1GWAA 1GBHA 3MO6A 3A8CA 2EDVA 2EI8A 1WF7A 3T2NA 1OWDA 2VSPA 3GY3A 2A4QA 3JZ1B 4XBDA 3S0NA 2XBWA 4XHVA 2FS9A 5FPSA 5T6DA 2BTCE 3ZVCA 4MNVA 1XUFA 3M3SA 2Q6GA 3M7TA 5GNDA 2F5YA 4IW4E 4FXGH 3E91A 3RM0H 1AN1E 4A6LA 1W14U 5L2YH 3RXUA 3MOCA 4R0IA 3D49H 2HGAA 5BRRE 3Q3KA 2A7CA 1NPMA 4FUEA 1RRKA 5PTPA 1CQQA 1SOTA 2VVVA 3EQ0H 3Q3XA 1NFXA 1EKBB 4CRGA 1C2GA 3GYLB 4Q7ZA 3A7VA 1J17T 5FAHA 3PDZA 1F7ZA 1C1MA 1LVYA 1C2HA 4G69A 4ESTE 4Q6SA 1RXPA 3ZV9A 2EGKA 3ZZ9A 1BTXA 4JYTA 1Q2WA 3ZZ4A 1QGFA 1SGPE 1GI7B 4KFWA 3ZZCA 4ABBA 1VGCB 3SU0A 5A0AE 1BMNH 3KQDA 2BD4A 3P8GA 1ABIH 2G8TA 1C1TA 1FUJA 3LGWA 1P2MA 4SGBE 4Q2NA 4GLYA 3UR6A 3I29A 1GJ9B 5ETXA 1IHTH 1PPEE 5ABWA 2AIPA 3K50A 1UM1A 1O3AA 1IQMA 3A88A 2CSJA 1W7XH 1CSOE 3GCTG 3A84A 1MH0A 4YLUA 4N6XA 1ZRBA 3KHFA 1O3NA 4MTBA 2ZHDA 1UTNA 2BD9A 1L2EA 4WWYA 4H42U 4U30A 3RXLA 4YT7H 4K1SA 1V2TT 2KG2A 2EEIA 2ZEBA 1AVXA 4WH6A 5DK1A 2W3IA 2FEQH 1LPZB 1YCPK 2OQ5A 1FC6A 1V62A 3RXIA 2C93B 4FU9A 1FPCH 2CV3A 3BPUA 3BN9A 4ABEA 1TWXB 3FVFB 1C5XB 1TNIA 2H6MA 5C3NA 2ZDNA 4Y79A 5JB8S 1GBLA 1HAVB 5LH8A 2BLOA 2XXLA 3M3TA 4MPXA 3GDUA 1T7CA 1Y3WA 4ZAEA 1MCTA 2QY0B 2TPIZ 1Q3OA 4GUXA 2KAIB 1GJAB 3GICB 2A5IA 3NGHA 2GCTB 2V0BA 3I77A 1EZSC 2FI4E 3E90B 2VB0A 2C8WB 2XC4A 2CHAC 2D8IA 2FI3E 1CHOF 4ASHA 1FZZA 2CHAB 3ID1A 5HM2A 1ZSJA 2F9PA 2EHRA 2Y5FA 2BYGA 1P2QA 1T4UH 1T2MA 1ZLRA 3NFKA 1O2JA 4K8BA 4UE7H 5GPIB 1UCYK 2F0AA 4X1SU 1TAWA 5EXMA 3QDOA 4YLQH 1OWJA 1PYTC 1AFQC 1YPGH 3A7TA 3S7KB 3TLOA 3TPIZ 3PMAB 5A2MH 1SR5C 3F9EA 6GCHG 1L1NA 1QBVH 3SUFA 1N99A 3R0HA 1P06A 2OC1A 2ODYB 1YCPH 3ITIA 5GDSH 4ZH8A 3EA9A 1BE9A 2DKRA 3GGEA 1XUIA 1Z8IB 4X2XA 5HMAA 4ABDA 2XWAA 1O2WA 1EAXA 1X45A 1V2NT 1OP0A 1H8IH 2I0LA 4K1EA 1GG6C 1KXFA 4M7GA 1JRSA 1GG6B 2C8XB 4FU8A 2FOGA 1EB1H 2VZ5A 2VIQA 4CRFA 1UFXA 3TK9A 2VH6A 2BDBA 2ZPRA 5E2OA 2OINA 1S5SA 3UUZA 1QLCA 4Q7XA 3PWBA 5EPNA 2OQSA 5JPMH 5I25A 3PMJA 3QUMP 4Q80A 4JOKA 2FP7B 1GBJA 2GCHG 3TNTA 4JOHA 4K5ZA 4XSKU 1HRTH 4TPIZ 1TRNA 1D6WA 2Z17A 3TSWA 4GHQA 4AFZA 1E38B 1RFNA 3PLBA 2QIQA 1OWIA 1WYKA 2J92A 3DORA 1TOCB 3AVZA 4ZHMU 2V1WA 3RXPA 1X7AC 3MYWA 2CXVA 1O2LA 1X6DA 2PUQH 5A0CA 4GHTA 1VCQA 8ESTE 4UEHH 5HFFA 1SHHB 2BYAX 2PKAB 2ENOA 3P8OA 1AFEH 2ALPA 1WI2A 1GHZA 3QTOH 1MKXK 1BCUH 3UREA 1QY6A 2GDDA 4B75A 2ZQ2A 2Y5HA 1PPFE 2R3YA 5DG6A 3CBZA 1GDUA 3RXGA 3RLWH 2KBSA 4D9QA 2GZVA 1DLKB 1IU0A 2QF3A 1K1PA 3U98H 2UWOA 3F6UH 6CHAC 1FIWA 2BB4A 2UUJB 4XDEA 3TNSA 6CHAB 1P2IA 2DUCA 2D26C 4H6SB 4F49A 1ELFA 3SJKA 1Y59T 2CS5A 1AQ7A 5HF1A 2ZG0H 1J8AA 2GVFA 1WU1A 3KEEA 3JXTA 2D1JA 2DLUA 3ZV8A 1N6FA 1THRH 3QGNB 1PQAA 1SPJA 1ZOMA 3S9BA 2IWOA 4XFQA 1N1LA 1P0SH 1YPJH 2AS9A 4MG3A 3QGJA 1GVZA 1PQ8A 1O2PA 4Q2PA 4AORA 1SGTA 4K60A 3GSLA 2KAIA 4JORA 3NKKA 1QB9A 1HAGE 3KGPA 1GQ5A 1RTKA 1DT2A 1C1VH 4NZQA 3KHVA 1GBFA 2WUCA 4BAKB 1ZZZA 1GMCF 3GY4A 2PFEA 1DM4B 2I6QA 3RXAA 1NZQH 3DHKH 2JINA 3FY5A 2QXIA 3Q3YA 2AINA 1QL8A 3QZRA 3P70B 4ZKNU 1C5PA 1TPOA 1LVOA 3DUXH 2VWRA 1ZPZA 1GBCA 1RJXB 5C1UA 1UK4A 7GCHG 2ZQ1A 5SGAE 1BB0B 8KME2 3MU0A 2G5MB 1G37A 1X5NA 2KRGA 1OSSA 2KJKA 1F0SA 5HF4A 2I04A 1C5QA 1HV7A 1SL3A 1AVGH 2BOHB 5A2PA 3BTME 1V1TA 2GD4B 5DGJA 6LPRA 1LCYA 1O2UA 1BITA 1CGHA 1ELBA 2EI6A 2ZPQA 3AASA 1VAEA 1KXAA 2GT7A 5A8YA 1IQGA 3BTGE 2QC2A 1GI6A 3SUGA 3KQBA 4CHAB 1C4Y2 2FO9A 3VFEA 1FC7A 3B23B 1GJCB 4D9RA 2KA9A 2Z3EA 2M0VA 2LA8A 1O5BB 4JYVH 2GV7A 2GMTC 1LKBA 5JBAS 2KL1A 2GMTB 1VA8A 3QTVH 2KPLA 3LGIA 5JYIA 4B74A 3GCNA 1MZAA 3TK5A 1H8DH 1DLEA 2ZFFH 5FXLA 1GHAF 5GWZA 3SOEA 3C27B 5D13A 1GBKA 3HKIB 3P17H 2PA1A 1BRCE 1FV9A 2RCZA 1F2SE 2ZFQH 5LPFA 1ELTA 2FOBA 1YPMH 2ZO3H 3LJOA 2H3MA 5K7RA 3BG4C 2NU3E 1ESTA 4XOJA 1EJNA 3BG4B 4JZ1A 4Y10E 5EZ0A 1HNEE 1GHVH 2PKAA 1KXCA 3E3TA 2BM2A 1WUNH 1WF8A 2OGPA 1C1WH 1PQ7A 1P2NA 1H4WA 4LOYH 2AGEX 3SJ8A 1O2RA 1PYTD 1QJ6B 4TYDA 2BDCA 3LU9B 1NRRH 2REYA 5EQSA 1QJ7B 4UU6A 2PHBA 1NTEA 3U69H 3ODDA 5F8ZA 3RXDA 1O5AB 1RIWC 8GCHF 1FAXA 4JZEH 1ETTH 1GJ5H 1V2OT 3HGPA 4ISHH 3BEUA 3QDZB 2EEJA 4JOPA 1LHDH 3E0PB 2R9PA 2RA3A 5TCCA 1BTHH 1VR1H 1Z1JA 5T3HA 1DVAH 3T29A 3V13A 4AFUA 2P3WA 4Y8YA 5HDYA 3ZZBA 3OYPA 3SHUA 4AMHA 3VQFA 3RXEA 2BD3A 2SGEE 4B2AA 1UJUA 2TGAA 1FQ3A 4NFFA 5E22A 3SJOA 3OTPA 1W11U 3IWMA 5EYZA 2D2DA 3TITA 4NIWA 2OMJA 1CU1A 1ETRH 3ZZ8A 2R3UA 4OS1A 2OC8A 3SU5A 1YC0A 5F8TA 2AFQB 2JOAA 1UEQA 1LHGH 3PV5A 1C2JA 3SNAA 1UF1A 3A7WA 3LKWA 2KQFA 1Y3XA 2A2XH 3HK6B 4NWKA 5FX5A 1O2GH 2KPKA 4K72A 4AB9A 1SLXB 3CH8A 1D5GA 1PPGE 2FDAA 1FLEE 2VVCA 1CE5A 1KLIH 2WINI 1XXDA 1P03A 3R0FA 3ZVBA 5LPEA 2Y6TA 4Y6DA 3A82A 3FZZA 2O8UA 3UWIA 1O36A 2Q6FA 3OY6U 3PV2A 1ZGIA 3H5CB 3K9XB 3LJJA 2WYGA 2GZ7A 4X2WA 1L4ZA 4UDWH 1FY4A 4THNH 4Z33A 3QLPH 1AUTC 1I16A 1S6FA 1QAVA 4NMRA 1P2OA 1Z8JB 2LC7A 4KELA 3VXEH 4O97A 2L4SA 2A32A 1GHBG 3ATLA 1O5GH 4PQWA 2OBQA 2Z9GA 1ELAA 2W7SA 3SHAH 1H9LB 4AOQA 4JZDH 1ELVA 2C8YB 1QQ4A 1BMMH 1GJBB 3LNXA 4QT8C 4KGAA 3TH3H 2QXHA 3A8AA 1HFDA 1FAKH 4DOQA 2RDLA 1WAYB 1SG8B 1TMBH 1G2MA 2W26A 1ZSKA 3B8JA 2EGNA 1EOJA 1A0HB 4P2AB 1MD8A 4AYVB 2ANWA 3CBYA 4NXQA 1MC7A 3MH5A 3GY8A 2VWMA 2WUBA 1T8LA 1YP9A 2D92A 4GVUA 3TVJB 1LVMA 1QHRB 1TQ7B 1FY8E 1JWTA 4Y8ZA 2Z9LA 1VCPA 3H7TA 3NXPA 4LZ1H 3V12A 2M0UA 5A8ZA 3T26A 2ZDKA 3GY6A 3ZVGA 2IWPA 3SZNA 4A7IB 1TGSZ 2WL7A 1SQOA 1VZQH 1D6RA 5DP8A 1UTPA 2A45B 2OLGA 5HEDA 3FP7E 1ZOKA 3M3VA 5DP7A 4CR5A 5CHAC 1TBRH 4O9VA 5CHAB 4GVDA 1GMDF 3KZDA 1Y5AT 3SU1A 3SW2B 2F9NA 2QBWA 2QV1A 2OS6A 1TP5A 3DFLA 2JILA 1HIAB 3MFJA 1V3XA 1K2I1 4NSVA 4A1XA 3ATKA 5J4QA 3F68H 3KL6A 1K28D 1OP8A 3SO3A 5HGGA 4BAHB 2BY7X 2HNTF 2KOJA 4NNLA 1P09A 1EP5A 2SNVA 5A0BA 1A2CH 1E35B 1WOFA 4JK6A 4UFEH 1V2LT 4ISLA 2BMGB 1TBQH 4ABFA 1W7GH 4JCNA 4R2ZA 1MAXA 1O33A 3B76A 1EAWA 4IN1A 1Z71A 3LPRA 1HJAB 2FYRA 2ZGHA 3KNXA 1IQKA 2HOBA 2O2TA 4YT6H 1TX7A 4GAWA 4CRDA 1TP3A 3OU0A 1SGRE 2ZP0H 1OWKA 1K22H 1YPLH 2B7DH 1TA2A 2TGPZ 1QNJA 2QGRA 4HI3A 1U6QA 2ZHFH 4Q2QA 4JOEA 3LDXH 3SGAE 1EOLA 3PV4A 1KTTB 4FUBA 3PMBB 5G4BA 1HCGA 1XUHA 1TNJA 1AI8H 3EYDA 3S69A 3W95A 4Z8JA 1SGIB 2B5TB 3SOSA 1FDPA 2BDAA 1C5LH 1HPGA 3SNDA 1R6JA 1Q3PA 1SGDE 2QXJA 3MO3A 1KXDA 1N6YA 2ZGXH 2P8OB 3SN8A 3KN2A 2FESH 3O8RA 1TE0A 1W13U 2F9BH 3P8NA 2ZGBH 7ESTE 1CT2E 1TGTA 6ESTA 3K82A 4NG9H 3SJIA 1C9PA 4NMOA 2O8TA 2WPJS 1C5NH 2ZU3A 1GCTB 1LHCH 2OSGA 3FZDA 2WV5A 1A0JA 1C5ZB 1C2EA 2XW9A 3SNCA 4ZKOU 5J4SA 5A09A 1LHFH 1C4U2 2ESTE 2EV8A 2DB5A 4SGAE 2M3MA 1NU9A 3RLYH 5L6NH 1YKTA 3MTYA 1O3MA 1VGCC 1EZQA 1CGIE 1RTLA 4DCDA 3QO6A 2C4FH 1H9HE 1OZIA 2VIWA 3M5OA 1YF4A 3RXHA 1FN8A 1O2TA 3RM2H 3PWCA 1SHYA 2FODA 1G30B 1V2KT 3O8DA 3L3TA 1CHOG 1Y3UA 4HGCA 1O3GA 1YBOA 2W3KA 1D9IA 1K1LA 2ZPSA 4YTAA 1W9QA 1H9IE 4ISOA 1Z86A 4JOJA 1OBYA 5CE1A 2EDZA 1FY5A 1GI9B 5DKMA 1YM0A 3S7HB 1E0FD 1G32B 3NUMA 3FANA 4NMQA 1TX6A 3JZ2B 5T6FA 3UOUA 2ZU4A 5F3XA 1U3BA 2J34A 1N8OC 1UEPA 3UOPA 1N8OB 1D4PB 1ELEE 2Z6BD 4DG4A 1O3PB 3A85A 4K75A 1GBMA 2AERH 2B0FA 3T5FH 2DLSA 2SGFE 1A3BH
chains in the Genus database with same CATH superfamily
4A5TS 5IL9A 1UTJA 5C5OA 4I8HA 3UFAA 2L4TA 1EUFA 1O2KA 4E3BA 2FX6A 1EAUA 4F4OC 1MCVA 2FYQA 1WBGB 2SGAA 5G1EA 1DWEH 4P02A 5DJ7A 2YOLA 1C5TA 4ABJA 1O3FA 5E1YA 2ZC9H 4NA9H 4XE4A 1GI2A 1AO5A 3BG8A 1Y8TA 3M7UA 2EJYA 1F0RA 4NA7A 1TRMA 2GCTC 3BTTE 3F9GA 1ARCA 1OYQA 2TGDA 1NU7B 3M5MA 4F8KA 3TH2H 5IYTA 3PB1E 4ZHLU 3TGIE 4MLFB 2FOCA 4BANB 1S6HA 3SNBA 4AX9H 2KCPA 2BDHA 2R2WU 1O39A 3RXKA 1MZDA 1SQRA 2JXOA 1GI1A 2BDYA 5EQRA 1EPTC 5A8XA 1XUGA 1TBZH 2FE5A 1EPTB 3ATWA 3TIUA 2FOAA 4FU7A 4YM9A 5KGOA 1ZPBA 4M9FA 3RL8A 4BOHA 2QKUA 3MNXA 1WFGA 1VITH 3K6ZA 1CBWC 3E8LA 1Z6JH 2Q6DA 1CBWB 4UFGH 1V2UT 2KJDA 4DJZB 3RLEA 3A8BA 2ANMH 1KDQB 4UU5A 3OAAD 3P8FA 5EIYA 1O2HA 1SMFE 1NF3C 2SGQE 1QL7A 1FY1A 4BAQB 3QJMA 2H9HA 4HZHA 3ZZ7A 1OS8A 1U39A 1FONA 1A5IA 2DAZA 1DY8A 1DXPA 2RA0A 4DT7B 1EP6A 4Y11E 4AGKA 4TY7A 1TFXA 2PGQB 3CENA 2SFAA 2H5CA 3MO9A 1LHEH 2HNTC 3PS4A 1YPEH 2X7ZA 3ZVDA 5LGOA 2TBSA 3STJA 5DN6D 2ZU5A 1K32A 2PTCE 1O2NA 3AW1A 3KQ5A 3E17A 4FUJA 1INCA 3ID2A 2PSYA 1L6OA 4CH2B 1QURH 1UCYH 3CS7A 2A4OA 4OS6A 5GXPA 1SGNE 2ZPMA 2H2ZA 1HXEH 1AHTH 3MNBA 2RRMA 4FGMA 3O5NA 1C5VA 2A5AA 2ZHWH 3ESTA 3MU5A 4NZLA 4ABIA 1O2QA 3UAIC 2XC0A 2YNAA 4D76A 1C5MD 4MNXA 5GIBA 3EGGC 5E2PA 1C2FA 2FI5E 3MU4A 2HVXA 5EW2H 4X1RU 3HATH 2VRFA 1BJVA 2W7RA 1IQIA 2ZDMA 1YYY1 5TCAA 1HUTH 2JJ2D 1OP2A 5FCKA 5C1XA 3UPEA 2LNCA 2OCVB 4DT4A 1NROH 2QYIA 1TA6A 1GMCG 1OHHD 3T62A 2IJOB 2F9VA 5EGMA 1NESE 4FVDA 1N7EA 1O3OA 4H4FA 1O2MA 1XVOA 3RXQA 1K21H 4YZUA 2NU2E 1UVPA 1G9OA 4WXVA 2EEGA 1V5QA 3ZYDA 1FMGA 1BMFD 1HXFH 1GM1A 2QG1A 3F9FA 1A5HA 5EJLA 2RCEA 4OGXA 2GKVE 3TJUA 1MUEB 2UWPA 4AFSA 4XBCA 2EDPA 2KYLA 5JDUB 1S82A 1SOZA 3PTNA 4D7FA 1ESBA 1UVUH 2R0KA 1FPHH 2GV6A 2Y80A 2ZFSA 3SYJA 4INLA 3A89A 3HVQC 1TRYA 2IOTA 5H3JA 4UFDH 4BTUB 4BTIB 3GDSA 2ANKH 2VVUA 3NCLA 1TYNA 3RC5A 3ZVFA 2XCFA 1SI5H 3NFLA 1AD8H 3GISB 1UK3A 1IQJA 1TPAE 1HAVA 1QL9A 4K8YA 3RP2A 3T25A 1GVLA 2AGIX 2WPIS 3CYYA 3L4FD 2OQUA 3RUOA 2ZWLH 3S9AA 4FVBA 2CGAA 2H2CA 2BD8A 4IC5A 1UK2A 4JMYA 2WV9A 3EGKH 3ELAH 2EA3A 5E8EH 1MKXH 3SGBE 1V2VT 4AN7A 2QXGA 1QBNA 2UUKB 1XKBC 3H7OA 3I4WA 1FIZA 3UNQA 1BFEA 1E79D 4Y8XA 2R4HA 1DDJA 1GHAG 4Z0KA 2MHOA 1HBTH 4KFVA 4NIVA 1C5SA 2ZGCA 4INKA 2OXSA 1LQEA 2DE8A 1UVSH 2XNDD 1X8SA 2QT5A 1OXGA 1EJMA 2BY9X 2FM2A 3LOXA 3FP6E 1GCDA 1ZHRA 5K0HA 1K1OA 2CN0H 3OY5U 2ZHQH 1EPTA 2ZHEH 1MABB 1N6XA 3KF2A 1GI5A 3SHCH 3RMLH 4NWLA 5T6GA 4I7YH 1C1SA 5F6MA 3DJ1A 4CR9A 4CRBA 1AE5A 1N7FA 1LKAA 2ASUB 1MBQA 2D90A 2G5VA 2HWLB 4FUFA 1RGWA 1V6BA 1KDQA 2P95A 1PQ5A 1DPOA 2P3UB 2DM8A 3SUZA 1FY3A 2J38A 3QN7A 4Q7YA 3OSYA 2ZNKH 4L8NA 4GVCA 2KM0A 3PMHB 2FLBH 3PLKA 1GJ4H 5EOKA 5AVDA 4K78A 1P04A 2BVRH 1O5EH 2YNBA 1GDNA 1Y5UT 2ZDVH 8GCHG 5GCHF 2I0IA 4CHAC 2ZCHP 3SJ9A 5DP9A 1S0RA 3SU3A 3ID3A 4U2WA 1XMNB 2ZU2A 1BBRK 1O3BA 4GCHF 2G4TA 3LC3A 3QZQA 2ZTYA 4FETA 4JYUH 4B76A 1Y7NA 2PKTA 3I18A 4NNMA 2NU4E 2ZECA 4ZXXH 1NRQH 1P1DA 1NBME 5F67A 1X9ZA 1JOUB 2XTTB 1WG6A 1ESAA 4X0WU 1XUJA 4E06H 1IHSH 4PROA 1DFPA 1EB2A 4WF8A 4KKDA 1BIOA 2HPQH 1KWAA 1OBZA 4X6NA 2SGDE 4O06A 3NK8A 2I6SA 1UTLM 4IGDA 1NRPH 3VGCC 4AGJA 1TPSA 2LC6A 4GSOA 1WV7H 3VGCB 2OPGA 1P1EA 2YT8A 5E21A 1GDQA 3GJ9A 3RXJA 2GZ8A 1JXPA 2BD5A 2W7UA 1BTYA 1F0UA 1O3LA 1MD7A 1UCYE 2FOFA 1BZXE 2FWWA 3IG6B 1HGTH 1K1NA 1MKWK 2G52A 2M0ZA 3I78A 4MDSA 1U37A 3STIA 3SUDA 1P3CA 2H5DA 3SV6A 3MH6A 2V7QD 2ZGJA 1OKXA 2JSNA 1BBRH 3R68A 1Z8GA 2BVSH 4FUHA 1TGBA 1PFXC 1CHGA 1E34B 4NXPA 1HAHH 2PTNA 3O8CA 2HNTE 1QRZA 1ZMNA 1HLTH 4HOPB 1KMHB 1QAUA 1N6DA 1TONA 1UHBB 2CF8H 1ELCA 1G3EA 1ZGVA 1O5FH 1E37B 3EGHC 1GBBA 4H11A 4Y71A 4ISIH 2ZU1A 1ZJKA 1EJAA 4REYA 3BIUH 2WPHS 4Y0ZE 3BTKE 1WFVA 3U8TH 3QIKA 1ZJDA 3RXFA 3EE0B 1CGJE 2GGVB 1Y3YA 2Z9KA 3FKSD 4TY6A 1T32A 5I46H 1P2JA 1TGNA 1FNIA 5GJ4B 1NY22 1RD3B 1O38A 4X6MA 1NN6A 1Z8RA 3VPKA 1GI4A 3HPTB 1GVKB 2JETC 2JETB 1K1MA 1MKWH 1TMTH 4ZKSU 2XCNA 2LPRA 3AK5A 2BDGA 3F2HA 1AZZA 3D65E 1P3EA 1AWHB 4HFPB 5DTHA 3SI4H 4KTSA 5EJZA 1AWFH 2Q1JA 3BEFB 1AUJA 4FUDA 4ZMAH 4WJG2 4AFQA 2OTVA 2OC0A 5EPYA 1A4WH 2H2BA 2CMYA 1C4V2 4LZ4B 1A61H 1GI0A 4KTUA 1XUKA 1ZHPA 3BF6H 3P92A 5E6PB 3TSZA 2EAQA 1A46H 1C2LA 1GPZA 1M9UA 1GHWH 1ZR0A 3OEED 1Q31A 2A1DB 2F9UA 2ZI2H 3URCA 3BTDE 1FCFA 3M7QA 3HGNA 2ZTZA 4NMVA 2R2MB 4B71A 2V90A 1A1RA 2P16A 1C5RA 2BVXH 1GMDG 1J9CH 3CP7A 1A5GH 3KQCA 1W2KH 1C1NA 2FXRA 3N7OA 5ESBA 4JK5A 2FN5A 4NIYA 1O5CB 3RXOA 3SHWA 2J98B 4X8TH 2PDZA 3VG8A 1EX3A 3A83A 3RU4E 4D8NA 2ANYA 1UVTH 1O34A 1ZSLA 2F9OA 2FPZA 1ABJH 1DS2E 1NFYA 2OCSA 2A4RA 2JH0D 3ZZDA 3AAUA 1C1UH 1YCPM 5IK2D 1JMOH 2VWOA 2BD7A 2XWBI 4X1PU 1WCZA 1VITF 3VB7A 1WI4A 1UEZA 3EA7A 4O3UA 2OP9A 1GBEA 4MPAA 3DIWA 1QBOA 1EQ9A 4YO9A 4K3JA 2H3LA 2RFKC 4Y7BA 2BXTH 3M5NA 3RU4D 5AFZH 2V3MA 1B5GH 1BMAA 1O37A 1C5UA 1V2RT 1GHYH 3KQEA 1VJ9U 1GI3A 2TIOA 1MTNC 2KAWA 1F92A 1DANH 1MTNB 1WSSH 2BLQA 1AZ8A 1CO7E 1D3TB 3BSQA 3NWUA 1WHDA 1MFGA 1SFQB 4I8LA 1TLDA 1PDRA 1EFRD 3U8OH 3LGYA 1FC9A 2C90B 2I4SA 1TIOA 5HJ1A 3SORA 1C1PA 1O3EA 1O3DA 4MNYA 2OC7A 2KCYA 2KZ4A 4E34A 3CBXA 4K76A 3DSPA 5EXNA 1MU6B 5FB8C 1XKAC 2GP9B 1OX1A 3LIWA 4X6OA 2K20A 4HOPA 1LVBA 2P59A 3FFGA 3K6YA 1BOQA 1JIMA 1UHBA 4ZUHA 5HFBA 1DWBH 2GT8A 2P94A 4MPUA 1BTZA 1C2KA 2BZ6H 1BTUA 2XBVA 1UJVA 1W9EA 3SNEA 2C8ZB 1FN6A 3RXVA 2BLVA 2A7JA 1HB0B 3QJNA 5DPAA 1O2VA 3LH1A 3SQHE 2AMPA 2NWNA 2CF9H 4ABAA 1HJAC 1SQTA 2YUYA 2TGTA 4X1NU 1DUEA 3L33A 1MAYA 2LUIA 1RZXA 1ZTKA 2B9LA 3PLPA 1WHAA 1SGFA 1QTFA 2Y5GA 1W8BH 4OGYA 5B6OA 2PKSC 1O2YA 2IWNA 4ZXYH 3QGLA 4LMMA 2HGTH 3CC0A 2PKSB 3A80A 1AVWA 2E7KA 3SUEA 1IOEA 2CSSA 4FOUC 4YESB 5C5NA 2FIRH 3GABA 2XNIA 4DIHH 1W0ZU 3DT0H 2GDEH 3PDVA 4YDPA 4OS5A 1GHXH 1O3CA 2W6JD 1VJ6A 1NRSH 3T27A 2VBCA 1MTWA 4ISNA 5LPRA 1I92A 1QCPA 1O3IA 1SSXA 4GPGA 2QA9E 1M5ZA 1G3CA 1WH1A 5G1DA 2BY8X 4X8VH 3UTUH 4H6TA 2DC2A 4OAJA 3DSGA 3QK1A 4YYXA 1SBWA 2PW8H 1GBIA 4OS7A 5DP3A 1MTSA 2K0QA 2L6OA 1GMHF 3BTFE 1TX8A 3A87A 4WYUA 4Q2OA 4O3TA 2R0LA 3Q77A 3OX7U 3O8BA 4FUGA 2P8OC 2ZPLA 4DVAU 3D62A 3RMNH 1YBWA 4I8KA 2QKVA 1QB6A 1SGCA 5F53A 4BTTB 1UTMA 1SC8U 2A5KA 2WPMS 1P01A 3U1IB 1BRAA 1Y5BT 1RS0A 1Z7KA 4ZROA 1V5LA 3Q00A 3H09A 2NU1E 2W4FA 2PR3A 5FX6A 1AB9C 2HALA 1O32A 1GCTC 3N7DA 1AB9B 1TGCA 2J98A 1C2IA 1RGRA 1K9OE 1B7XB 1F5KU 2IN2A 5T1VA 4D7GA 2F91A 3ID4A 2JIKA 2VIVA 1ETSH 1L0ZA 1J16A 2TRMA 3SV9A 3P6ZB 3UQOA 1GQ4A 3AXAA 2EI7A 1EXFA 1YPHE 2J9NA 2EEHA 3FN8A 2I1NA 2O9QA 3MH4A 1MQ5A 3E0NB 1SLWB 3VB6A 4UFFH 4DW2U 1MBMA 2XC5A 2VINA 2AMQA 1S0QA 4IN2A 4WMFA 1G3DA 1S85A 2KOMA 3M61U 3RC6A 2HRVA 1HJ8A 1UJDA 2A31A 4BAOB 1O2OA 1C2MA 1BA8B 9ESTA 3GCHC 1DUAA 3MWIU 3MNCA 3GCHB 1AU8A 4R8TB 2EXGA 3P95A 2YT7A 3RXBA 3BIVH 3WY8A 2Z3CA 1ZTLA 1KEFA 2BXUH 1P02A 4I32A 3ZZ3A 1ZUBA 1DWDH 1K1JA 4LXBH 4DGJA 1HIAA 2GX4A 4B2BA 2AMDA 1QZ8A 2BY5X 3L6PA 1LPKB 3LC5A 3TU7H 1LTOA 4NMPA 4OS2A 2DMZA 4MQAA 3ZZAA 1C9TA 4JZIA 4Q2KA 1ZPCA 1ZHMA 1HAXB 1LQDB 3D23A 3A7XA 1DICA 1W0YH 1EZXC 1KY9A 1QQUA 4HTCH 1V2QT 3U1JB 1U38A 2I6VA 1TB6H 2B8OH 2NU0E 1KSNA 2D8WA 1WQVH 3A86A 1O31A 2AYWA 2GTBA 1C5OH 1T4VH 3N7EA 1TNHA 2BX4A 4Q6HA 3DJAA 4JOFA 1UM7A 2FOHA 3G01A 1VJAU 3ZVAA 5L30H 2ZDLA 2ZFPH 2XYAA 1TPPA 2KX4A 1DITH 5L2ZH 1QB1A 2BOKA 1N6EA 4NGAH 4AB8A 1O2ZA 5C2ZA 1ORFA 1AGJA 1SGFG 3SQEE 4IS5A 2F43B 1AE8H 3TMHA 2AEIH 4TWYA 2PNTA 2EC9H 4NA8A 3FAOA 1Q3XA 1B0EA 3F0OA 1XX9A 4BNRA 2QF4A 1AKSB 3EAJA 2MX6A 2WV4A 5FBEA 2UUYA 1Q7XA 1CVWH 4MPVA 2LOBA 2WPLS 2H9EH 2VH0A 3MH7A 3RL7A 1SFIA 2KOHA 1GBDA 2ZF0H 3BTEE 3DA9B 4WH8A 3GCTF 2PSXA 3PROA 1CT0E 3UR9A 3V0XA 2J95A 1J14A 1DXWA 3KDKA 1C2DA 2QN5T 1L1GA 1AFQB 2XRCA 4HG6A 2PGBB 2YTWA 1SLVB 3V3MA 3BV9B 1O5DH 4WXIA 2YUBA 1HDTH 1PPBH 3KCGH 5DP6A 4RSPA 2Q9VA 3ZZ5A 1RY4A 5EJ1A 3PO1C 1IQHA 1UVOA 3PO1B 2FNEA 5ILBA 1C1QA 5DP4A 5C20A 1O0DH 3SI3H 4BXSA 4MPWA 2J4IA 2JWEA 5EODA 3VXFH 5HYOA 1DE7H 5C67A 1GI8B 1OWHA 5HFCA 5F03A 5FHTA 2JH6D 4ABHA 1BJUA 5HM9A 2FZZA 3SZEA 1P57B 3RXTA 2P3FH 2STAE 5JBTA 4P0CA 2OZFA 2HLCA 1YPKH 4X8SH 2FOEA 4JOGA 3RMMH 3SV7A 5C0TA 2FS8A 2Y81A 3R3GB 1BUIA 2BHGA 3HK3B 1AMHA 1EATA 4B73A 5B6LA 2BY6X 1ANEA 2ZFRH 1KLJH 2BQWB 1ACBE 1GBTA 4I31A 2M5TA 4RT0A 1B0FA 2JH5D 3LGUA 5FBIA 1W3CA 1VCWA 4OEOA 1WQSA 2GJGA 3CNRA 2DE9A 1VB7A 4B6EA 3SU2A 3A7YA 3F2GA 1QRXA 6GCHF 1OOKB 3GOVB 2BZAA 1OBXA 1WIFA 3GYMA 1PPHE 3K2UA 5EQQA 1E36B 1BTWA 3GY2A 5HETA 1F5RA 1MFLA 1JIRA 1S83A 1TNGA 4UONA 2VNTA 3BTQE 3TGKE 1O30A 3VB5A 4Z1MD 4XRNA 1G2LA 4ASUD 1FI8A 3LT3A 3FP8E 1PPZA 3F9HA 4IMZA 3BEIB 1IHJA 5DO4H 2STBE 4FUCA 1O3HA 4FUIA 1WDIA 2VGCC 2G4UA 5ESTE 3MU8A 1P8VC 2VGCB 2WPKS 3QX5H 3C1KA 3ZYEA 3SBKA 1A3EH 2ZZUH 3BTWE 5GCHG 4NCYA 3NRLA 1CA8B 1V2MT 5GLJA 2HLDD 2HPPH 3Q76A 4ZHAA 4A1VA 3DSOA 4GCHG 2DJTA 3K1RA 7LPRA 4NSYA 1Z1IA 3TSVA 3OTJE 4I33A 1LMWB 2GCHF 1HAZB 3RXRA 4WVPE 4JZFH 2QKTA 3EE7A 1GBAA 1D3QB 1IQNA 4A92A 1PPCE 2ZFTA 1SGYE 1YGCH 5HEBA 1FJSA 1LDTT 1V2JT 1KIGH 1AY6H 1CA0C 1S81A 4WYTA 1CT4E 1CA0B 3LGTA 4ACAA 2AH4X 4B2CA 4JL7A 1O2IA 1AKSA 2HE2A 4NMTA 4YOIA 1Z87A 5C1YA 4YOJA 3LH3A 5E0HA 2KR7A 2V3HH 2KV8A 4U32A 2J97A 1LPGB 3TJVA 1ANDA 3BTHE 1SVPA 1NFWA 2AWWA 5TJXA 3PYHA 3E1XB 3DD2H 2RG3A 1HAYB 1YY3A 4Q3HA 1NT1A 4YOGA 1UTQA 3RC4A 1ZRKA 2BX3A 8LPRA 2ZKSA 1JRTA 4UD9H 3V7TA 5FCRA 1V6DA 1TQ3A 3RU4T 2VSVA 3B9FH 5IDKA 1G3BA 1QR3E 1ID5H 2GZ9A 5HXFA 1O35A 1WTGH 1WTHD 5I7ZA 4DURA 3HPMA 2AGGX 3MI4A 1SGEE 4TSFD 3U9AH 1QAVB 4KP0A 3T28A 3GY7A 1QFKH 1BDAA 2UUFB 2PUXB 2PWXA 3RXSA 4BXWA 3SV2H 2XBYA 1OYTH 2JKHA 3RDZA 1O2SA 3F1SB 1WJLA 2VIOA 3IITA 4I8GA 1D3DB 3SFJA 1MMJN 1T8OA 3W94A 4EDJA 5JB9S 1LO6A 4E35A 4IBLH 1HAPH 3URDA 3ODFA 1OWEA 1A0LA 1TALA 3MNSA 5DP5A 2O8WA 1BRUP 4XD7D 1GJ8B 2THFB 2H1UA 4RKJB 1S84A 2ZCLP 2KCAA 1B8QA 1ZMLA 1NBMD 4RKOB 2GEFA 4Z6AH 1IQFA 2BLWA 3K65B 4AG2A 1F0TA 1C5YB 1HAIH 3EDXB 3E6PH 4O03A 1QA0A 1XVMA 4E7NA 4DIIH 1E1RD 1TMUH 3RXMA 3SU4A 1F5LA 2ZTXA 2FCFA 5AHGH 1L1JA 1TABE 3AW0A 2A4GA 4K69A 4WY3A 2G81E 2QF0A 1KTSB 3EA8A 1UTKA 1BHXF 2ZA5A 4DY7B 5BPEA 4X2VA 2O8MA 2G5NA 4K6YA 3VB3A 3DFJA 2FLRH 2AIQA 7GCHF 1YLCA 2Z7FE 1UEWA 1BRBE 1NRNH 4RI0A 3NCVA 2A0QB 1DSTA 1NTPA 2WHXA 3SU6A 3GCOA 3WW7A 3TJNA 4AG1A 1H8HD 2OBOA 1GL0E 2Z94A 1BQYA 1UO6A 3GY5A 1K1IA 1WXRA 1KXBA 4E7RG 2W5EA 3M36A 2Z9JA 1ARBA 2EGOA 3ENSB 2P93A 5E11A 2IJD1 3U8RH 1QRWA 3A7ZA 1RIWB 1ZMJA 2K1QA 2V6NA 3RXCA 2ULLA 1GJ7B 1ZTJA 2BD2A 2FMJA 2PZDA 2A7HA 2SNWA 3A81A 4LK4A 4X6PA 2EEKA 4A1TA 3QE1A 2SGPE 2G2LA 1UITA 3ATMA 1P9SA 3S9CA 1V2ST 4FLNA 2QAAA 4B1TA 4P00A 2Z3DA 2VIPA 4IMQA 1W12U 1W10U 1T31A 2F83A 2P3TB 1X5QA 1J15A 3ZVEA 1KLTA 2FOMB 1VITG 2ZIQH 1YPHC 3MU1A 4I86A 4CBOA 1IAUA 7KMEH 1UJ1A 2G55A 1P11E 1PJPA 1T8MA 2KFWA 1T8NA 2VJ1A 3R69A 1DOJA 4NIXA 3CS0A 1NFUA 4J1YA 2VU8E 4X8UH 2PV9B 2ILNA 2IPQX 2XBXA 1X5RA 2G00A 2V3OH 4CBNA 2VWLA 1JBUH 2FX4A 1ELDE 1SGQE 1BMLA 3M35A 2M0TA 4RN6A 3VB4A 3I1EA 1O2XA 4CRAA 3NPSA 2OD3B 1ANBA 3VEQB 4J2YB 3TGJE 2F4LA 3MMGA 1QIXB 1P2KA 1YLNA 3NZIA 5H4IB 3F0PA 4AYYB 3UIRA 2IPHA 2AWXA 3ZRTA 1KYNA 1V2PT 1DWCH 1NO9H 2A2QH 2OUAA 3LONA 3M5LA 2BDIA 2FTLE 5FPTA 5JXBA 3VQGA 1G9IE 1C1OA 1HYLA 4TPYA 1N7TA 2V35A 4TWWA 2BQ7B 1XZ9A 3E16B 2ODQA 1EAIA 4X1QU 1TNKA 3ZZ6A 2UZCA 5AF9H 1DY9A 2O8LA 3MHWU 4BAMB 1IQEA 2F3CE 2VPHA 3TK6A 1MQ6A 1ELGA 5HEYA 3PRDA 4CREA 1IU2A 2UWLA 2C3SA 1MU8B 1V2WT 5HFEA 1DSUA 4GHNA 5JBCS 3AAVA 3RMOH 4Y76A 2KCOA 1AIXH 1S6LA 1MTUA 1Y3VA 1GL1A 2ZCKP 1K0HA 2L97A 2M10A 1DX5M 1SQAA 3UQVA 3LGVA 1ZYOA 2AWUA 1GGDC 2J94A 4Y7AA 1THSH 1QJ1B 3PTBA 1ANCA 2J2UA 1C5WB 1GGDB 2Q3GA 3A8DA 4VGCC 5E0GA 3TJOA 2H9TH 1P9UA 4VGCB 4OEPA 4MNWA 3UNRA 3SV8A 1Z6EA 3KZEA 2VIDA 1XM1A 1L4DA 1G36A 2K1ZA 3WKMA 2Y7XA 4ZKRU 1EASA 3HKJB 3HPKA 3UNSA 1THPB 4X2YA 2PLXA 3UY9A 1GMHG 5CMXH 4XBBA 5JBBS 1FXYA 2CJIA 5C0UA 3PM3A 5EW1H 4WMDA 2ZDAH 2G51A 5E0JA 4OM9A 2BQ6B 1O3JA 1GHBF 4OS4A 3WKLA 1BT7A 4Y0YE 2VWNA 4ABGA 1GJDB 3QWCH 4K1TA 2Y7ZA 1HJ9A 3M37A 2FTMA 3DJ3A 1C1RA 1RTFB 3O46A 4CRCA 1EZUC 1BBRE 1UTOA 1QA7A 2JREA 5EU8A 1GJ6A 1IQLA 4NXRA 1O3KA 4IC6A 1SB1H 3N99A 5HFDA 2J5UA 2WSSD 3ATIA 1TOMH 3SGQE 9LPRA 2KJPA 2PKUA 1XXFA 1OPHB 2Z9IA 2EQNA 4WMEA 5EG4A 2WYJA 3KIDU 1P12E 1TQ0B 2QCYA 5AFYH 1TNLA 2HE4A 1W9OA 1YLDA 1P10A 4E05H 1P05A 1UHPA 1NC6A 4CH8B 5FPYA 4NMSA 2ODPA 3UWJH 1MTVA 1SLUB 1KXEA 1HAOH 1BTPA 1A7SA 4NFEA 5F8XA 1NM6A 4U01A 1BHXB 1RGQA 3GDVA 3TH4H 2ALVA 1D3PB 4MVNA 4AZ2B 1NS3A 3LNYA 1H1BA 3MQKC 2Y82A 4I8JA 1UMAH 2YMSC 2IWQA 2L74A 4INHA 4K2YA 5EXLA 4KTCA 2YMSB 1GWAA 1GBHA 4AC9A 3MO6A 3A8CA 2EDVA 2EI8A 1WF7A 3T2NA 1OWDA 2VSPA 3GY3A 2A4QA 3JZ1B 4XBDA 3S0NA 2XBWA 4XHVA 2FS9A 5FPSA 5T6DA 2BTCE 3ZVCA 4MNVA 1XUFA 3M3SA 2Q6GA 3M7TA 2QE7D 5GNDA 2F5YA 4IW4E 4FXGH 3E91A 3RM0H 1AN1E 3WWFA 4A6LA 1W14U 5L2YH 3RXUA 3MOCA 4R0IA 3D49H 2HGAA 5BRRE 3Q3KA 2A7CA 1NPMA 4FUEA 1RRKA 5PTPA 1CQQA 1SOTA 2VVVA 3EQ0H 3Q3XA 1NFXA 1EKBB 4CRGA 3F3BA 1C2GA 3GYLB 4Q7ZA 3A7VA 1J17T 5FAHA 3PDZA 1F7ZA 1C1MA 1LVYA 1C2HA 4G69A 4ESTE 4Q6SA 1RXPA 2WZQA 3ZV9A 2EGKA 3ZZ9A 1BTXA 4B6FA 4JYTA 1Q2WA 3ZZ4A 1QGFA 1SGPE 1GI7B 4KFWA 3ZZCA 4ABBA 1VGCB 3SU0A 5A0AE 1BMNH 3KQDA 2BD4A 3P8GA 1ABIH 2G8TA 1C1TA 1FUJA 3LGWA 1P2MA 4SGBE 4Q2NA 4GLYA 3UR6A 3I29A 1GJ9B 5ETXA 1IHTH 1PPEE 5ABWA 1W0JD 2AIPA 3K50A 1UM1A 1O3AA 1IQMA 3A88A 2CSJA 1W7XH 1CSOE 4RT1A 3GCTG 3A84A 1VKYA 1MH0A 4YLUA 4N6XA 4Q63A 1ZRBA 3KHFA 1O3NA 4MTBA 2ZHDA 1UTNA 2BD9A 1L2EA 4WWYA 4H42U 4U30A 3RXLA 4YT7H 4K1SA 1V2TT 2KG2A 2EEIA 2ZEBA 1AVXA 4WH6A 5DK1A 2W3IA 2FEQH 1LPZB 1YCPK 2OQ5A 3OE7D 1FC6A 1V62A 3RXIA 3OFND 2C93B 4FU9A 4TT3D 1FPCH 2CV3A 3BPUA 3BN9A 4ABEA 1TWXB 3FVFB 1C5XB 1TNIA 2H6MA 5C3NA 2ZDNA 4Y79A 5JB8S 1GBLA 1HAVB 5LH8A 2BLOA 3OEHD 2XXLA 3M3TA 4MPXA 3GDUA 1T7CA 1Y3WA 4ZAEA 1MCTA 2QY0B 2TPIZ 1Q3OA 4GUXA 2KAIB 1GJAB 3GICB 2A5IA 3NGHA 2GCTB 2V0BA 3I77A 1EZSC 2FI4E 1FX0B 2VB0A 3E90B 2C8WB 2XC4A 2CHAC 2D8IA 2FI3E 1CHOF 4ASHA 1FZZA 2CHAB 3ID1A 5HM2A 1ZSJA 2F9PA 2EHRA 2Y5FA 2BYGA 1P2QA 1T4UH 1T2MA 1ZLRA 3NFKA 1O2JA 4K8BA 4UE7H 5GPIB 1UCYK 2F0AA 4X1SU 1TAWA 5EXMA 3QDOA 4YLQH 2JDID 1OWJA 1PYTC 1AFQC 1YPGH 2XOKD 3A7TA 3S7KB 3TLOA 3TPIZ 3PMAB 5A2MH 1SR5C 3F9EA 6GCHG 1L1NA 5CDFE 1QBVH 3SUFA 1N99A 3R0HA 1P06A 2OC1A 2ODYB 1YCPH 3ITIA 5GDSH 4ZH8A 1COWD 3DCLA 3EA9A 1BE9A 2DKRA 3GGEA 1XUIA 1Z8IB 4X2XA 5HIZA 5HMAA 3W1EA 4ABDA 2XWAA 1O2WA 1EAXA 1X45A 1V2NT 1OP0A 1H8IH 2I0LA 4K1EA 1GG6C 1KXFA 4M7GA 1JRSA 1GG6B 5DSFA 2C8XB 4FU8A 2FOGA 1EB1H 2VZ5A 2VIQA 4JJ0A 4CRFA 2QF5A 1UFXA 3TK9A 2VH6A 2BDBA 2ZPRA 5E2OA 2OINA 1S5SA 3UUZA 1QLCA 4Q7XA 3PWBA 5EPNA 2OQSA 5JPMH 5I25A 3PMJA 3QUMP 4Q80A 4JOKA 2LP6A 2FP7B 1GBJA 2GCHG 3TNTA 4JOHA 4K5ZA 4XSKU 1HRTH 4TPIZ 1TRNA 1D6WA 2Z17A 3TSWA 4GHQA 4AFZA 4ACBA 1E38B 1RFNA 3PLBA 2QIQA 1OWIA 1WYKA 2J92A 3DORA 1TOCB 3AVZA 4ZHMU 2V1WA 3RXPA 1X7AC 3MYWA 2CXVA 1O2LA 1X6DA 2PUQH 5A0CA 4GHTA 1VCQA 8ESTE 4UEHH 5HFFA 1SHHB 2BYAX 2PKAB 2ENOA 3P8OA 1AFEH 2ALPA 1WI2A 1GHZA 3QTOH 5KEDA 1MKXK 1BCUH 3UREA 1QY6A 2GDDA 4B75A 2ZQ2A 2Y5HA 1PPFE 2R3YA 3WWBA 5DG6A 3CBZA 1GDUA 3F2FA 3RXGA 3RLWH 2YMSD 2KBSA 4D9QA 4JJ3A 2GZVA 1DLKB 1IU0A 2QF3A 1K1PA 3U98H 2UWOA 3F6UH 6CHAC 1FIWA 2BB4A 2UUJB 4XDEA 3TNSA 6CHAB 1P2IA 2DUCA 2D26C 4H6SB 4F49A 1ELFA 3SJKA 1Y59T 2CS5A 1AQ7A 5HF1A 2ZG0H 1J8AA 2GVFA 1WU1A 3KYFA 3KEEA 3JXTA 2D1JA 2DLUA 3ZV8A 1N6FA 1THRH 3QGNB 1PQAA 1SPJA 1ZOMA 2WPDD 3S9BA 2IWOA 4XFQA 1N1LA 1P0SH 1YPJH 2AS9A 4MG3A 1YWUA 3QGJA 1GVZA 1PQ8A 1O2PA 4Q2PA 4AORA 1SGTA 4K60A 3GSLA 2KAIA 4JORA 3NKKA 1QB9A 1HAGE 3KGPA 1GQ5A 1RTKA 1DT2A 1C1VH 4NZQA 3KHVA 1GBFA 2WUCA 4BAKB 1ZZZA 1GMCF 3GY4A 2PFEA 1DM4B 2I6QA 3RXAA 1NZQH 3DHKH 2JINA 3FY5A 2QXIA 3Q3YA 2AINA 1QL8A 3QZRA 3P70B 4ZKNU 1C5PA 1TPOA 1LVOA 3DUXH 2VWRA 1ZPZA 3FOAA 1GBCA 1RJXB 4YXWD 5C1UA 1UK4A 7GCHG 2ZQ1A 2K8IA 5SGAE 1BB0B 8KME2 3MU0A 2G5MB 5FL7D 1G37A 1X5NA 2KRGA 1OSSA 2KJKA 1F0SA 2JJ1D 5HF4A 2I04A 1C5QA 1HV7A 1SL3A 1AVGH 2BOHB 5A2PA 3BTME 1V1TA 2GD4B 5DGJA 6LPRA 1LCYA 1O2UA 1BITA 1CGHA 1ELBA 2EI6A 2ZPQA 3AASA 1VAEA 1KXAA 2GT7A 5A8YA 1IQGA 3BTGE 1UW7A 2QC2A 1GI6A 3SUGA 2CK3D 3KQBA 4CHAB 1C4Y2 2FO9A 3VFEA 1FC7A 3B23B 1GJCB 4D9RA 2KA9A 2Z3EA 2M0VA 2LA8A 1O5BB 4JYVH 2GV7A 2PP6A 2GMTC 1LKBA 5JBAS 2KL1A 2GMTB 1VA8A 3QTVH 2KPLA 3LGIA 5JYIA 4B74A 3GCNA 1MZAA 3TK5A 1H8DH 1DLEA 2ZFFH 5FXLA 1GHAF 5GWZA 3SOEA 3C27B 5D13A 1GBKA 3HKIB 3P17H 2PA1A 5CHBA 1BRCE 1FV9A 2RCZA 1F2SE 2ZFQH 5LPFA 1ELTA 2FOBA 1YPMH 2ZO3H 3LJOA 2H3MA 5K7RA 3BG4C 2NU3E 1ESTA 4XOJA 1EJNA 3BG4B 4JZ1A 4Y10E 5EZ0A 1HNEE 2LELA 1GHVH 2PKAA 1KXCA 3E3TA 2BM2A 1WUNH 1WF8A 2OGPA 1C1WH 1PQ7A 1P2NA 1H4WA 4LOYH 2AGEX 3SJ8A 1O2RA 1PYTD 1QJ6B 4TYDA 2BDCA 3LU9B 1NRRH 2REYA 5EQSA 1QJ7B 4UU6A 2PHBA 1NTEA 3U69H 3ODDA 5F8ZA 3RXDA 1O5AB 1RIWC 2EY4C 8GCHF 3KYGA 1FAXA 4JZEH 1ETTH 1GJ5H 1V2OT 3HGPA 4ISHH 3BEUA 3QDZB 2EEJA 4JOPA 1LHDH 3E0PB 2R9PA 2RA3A 5TCCA 1BTHH 1VR1H 1Z1JA 5T3HA 1DVAH 3T29A 3V13A 4AFUA 2P3WA 4Y8YA 5HDYA 3ZZBA 3OYPA 3SHUA 4AMHA 3VQFA 3RXEA 2BD3A 2SGEE 4B2AA 1UJUA 2TGAA 1FQ3A 4NFFA 4ZCNA 5E22A 3SJOA 3OTPA 1W11U 3IWMA 5EYZA 2D2DA 3TITA 4NIWA 2OMJA 1CU1A 1ETRH 3ZZ8A 2R3UA 4OS1A 2OC8A 3SU5A 1YC0A 5F8TA 2AFQB 2JOAA 1UEQA 1LHGH 3PV5A 1C2JA 3SNAA 1UF1A 3A7WA 3LKWA 2KQFA 1Y3XA 2A2XH 3HK6B 4NWKA 5FX5A 4F55A 1O2GH 2KPKA 4K72A 4AB9A 1SLXB 1W0KD 3CH8A 1D5GA 1PPGE 2FDAA 1FLEE 2VVCA 1CE5A 1KLIH 2WINI 1XXDA 1P03A 3R0FA 3ZVBA 5LPEA 2Y6TA 4Y6DA 3A82A 3FZZA 2O8UA 3UWIA 1O36A 2Q6FA 3OY6U 3PV2A 1ZGIA 3H5CB 3K9XB 3LJJA 2WYGA 2GZ7A 4X2WA 1L4ZA 4UDWH 1FY4A 4THNH 4Z33A 3QLPH 1AUTC 1I16A 1S6FA 1QAVA 4NMRA 1P2OA 1Z8JB 2LC7A 4KELA 3VXEH 4O97A 2L4SA 2A32A 1GHBG 3ATLA 1O5GH 4PQWA 2OBQA 2Z9GA 1ELAA 2W7SA 3SHAH 1H9LB 4AOQA 4JZDH 1ELVA 2C8YB 1QQ4A 1BMMH 1GJBB 3LNXA 4QT8C 4KGAA 3TH3H 2QXHA 3A8AA 1HFDA 1FAKH 4DOQA 2RDLA 1WAYB 1SG8B 1TMBH 3FO8D 1G2MA 2W26A 1ZSKA 3B8JA 2EGNA 1EOJA 1A0HB 4P2AB 1MD8A 4AYVB 2ANWA 3CBYA 4NXQA 4Q4LA 1MC7A 3MH5A 3GY8A 2VWMA 2WUBA 1T8LA 1YP9A 2D92A 4GVUA 3TVJB 1LVMA 1QHRB 1TQ7B 1FY8E 1JWTA 4Y8ZA 2Z9LA 2JIZD 1VCPA 3H7TA 3NXPA 4LZ1H 3V12A 2M0UA 5A8ZA 3T26A 2ZDKA 3GY6A 3ZVGA 2IWPA 3SZNA 4A7IB 1TGSZ 2WL7A 1SQOA 1VZQH 5HIYA 3PRBA 1D6RA 5DP8A 1UTPA 2A45B 2OLGA 5HEDA 3FP7E 1ZOKA 3M3VA 5DP7A 4CR5A 5CHAC 1TBRH 4O9VA 5CHAB 4GVDA 1GMDF 3KZDA 1Y5AT 3SU1A 3SW2B 2F9NA 2QBWA 2QV1A 2OS6A 3UB0A 1TP5A 3DFLA 2JILA 1HIAB 3MFJA 1V3XA 1K2I1 4NSVA 4A1XA 3ATKA 2AHME 2HVYB 5J4QA 3F68H 3KL6A 2W6ID 1K28D 1OP8A 3SO3A 5HGGA 4BAHB 2BY7X 2HNTF 2KOJA 4NNLA 1P09A 1EP5A 2SNVA 5HKKD 5A0BA 3GS9A 1A2CH 1E35B 1WOFA 4JK6A 4UFEH 1V2LT 4ISLA 2BMGB 1TBQH 4ABFA 1W7GH 4JCNA 4R2ZA 1MAXA 1O33A 3B76A 1EAWA 4IN1A 1Z71A 3LPRA 1HJAB 2FYRA 2ZGHA 3KNXA 1IQKA 2HOBA 2O2TA 4YT6H 1TX7A 4GAWA 4CRDA 1SKYE 1TP3A 3OU0A 1SGRE 2ZP0H 1OWKA 1K22H 1YPLH 2B7DH 1TA2A 2TGPZ 1QNJA 2QGRA 4HI3A 1U6QA 2ZHFH 4Q2QA 4JOEA 3LDXH 2OK5A 3SGAE 1EOLA 3PV4A 1KTTB 4FUBA 3PMBB 5G4BA 1HCGA 1XUHA 1TNJA 1AI8H 3EYDA 3S69A 3W95A 4Z8JA 1SGIB 2B5TB 3SOSA 1FDPA 2BDAA 1C5LH 1HPGA 3SNDA 5C94A 1R6JA 1Q3PA 1SGDE 2QXJA 3MO3A 1KXDA 5B42A 2RDEA 1N6YA 2ZGXH 2P8OB 3SN8A 3KN2A 2FESH 3O8RA 1TE0A 1W13U 2F9BH 3P8NA 2ZGBH 7ESTE 1CT2E 3KDGA 1TGTA 1E1QD 6ESTA 3K82A 4NG9H 3SJIA 1C9PA 4NMOA 2O8TA 2WPJS 1C5NH 2ZU3A 1GCTB 1LHCH 2OSGA 3FZDA 3ZIAD 2WV5A 1A0JA 1C5ZB 1C2EA 2XW9A 3SNCA 5KECA 4ZKOU 5J4SA 5A09A 1LHFH 1C4U2 2ESTE 2EV8A 2DB5A 4SGAE 2M3MA 1NU9A 3RLYH 5L6NH 1YKTA 3MTYA 1O3MA 1VGCC 1EZQA 1CGIE 1RTLA 2M2AA 4DCDA 3QO6A 2C4FH 1H9HE 1OZIA 2VIWA 3M5OA 1YF4A 3RXHA 1FN8A 1O2TA 3RM2H 3PWCA 1SHYA 2FODA 1G30B 1V2KT 3O8DA 3L3TA 1CHOG 1Y3UA 4HGCA 1O3GA 1YBOA 2W3KA 3U28C 1D9IA 1K1LA 2ZPSA 4YTAA 1W9QA 1H9IE 4ISOA 1Z86A 4JOJA 1OBYA 4F48B 5CE1A 2EDZA 1FY5A 5C17A 1GI9B 5DKMA 1YM0A 3S7HB 1E0FD 1G32B 3NUMA 3FANA 4NMQA 1TX6A 3JZ2B 5T6FA 3UOUA 2ZU4A 5F3XA 1U3BA 2J34A 1N8OC 1UEPA 3UOPA 1N8OB 1D4PB 1ELEE 2Z6BD 4DG4A 1O3PB 1H8ED 3A85A 4K75A 1GBMA 2AERH 2B0FA 3T5FH 2DLSA 2SGFE 1A3BH
chains in the Genus database with same CATH topology
4A5TS 5IL9A 1UTJA 5C5OA 4I8HA 3UFAA 2L4TA 1EUFA 1O2KA 4E3BA 2FX6A 1EAUA 4F4OC 1MCVA 2FYQA 1WBGB 2SGAA 5G1EA 1DWEH 5DJ7A 2YOLA 1C5TA 4ABJA 1O3FA 5E1YA 2ZC9H 4NA9H 4XE4A 1GI2A 1AO5A 3BG8A 1Y8TA 3M7UA 2EJYA 1F0RA 4NA7A 1TRMA 2GCTC 3BTTE 3F9GA 1ARCA 1OYQA 2TGDA 1NU7B 3M5MA 4F8KA 3TH2H 5IYTA 3PB1E 4ZHLU 3TGIE 4MLFB 2FOCA 4BANB 1S6HA 3SNBA 4AX9H 2BDHA 2R2WU 1O39A 3RXKA 1MZDA 2JXOA 1GI1A 2BDYA 5EQRA 1EPTC 5A8XA 1XUGA 1TBZH 2FE5A 1EPTB 3ATWA 3TIUA 2FOAA 4FU7A 4YM9A 1ZPBA 3RL8A 4BOHA 2QKUA 3MNXA 1WFGA 1VITH 3K6ZA 1CBWC 3E8LA 1Z6JH 2Q6DA 1CBWB 4UFGH 1V2UT 2KJDA 4DJZB 3RLEA 3A8BA 2ANMH 1KDQB 4UU5A 3P8FA 1O2HA 1SMFE 1NF3C 2SGQE 1QL7A 1FY1A 4BAQB 3QJMA 2H9HA 4HZHA 3ZZ7A 1OS8A 1U39A 1FONA 1A5IA 2DAZA 1DY8A 1DXPA 2RA0A 4DT7B 1EP6A 4Y11E 4AGKA 4TY7A 1TFXA 2PGQB 3CENA 2SFAA 2H5CA 3MO9A 1LHEH 2HNTC 3PS4A 1YPEH 2X7ZA 3ZVDA 5LGOA 2TBSA 3STJA 2ZU5A 1K32A 2PTCE 1O2NA 3AW1A 3E17A 4FUJA 1INCA 3ID2A 2PSYA 1L6OA 4CH2B 1QURH 1UCYH 3CS7A 2A4OA 4OS6A 5GXPA 1SGNE 2ZPMA 2H2ZA 1HXEH 1AHTH 3MNBA 2RRMA 4FGMA 3O5NA 1C5VA 2A5AA 2ZHWH 3ESTA 3MU5A 4NZLA 4ABIA 1O2QA 2XC0A 2YNAA 4D76A 1C5MD 4MNXA 5GIBA 3EGGC 5E2PA 1C2FA 2FI5E 3MU4A 2HVXA 5EW2H 4X1RU 3HATH 2VRFA 1BJVA 2W7RA 1IQIA 2ZDMA 1YYY1 5TCAA 1HUTH 1OP2A 5FCKA 5C1XA 3UPEA 2LNCA 2OCVB 1NROH 2QYIA 1TA6A 1GMCG 3T62A 2IJOB 2F9VA 5EGMA 1NESE 4FVDA 1N7EA 1O3OA 4H4FA 1O2MA 1XVOA 3RXQA 1K21H 4YZUA 2NU2E 1UVPA 1G9OA 4WXVA 2EEGA 1V5QA 3ZYDA 1FMGA 1HXFH 1GM1A 2QG1A 3F9FA 1A5HA 2RCEA 4OGXA 2GKVE 3TJUA 1MUEB 2UWPA 4AFSA 4XBCA 2EDPA 2KYLA 5JDUB 1S82A 1SOZA 3PTNA 4D7FA 1ESBA 1UVUH 2R0KA 1FPHH 2GV6A 2Y80A 2ZFSA 4INLA 3A89A 3HVQC 1TRYA 2IOTA 5H3JA 4UFDH 4BTUB 4BTIB 3GDSA 2ANKH 2VVUA 3NCLA 1TYNA 3RC5A 3ZVFA 2XCFA 1SI5H 3NFLA 1AD8H 3GISB 1UK3A 1IQJA 1TPAE 1HAVA 1QL9A 4K8YA 3RP2A 3T25A 1GVLA 2AGIX 2WPIS 3CYYA 3L4FD 2OQUA 3RUOA 2ZWLH 3S9AA 4FVBA 2CGAA 2H2CA 2BD8A 4IC5A 1UK2A 4JMYA 3EGKH 3ELAH 2EA3A 5E8EH 1MKXH 3SGBE 1V2VT 4AN7A 2QXGA 1QBNA 2UUKB 1XKBC 3H7OA 3I4WA 1FIZA 3UNQA 1BFEA 4Y8XA 2R4HA 1DDJA 1GHAG 4Z0KA 2MHOA 1HBTH 4KFVA 4NIVA 1C5SA 2ZGCA 4INKA 2OXSA 1LQEA 2DE8A 1UVSH 1X8SA 2QT5A 1OXGA 1EJMA 2BY9X 2FM2A