3GCNA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with omp peptide (yqf)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
300
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Mechanisms of allosteric activation of the DegS protease by OMP-peptide binding and protein-substrate binding
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 300
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcnA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA01
2K1ZA 1KEFA 2CMYA 3R0FA 2ZHEH 1IQGA 3S7KB 3KQCA 1Y3YA 2RA3A 4FUFA 2BYGA 2G4TA 1W2KH 5E2OA 1UCYK 1XVMA 3HKIB 1TMUH 3JZ1B 1L6OA 8ESTE 2YNBA 2PW8H 3AXAA 3MH6A 1RIWC 4K75A 4AN7A 1C4U2 1N6DA 1O2MA 1MBMA 4ZKSU 4Y7AA 1ANBA 1C5TA 1GBDA 1SGFA 4OS2A 1X5RA 1GBHA 1UHPA 2A4RA 1OWKA 2B9LA 3P8NA 3ZZ5A 3M36A 3TH2H 3SJIA 2DC2A 1Z7KA 1TP3A 2CSSA 1AN1E 3A7WA 4YLQH 1CVWH 3IITA 7GCHF 1O3JA 2ZTZA 5T6GA 1MU6B 2QKUA 3M5NA 1WI2A 2VIPA 3BEFB 2J38A 1C1UH 3SUDA 1A1RA 1CA0C 3OYPA 2TGAA 2QG1A 1HRTH 1DT2A 2LOBA 5LPRA 4LMMA 2OGPA 1UEZA 2ZP0H 2ZDVH 3U69H 2M10A 1GI0A 2W7UA 4NMVA 4X6NA 2EGNA 3M61U 1BTUA 4IGDA 1MQ5A 2VVVA 2HGAA 1BBRK 1Z1IA 2L97A 2Y5FA 1MAYA 2JXOA 2VSPA 2V3OH 3ZVGA 5GWZA 4JOFA 1TQ0B 2ZTYA 2G51A 4NMPA 2DB5A 2H5DA 1D3DB 2F9PA 3FP7E 2YUBA 1Q3OA 1FC6A 3H5CB 3VFEA 5JPMH 1YCPK 1GJ6A 4LOYH 1SPJA 1GMCF 5J4QA 1SG8B 4NMTA 1V2VT 1BRUP 4QT8C 3RXSA 1AO5A 1Q31A 3UREA 1JOUB 1P02A 2F91A 1O5AB 1IQMA 1GMHF 1RY4A 2O8WA 5CHAC 1V2WT 1N99A 4AFQA 1QBVH 1P04A 1ZZZA 1L1JA 1CO7E 4BTTB 2ZFSA 3P17H 2EEGA 3BTQE 1H8DH 2G5NA 1HXFH 2I0LA 4H6SB 1X7AC 4BTUB 2H3MA 1T2MA 1UFXA 3TJVA 2F9VA 1ZPBA 5FB8C 3MU5A 3BTDE 3LT3A 5C5OA 4BXSA 1E0FD 1C1PA 3EA9A 2FTMA 4TY7A 1KXFA 3SW2B 5GPIB 3W94A 2EDPA 1ELBA 1TYNA 2PKAA 4ZXYH 2EDVA 3GICB 3UQVA 1LVOA 4JORA 4DOQA 3NZIA 1C2LA 4K5ZA 1OWEA 4UE7H 3V3MA 4I32A 3R3GB 1GHAG 2R3UA 1C5XB 3AW1A 2BZAA 3E16B 4XE4A 1GQ4A 1SLVB 2EEHA 1ELDE 5C3NA 5E0JA 1G2MA 1GBLA 2VIOA 4MPUA 1G2LA 2ESTE 1LPKB 1XKBC 2PUQH 4ABDA 4JZDH 2Y82A 1O5GH 3ITIA 2PKSC 3PDZA 2FLBH 4CRFA 4UFEH 3FANA 4ZXXH 2IWNA 1W9QA 1DM4B 1FY8E 1O37A 3HATH 5B6OA 2VGCC 2JETC 4BXWA 3M7TA 1UF1A 3HPTB 1UTLM 5EQRA 5EU8A 3R68A 1QL7A 1M5ZA 1X6DA 4RKOB 4X1QU 2QF0A 3OTJE 5L2ZH 4Y8YA 5CMXH 1EAIA 2CSJA 1K1MA 2OC1A 2VWOA 3PO1B 1GJ9B 2QAAA 2Q6GA 4JOJA 2ZGHA 5FXLA 1V2NT 1ZSLA 3ZZ8A 1LMWB 3A80A 1TB6H 4OS1A 3PMHB 4D9QA 1P05A 1ZPZA 4GHQA 5AFYH 1H1BA 2RG3A 1F0SA 1ZTJA 1A4WH 2QIQA 2ZFFH 1F5LA 2QV1A 1QQUA 3HGPA 3MMGA 1N7FA 5GLJA 1TNKA 4JYTA 1KXAA 3QIKA 2Z9KA 3GY2A 1UVUH 1TP5A 3RM0H 2FWWA 1WOFA 2ZDMA 5EYZA 3BTGE 2R0LA 3AAVA 2J95A 1OWIA 2ZWLH 5GIBA 3FVFB 1SOZA 2AGIX 3MYWA 3RMMH 2ALPA 3KCGH 3V12A 4OAJA 1ANCA 2EEKA 1NFXA 2SNVA 3A82A 4FGMA 2Y5HA 3SNDA 1MQ6A 2UWOA 5EZ0A 1GI3A 3GY4A 2V90A 2TRMA 4AGJA 3MH7A 6LPRA 3SN8A 1V2PT 1P9SA 4J2YB 1C1MA 4B74A 1K1PA 1GBIA 2I6SA 1FI8A 1WF7A 2C90B 8GCHG 4ABGA 1N1LA 3TGIE 1JBUH 4XDEA 5E8EH 1NRNH 4INKA 5LPEA 5JXBA 1GBFA 4MNVA 3SU0A 3GCTG 3ZVCA 3LC5A 3Q3KA 2BLWA 2DLSA 2B0FA 4AYVB 1QB9A 1IQJA 1WSSH 5C1XA 2D90A 1PQAA 1YF4A 1FONA 1QURH 1GG6B 3TVJB 4O03A 5AHGH 3K82A 1GMCG 5C2ZA 1F92A 1W8BH 9LPRA 1GMHG 2YUYA 2FO9A 3DJAA 3I77A 1D3PB 3BG4B 1MD8A 3MNCA 3K6ZA 4I8KA 4AX9H 4ZHMU 4DIHH 3I78A 1TNGA 5E6PB 2KQFA 3NUMA 4Y11E 1GCDA 3K6YA 1SB1H 3RU4D 5I46H 3VXFH 5HETA 3CS0A 1BIOA 6CHAB 2SGQE 1AKSA 3DIWA 1GBTA 5A2MH 3KZDA 4ABIA 3SJKA 5T6DA 3B9FH 4WMFA 1O2HA 1E34B 1ZHRA 2BY5X 2KOMA 1UTNA 2BX4A 4NFEA 1C5VA 3ZVEA 4Y6DA 3VEQB 1TE0A 4BNRA 1O2WA 1DFPA 2EV8A 1KXEA 1O3FA 1C2EA 1PPCE 1TONA 3FZZA 3T25A 1A3BH 1CHOF 4Q7ZA 4WYUA 1E35B 3QGLA 4K8BA 5DP3A 2EEIA 1UM1A 2CV3A 3KQDA 1HDTH 1V2TT 1D3TB 2ULLA 1TGSZ 1TQ7B 3GYLB 2F5YA 3S9CA 1S0RA 2A4GA 1TRMA 2PGQB 3SHAH 4WF8A 1GCTB 3SI3H 1G9IE 4X1RU 5H4IB 1YPMH 2ODPA 1LVBA 3WY8A 2LC6A 1M9UA 3UUZA 4TWWA 1FPCH 5GJ4B 4OEOA 1LVYA 1N8OC 1YP9A 4WMDA 1UK4A 4OEPA 4MLFB 1Y59T 1P1DA 2SFAA 5F6MA 1EJMA 3DT0H 3SV9A 1PQ7A 2GKVE 1V5LA 2PDZA 1C5LH 2RCZA 4ISHH 3S9BA 1C1WH 1GL1A 2WINI 4YO9A 3EA8A 4JYVH 1BT7A 1QAVA 5G1DA 1O5CB 1UVPA 3A88A 4GAWA 4JZIA 1ELTA 2KYLA 1EJNA 2H3LA 1O3AA 1DY9A 5D13A 1J17T 4CHAB 2GZVA 4AYYB 2ZPLA 1ZRKA 4EDJA 1SQTA 1VB7A 3RXMA 4XSKU 2H9EH 1LHDH 1EZSC 2B5TB 2DMZA 4NMSA 4AG2A 2VRFA 3SHUA 2BDBA 1CGIE 4K78A 1XUKA 4IW4E 2Z7FE 2QXJA 4XFQA 3I29A 2G5MB 3LKWA 3R0HA 4YM9A 4Y76A 1K1LA 3U9AH 3KIDU 1U39A 1GHZA 1SGCA 3SQHE 2SGDE 1HB0B 1AVGH 4BTIB 1T4UH 1G37A 5IYTA 2BLVA 2Z9JA 1NRRH 1H9IE 1O35A 2AEIH 4FUEA 1EP5A 6GCHF 2P59A 3L6PA 4E06H 2PZDA 3VB3A 3RXVA 1ZOKA 2BQ7B 4BOHA 1OBZA 3WKMA 4FUCA 1VGCB 3RXQA 2FOHA 1TPSA 2FLRH 5HFEA 2VINA 5A8YA 2SGPE 2R0KA 3ZRTA 1BTZA 2ZDKA 2VWNA 2TPIZ 3BEUA 5FBIA 4WVPE 3TJUA 4UD9H 3ZV9A 1VITH 1ZRBA 2H9HA 1ELEE 4NIVA 2VNTA 3A7YA 1Y3WA 4E35A 2UZCA 4K2YA 1BMLA 1O2NA 2BD3A 1O2ZA 1G9OA 1FN8A 1NS3A 1SFIA 2AINA 4KP0A 1RGRA 1TALA 1TMBH 4YTAA 2BVSH 1X5QA 1EJAA 1GJAB 1O3EA 1RTFB 3STIA 5HYOA 1UO6A 4WMEA 3RL8A 1TOCB 2OC7A 1PQ5A 4X1PU 5C20A 1U3BA 1LPZB 3MFJA 1SR5C 4FUBA 1EKBB 1QHRB 3PROA 2ZCLP 1XX9A 4HI3A 3BTEE 1P3CA 3M3SA 1OBYA 1GL0E 3O8BA 3BV9B 4AFUA 4TPYA 5JYIA 4I8HA 1A0HB 3KF2A 1IQFA 2M0VA 2IJOB 1F5RA 1NRPH 4DG4A 1W7GH 3RXUA 1P2JA 4NGAH 3ZZ6A 2O8TA 3CP7A 4WXIA 1Q2WA 3QZRA 1KY9A 1Z6EA 1C1RA 1CHOG 3D62A 3RU4T 2A2XH 2ANWA 3EGKH 1MKXK 4THNH 4Y0ZE 5PTPA 1LTOA 2FYRA 1OP2A 2H2BA 3B23B 5HDYA 4AORA 5BPEA 1BJUA 2HNTC 1QL8A 3TJNA 1DX5M 2TBSA 1VCWA 1J14A 3TSWA 4BAHB 2W7SA 1LHEH 1C1TA 2PSYA 1C2MA 1OS8A 4Y79A 2GZ7A 2PTNA 2KJKA 2OD3B 2I6VA 1WCZA 2ZFRH 1EAXA 1BQYA 4UDWH 2ZO3H 1ZMNA 2EC9H 2CXVA 2SGAA 2BTCE 3OTPA 4JOHA 1IAUA 1TGBA 1PQ8A 2NWNA 2P93A 2O2TA 3GY5A 2ANKH 2AGGX 3EGHC 2XCFA 1V5QA 1JIRA 1VZQH 1IQEA 1GDUA 2HLCA 2VVUA 1YM0A 2WPMS 1GBCA 3E90B 3CENA 1S0QA 1SGNE 2J92A 2P16A 1UJDA 3AASA 4KFWA 1IHJA 1O5BB 1VITF 3SHCH 4NSYA 1EPTA 1KYNA 2OXSA 1FQ3A 3KQEA 2BD5A 1XXDA 2BY8X 1V6BA 1O2LA 4NNLA 3BIVH 1SGDE 2A5IA 2ZHWH 3UNSA 1T32A 4X0WU 1GHYH 1AKSB 2A2QH 3SU4A 4CRDA 2FNEA 2IWPA 1CU1A 4SGBE 1KXDA 5HFCA 4XOJA 1LO6A 2Y5GA 6GCHG 3H7OA 3SJOA 3B76A 2BD2A 1KTTB 1F0TA 3RXHA 2ZI2H 1IQLA 3AAUA 1BTHH 3QK1A 1P57B 3RXRA 5C67A 5DTHA 1SVPA 2PHBA 2PWXA 3I18A 2W3KA 2WPJS 1AVXA 2BY9X 2VGCB 2PLXA 1Y8TA 1W0YH 3ATKA 1J15A 3F9EA 1PDRA 3RXDA 3ZZ7A 2O8LA 3SNAA 3LGTA 3STJA 3P70B 3A8CA 1P09A 3GCHB 1O2PA 1YPHC 4AFZA 1AB9B 1T7CA 3M5MA 3RXEA 2DLUA 4Q2QA 1BUIA 1NRSH 4I33A 1FPHH 2V35A 1BCUH 3Q76A 2FI5E 4Z8JA 1LHGH 2Q1JA 1ABIH 3TJOA 3RDZA 4FUJA 2J4IA 1UITA 1FY1A 5DP5A 5GCHF 4GHTA 1DS2E 4PROA 1SBWA 3SUZA 1QAVB 5ESTE 4RN6A 1QNJA 1JMOH 3A86A 4HTCH 1C1SA 2PSXA 1FNIA 4ISOA 3GY6A 1UJUA 3ODDA 1C9PA 3PMBB 3MO6A 2A5KA 2FM2A 2YT8A 1C2GA 4F4OC 1SL3A 1UVTH 2Z9LA 2OS6A 2OQUA 2ZPQA 5AVDA 1S6FA 3LJJA 2FI3E 4JZEH 1TNJA 1HFDA 2Y80A 2VIQA 2XTTB 1OX1A 2Y6TA 1EZQA 3RXAA 1CA8B 2GV6A 1UCYH 2FPZA 2ZFQH 2DE9A 2ZA5A 4D7FA 1OPHB 2JOAA 3VXEH 1HJAB 3B8JA 3M3TA 2ZGXH 1BDAA 2FP7B 1GI9B 1TWXB 2R2WU 3SV6A 1BTYA 3E0PB 4GLYA 4O3UA 2WPLS 4YLUA 2P3TB 5SGAE 1DPOA 1XUGA 2A4QA 1UVSH 1S5SA 4CRGA 2OP9A 4WY3A 1DE7H 1RGQA 1HAHH 3URDA 2EHRA 1OYTH 1K2I1 2ZC9H 1JWTA 2EGOA 4FXGH 2JILA 3A7TA 3FY5A 4Y10E 2X7ZA 1GI4A 2VB0A 2Z3EA 1HGTH 2P8OC 1AD8H 1UHBB 2ZQ1A 3FP8E 3EQ0H 3PV4A 2M0UA 1O33A 4MG3A 1C5RA 2F0AA 1V2MT 1LCYA 1FJSA 3MU0A 4NXRA 4U2WA 3DFLA 3F9FA 3O8CA 2BVXH 1GBBA 1V2UT 3UWJH 2STBE 2IOTA 3LU9B 4A1TA 1GI8B 1BBRH 1GGDC 1DOJA 2FESH 1SI5H 2XBXA 4WXVA 4MPAA 4CBOA 5HFFA 1V2ST 1A46H 2CF9H 1MTVA 2I1NA 1ZGIA 3BG8A 1V2KT 1GDNA 3NCLA 5JB8S 2Z3CA 4P2AB 1VITG 4IS5A 1WI4A 3RXKA 4XHVA 1HLTH 2AH4X 2EAQA 1YPJH 1OXGA 1YKTA 1YCPH 3K50A 3KZEA 1SGQE 2IPHA 5BRRE 1DWCH 1K21H 1O0DH 2JH5D 1OZIA 1WIFA 1O3NA 2FOMB 3KEEA 4WYTA 3T62A 4U32A 4ABEA 4BAQB 1O34A 3QX5H 1CBWB 1HXEH 1GBMA 1Z71A 2C3SA 3BTFE 2ZU3A 1S82A 3SGBE 1TQ3A 1D6RA 2XNIA 1AZ8A 5EQSA 1XMNB 4H42U 5G1EA 3QUMP 3RLWH 5AFZH 3RU4E 3UR9A 3TK6A 1U37A 1N8OB 3ZZAA 2FOEA 1SQOA 3URCA 1W7XH 3BPUA 2ZPMA 4DY7B 4JOKA 2PFEA 4MPXA 2QXGA 4JOPA 1FLEE 4NIYA 1Z8RA 3QTVH 5HF4A 1F5KU 3ZVBA 1DLEA 3DFJA 4TY6A 2H6MA 1X45A 4TYDA 3TK5A 2ZZUH 3TSZA 1AFQB 1ESTA 1BFEA 1Q7XA 1BB0B 4IC5A 2W4FA 1GJ7B 1DDJA 4Y0YE 5EXLA 3UIRA 1QJ7B 4H6TA 1ABJH 1WQVH 3KL6A 4R0IA 3VB5A 3DUXH 2ZIQH 4Z33A 4WJG2 2EI6A 1MU8B 4K1SA 4B73A 4CRAA 3UQOA 1GJBB 3EDXB 3MWIU 3O8DA 2OZFA 2LC7A 3OY6U 1EXFA 3P92A 1N6XA 2QCYA 3Q3YA 1XUJA 1JXPA 1XUFA 4IN1A 2ASUB 2XC4A 3MNSA 2OINA 1UK2A 3U8RH 2AGEX 2NU2E 3EA7A 3SZNA 1P11E 3QJMA 5T6FA 1UTOA 2UUJB 1K1JA 3S69A 2CHAC 1CT0E 3QGNB 2BXUH 1EPTB 2XC5A 2ODQA 1G36A 1G30B 3PLKA 1T8NA 1YPEH 4VGCC 4K76A 4NZLA 1NO9H 4X6PA 3GY8A 3CBYA 3MI4A 1UTMA 2BMGB 2V3HH 4GVUA 1C2IA 2REYA 2MX6A 4ABFA 3ZYEA 3ID4A 2ANMH 2GD4B 2NU1E 1KLIH 1ARBA 1GDQA 5EQQA 3ATWA 7GCHG 1UEQA 2H1UA 3GY7A 3ZZBA 1W9OA 3LGVA 2HPQH 2SGFE 4ZH8A 4Q80A 3TK9A 1Z8JB 2ZGCA 4X2YA 3KQBA 4DGJA 1GI5A 4BAOB 5F3XA 1SLXB 4DURA 3MH5A 2AMDA 4ISIH 1HAZB 3QE1A 1HIAB 1O39A 2K20A 4NA8A 5DP9A 1LHCH 4MQAA 1MKWK 4K1TA 4HOPB 1HPGA 1L2EA 1MUEB 1C5OH 3LGYA 4X2VA 1V2LT 1ETRH 2BD4A 3KHFA 1O2UA 1VJ6A 2Y7ZA 3ZZ4A 3A81A 1YPKH 4MNYA 4MPVA 1FY5A 1QJ6B 1OYQA 3QJNA 1OWHA 2E7KA 1NU9A 2Q6FA 5GDSH 2KPLA 3WKLA 3U1IB 1AMHA 2XBYA 1WV7H 5HEDA 1W9EA 3JXTA 3RXCA 1MTNB 4DJZB 1ARCA 4GPGA 1GJCB 1WHDA 1NFYA 1FDPA 1VA8A 1TIOA 1VJAU 4KTUA 2L4SA 5C1UA 3DD2H 5EPYA 1WBGB 5EGMA 1RTLA 3T27A 2OTVA 1K9OE 1O2KA 1KXCA 2ILNA 2HVXA 1MFGA 1XKAC 3DA9B 2QBWA 2OC8A 1V1TA 3SU1A 4NMOA 2QT5A 1ANEA 1V2QT 2A7HA 5HJ1A 4Q3HA 2ZDNA 3EE0B 3M7QA 1NM6A 1EAUA 5FX5A 3PTNA 1HV7A 3VB7A 3A85A 4IMQA 4RI0A 2FS9A 3A8AA 5HFBA 4NZQA 1WTGH 1WFVA 3SUEA 3PTBA 1VCPA 1TMTH 3RP2A 5ETXA 3ZZ3A 4JZFH 2I4SA 4U30A 4B1TA 1ANDA 2P95A 4I8JA 5DP7A 1NRQH 2I0IA 2O9QA 2VU8E 1CT2E 3NK8A 5LPFA 1SLWB 2ODYB 1SSXA 4P0CA 5FPYA 2GCTB 1YYY1 3RXIA 1P06A 1IHTH 3FP6E 2VPHA 1V62A 1O3KA 4FVBA 3SGAE 2M0ZA 1GVZA 4NA7A 4X8UH 2H2CA 2ZDLA 2HE4A 4MVNA 3RM2H 3SO3A 2LPRA 4O3TA 1MC7A 1MZDA 4AOQA 1C2KA 4ABJA 4TWYA 3LOXA 3OX7U 4Y8ZA 1GJDB 1WYKA 2XCNA 2UWLA 1UEWA 1QIXB 4O97A 3E17A 2KPKA 4CREA 2C8ZB 2DUCA 3ESTA 3QLPH 3VGCB 4B2BA 2FCFA 1UM7A 1DSTA 1T31A 1O3PB 1TA2A 4Q7YA 1P2NA 1B8QA 1GJ5H 3E6PH 3QTOH 3ZVFA 3ZZ9A 1D3QB 1DICA 4ABBA 1V2JT 3ENSB 4FUGA 5K7RA 1HUTH 2KV8A 4CRBA 4ISLA 1W14U 2HNTF 3S9AA 2XBVA 1BITA 4X6MA 5DGJA 1DWEH 1UTQA 4HFPB 2VH6A 3DJ1A 5F8ZA 1ELCA 1QRZA 3BTWE 4B71A 1EQ9A 1O2GH 1ZOMA 4ABHA 4H11A 1AE8H 2G8TA 1C2JA 4HGCA 2M3MA 2VSVA 1MH0A 1DANH 1MZAA 1SLUB 4BAMB 1UTKA 1C2HA 3E91A 3HK6B 2VWRA 1QA0A 2W7RA 2BDIA 2H9TH 2WYJA 3O46A 3E3TA 3SNBA 3SV8A 1G3CA 3V13A 1LDTT 2QKVA 1U38A 1ZHMA 2C8YB 4HZHA 1A7SA 1HAIH 2FYQA 1T8LA 3NKKA 1B5GH 2A31A 2EJYA 1HAVA 1FY3A 2Z9GA 3SV7A 3T29A 1QRXA 3VPKA 2NU0E 4CR5A 1ELAA 2THFB 2AIPA 1X8SA 1QY6A 1EASA 2GMTB 2Z17A 1F2SE 2D8IA 2JH0D 4FU9A 3UFAA 5FCKA 2GTBA 1SGEE 1WG6A 2QA9E 3CBZA 1UHBA 3V7TA 4E7RG 1GI7B 3CS7A 1ZLRA 2YTWA 3QO6A 2BDHA 2W3IA 5HM2A 3GDVA 3ZZDA 1L4DA 1XUIA 1O3MA 3MU4A 1UK3A 1RIWB 2D2DA 1B7XB 1HJ9A 1SHYA 3HKJB 1THPB 3BTHE 2UUKB 3G01A 3M37A 3UNRA 3UY9A 1N6YA 2RDLA 2Q3GA 1C5UA 1RTKA 2ZPRA 1QBNA 2FOAA 2CN0H 5A0CA 1KSNA 3LNYA 4A1XA 4H4FA 2F9OA 2G5VA 2OQ5A 4IN2A 5K0HA 2OCSA 1RD3B 4X8SH 5JB9S 1CGHA 1GI2A 2V0BA 1TA6A 2EXGA 4OS7A 4A6LA 4O06A 2FDAA 3BEIB 1CA0B 3P6ZB 4K3JA 3LNXA 2BY7X 1TNIA 3HK3B 4NA9H 3DJ3A 2TIOA 3RMNH 2OCVB 4UFDH 1H8IH 1E37B 1O5DH 2WUBA 2ZGJA 2GT7A 4KTCA 3VB4A 4XBCA 4L8NA 1CQQA 1A3EH 2HPPH 1TX7A 1PFXC 1INCA 2QF3A 1FUJA 5G4BA 3Q00A 1GHXH 2YT7A 3KNXA 2UUFB 1SGRE 2ZHFH 4Q6HA 5I25A 5A2PA 1GG6C 1CGJE 1O2VA 2B8OH 1TX6A 1ETSH 2OC0A 3SGQE 2QGRA 4K69A 2XXLA 2JH6D 1NT1A 5FHTA 1BHXF 1DY8A 2HOBA 3I1EA 1GGDB 5HF1A 1MD7A 3ZVDA 1Y7NA 3VQFA 4K72A 5TCAA 1RRKA 3BG4C 1D4PB 2OMJA 3LH1A 4TPIZ 5EW1H 4Q7XA 1GM1A 1C4Y2 1P01A 5DK1A 2WV5A 1C4V2 2CF8H 1BJVA 2RCEA 2CS5A 3RL7A 1HAGE 5CHAB 3ID1A 4Q2PA 1Z87A 2JKHA 2AWWA 5DP8A 2QXHA 5HM9A 6CHAC 4OGYA 1OWJA 3TLOA 3EGGC 1TPOA 1NPMA 3KHVA 4NSVA 5L6NH 1Y3VA 1BTPA 3RC5A 7ESTE 1QFKH 4E3BA 1UCYE 2FOFA 4D7GA 4X8VH 4NNMA 1W13U 5DP4A 3UWIA 3Q77A 1C5MD 2EEJA 3RXLA 1FC7A 1O2RA 1V2RT 3ZV8A 2C4FH 1OP8A 4GVCA 3MTYA 2J2UA 3C1KA 2XW9A 3W95A 2NU4E 2Z94A 3A87A 3RMOH 1NN6A 1TABE 3UPEA 1VAEA 3QN7A 1O2JA 1ZTKA 2CJIA 2GDEH 1GCTC 1QAUA 2EGKA 2J9NA 5HXFA 3S0NA 2A32A 3V0XA 3RXGA 1VJ9U 3RUOA 1ZGVA 1T8MA 3N7OA 1WF8A 1DVAH 4IMZA 4Y7BA 3TSVA 3MH4A 5FPTA 3U1JB 1PJPA 1P2QA 6ESTA 2V1WA 4YZUA 2XBWA 2FTLE 2SNWA 2L4TA 3D23A 1C9TA 2BOKA 1IQKA 5J4SA 2FOGA 3PWCA 1SGFG 1C5SA 4OS6A 4GCHF 5HMAA 3QGJA 2PKSB 4JCNA 1WFGA 2XYAA 1FV9A 1BBRE 1GVKB 2Q9VA 1SHHB 2JETB 4ZKOU 1TFXA 1EATA 2D8WA 2O8MA 1GPZA 2DM8A 4G69A 4GHNA 3BTTE 2D26C 4WH8A 4NCYA 4Z6AH 4CHAC 1X5NA 1D9IA 1GHBF 1ETTH 1BRAA 5FPSA 3U8OH 1HIAA 1R6JA 1AHTH 1ELVA 1BE9A 1RFNA 1WTHD 1DSUA 3GY3A 2WV4A 3RXTA 4UFGH 3RLYH 4HOPA 1I16A 4I8LA 3RXOA 1TBZH 3RXBA 4KKDA 5DKMA 2BX3A 2HGTH 3E8LA 3TH4H 1RS0A 2PR3A 2KJDA 1TGTA 3LONA 1J9CH 1TBRH 1S81A 5E0HA 4A7IB 3PWBA 3T28A 1A2CH 1F7ZA 3UTUH 2J94A 2BYAX 4NIWA 4LZ4B 2DE8A 1MBQA 2ZFTA 1OKXA 3NWUA 1DWBH 2OSGA 5EXNA 1A5IA 5AF9H 3A7XA 2BLOA 1C5PA 3QDOA 3ELAH 1TPPA 3TPIZ 1QB1A 7KMEH 2ZU2A 5DJ7A 1ELGA 2A0QB 3IWMA 4J1YA 4DIIH 1W0ZU 4JZ1A 2KL1A 1C5NH 1OBXA 5E0GA 2DKRA 1N7TA 3A83A 2FIRH 1IU0A 1EP6A 1SMFE 1GVLA 2FOBA 1RXPA 1KXBA 3SJ9A 1K1OA 4INLA 9ESTA 3PYHA 3ATMA 1AVWA 1JRSA 3E0NB 1HCGA 1ZMJA 2BDCA 2OPGA 5L30H 4ZHLU 2GZ9A 1OOKB 2Z3DA 4ZUHA 1GMDF 2GV7A 2JIKA 2WYGA 3BIUH 2P3FH 4D76A 4Q2OA 4AB9A 1P8VC 1I92A 1ELFA 1FN6A 4MNXA 1G32B 1QCPA 5GXPA 4KELA 1HAVB 1XVOA 2I04A 3TMHA 1WU1A 1KDQA 1O2YA 1O2IA 3HVQC 4AGKA 3K65B 1XXFA 3OU0A 2A45B 2D92A 1UTPA 5EODA 1KIGH 5A8ZA 3U98H 2KJPA 1GBJA 8KME2 1P3EA 1PYTD 1L4ZA 3GJ9A 4JOEA 1YLDA 3LC3A 5H3JA 4NMRA 4Q2KA 1NF3C 4A5TS 1ZYOA 2STAE 1F0UA 4UONA 1RJXB 4NXQA 1IU2A 5C5NA 1J16A 5C1YA 3SNCA 3GDUA 3TU7H 3UOPA 3A7VA 3SU5A 1Z86A 2QN5T 4A92A 1TRNA 4F49A 3PDVA 1O2XA 3T2NA 4MPWA 4MTBA 1O36A 4YOJA 1AZZA 1AE5A 5F8XA 1WHAA 1FAKH 8GCHF 1L1NA 1N6EA 5FX6A 3IG6B 1C1OA 3CH8A 2JINA 3A8BA 3F9HA 1QGFA 1MTSA 5EW2H 2F9NA 4AG1A 4Y8XA 1P10A 2I6QA 5A0BA 3QDZB 3GCTF 4JK5A 5E2PA 1H9HE 1O5FH 8LPRA 2O8UA 1O2TA 5DP6A 1RZXA 2ZTXA 5DG6A 3GGEA 1YPLH 3SJ8A 1TAWA 2GCHF 1LKBA 1DWDH 3K9XB 1FZZA 3UR6A 1LQEA 2A7JA 4IC6A 4UFFH 3HPKA 1GWAA 1QA7A 4GCHG 4U01A 3SV2H 2R2MB 1PPEE 1C1QA 4K60A 2EA3A 1D6WA 1DXWA 4UU6A 5F8TA 3K1RA 1O2OA 1YC0A 2PKTA 1P1EA 1W3CA 2D1JA 2HNTE 1MTUA 4INHA 4B75A 1W12U 1AWFH 1ZJDA 2PKUA 2MHOA 2AWUA 1P2MA 1TLDA 1GHBG 2HE2A 2VH0A 2ZEBA 2XWAA 4MNWA 4X2XA 1QR3E 2FX4A 2NU3E 4MDSA 1AY6H 1F0RA 5E22A 3SORA 5EPNA 1W10U 4XBDA 3MO3A 1C2FA 2ANYA 2BDAA 5GNDA 2Y81A 1UVOA 2R4HA 1HBTH 2FOCA 2AERH 2AIQA 4CH2B 2G81E 3SQEE 4R2ZA 1Y5AT 1SFQB 5GCHG 1P12E 1T8OA 2GP9B 4ISNA 1W11U 4GVDA 1RGWA 4JYUH 4BAKB 4X1SU 1KLTA 4NFFA 1BRBE 4B2AA 1DLKB 4JK6A 4ASHA 5JBTA 3H7TA 1WH1A 4YYXA 4B76A 2A5AA 4NMQA 3K2UA 2ZGBH 2P94A 4PQWA 1XUHA 4YT6H 3KGPA 4DW2U 2V6NA 4BANB 2BY6X 4NG9H 4E7NA 3RLEA 5LH8A 4X6OA 2Q6DA 1THRH 1O3HA 3GCHC 4FU7A 2VWMA 2VWLA 1AB9C 3MO9A 2CGAA 3MOCA 2FMJA 2EI8A 3A8DA 1IHSH 4AB8A 3VQGA 3ODFA 5T3HA 4KGAA 1ZSKA 4OS5A 2F9UA 1GMDG 4NXPA 1C5YB 2ENOA 1E36B 3GOVB 1ZSJA 4LXBH 3HGNA 3OSYA 4REYA 4Z0KA 2LA8A 5E1YA 5E21A 2KOJA 2ZDAH 1HAXB 1XZ9A 1Y3UA 3BTKE 1K22H 4M7GA 3BF6H 1K32A 2M5TA 1A0LA 4K1EA 1SGTA 1GBAA 2JWEA 1YPHE 1O32A 3A89A 2PA1A 1GJ8B 3SU6A 1ZUBA 1NZQH 4X8TH 1BMAA 2ZPSA 1ACBE 2OBOA 3T5FH 1BZXE 1LKAA 2Z6BD 2KBSA 3NFKA 1GJ4H 1A0JA 1HAPH 1XM1A 3MU1A 2IWOA 1LQDB 2ZKSA 3M3VA 3QWCH 2F83A 1QB6A 1C5ZB 1BTXA 1MKWH 2BD7A 2P3UB 3F68H 1CSOE 2C8WB 3RC4A 1DUEA 1ORFA 2SGEE 3ATLA 4AFSA 2C93B 3RXFA 3TNSA 2BZ6H 2PV9B 7LPRA 1SOTA 1P9UA 1QBOA 2BHGA 2ZU1A 1HJAC 1WUNH 2TGPZ 1ZR0A 4FUDA 1A5HA 1V3XA 1PYTC 1BRCE 1EAWA 4K8YA 5TJXA 1J8AA 4FVDA 2BM2A 1DUAA 4F8KA 1TNLA 3ATIA 1G3BA 1OP0A 5IDKA 1TBQH 1SGYE 1Z6JH 2KRGA 1MCVA 4N6XA 4FU8A 4D8NA 1ZTLA 2QXIA 2GCHG 4YOGA 3BSQA 1AI8H 5FAHA 2G00A 3GISB 1PPFE 5EXMA 2VIVA 1FIZA 1VR1H 2WPHS 2QY0B 4Q6SA 1Z8IB 1O3CA 4R8TB 2PGBB 1BMNH 2HRVA 4DVAU 4RKJB 4ZHAA 1P2IA 3DORA 1O38A 2KOHA 1SGPE 4ZKRU 1CE5A 2TGDA 2BQ6B 4DCDA 3E1XB 3P8OA 2KAIA 3UNQA 1ID5H 1KDQB 2M0TA 1O3LA 3LGIA 5CE1A 2KAWA 1AU8A 3ZZCA 1OWDA 4CBNA 1H9LB 3F6UH 1H4WA 3L3TA 3PV2A 2OQSA 1O3DA 4DT7B 1NESE 1YCPM 1YBOA 1LPGB 1P03A 3P95A 3NGHA 1S84A 2VVCA 2ZHDA 1AUTC 2A4OA 2FODA 2Y7XA 3PLPA 4I31A 2BVRH 3NFLA 2W26A 3FAOA 4KFVA 3CC0A 1HJ8A 4ESTE 1CBWC 1QJ1B 3EAJA 1C1NA 1Q3XA 2BQWB 2BB4A 1GHVH 1PPHE 3D65E 1DITH 2A1DB 4X1NU 3BTME 2WPKS 2AWXA 5EG4A 5ESBA 3TH3H 3VB6A 3BN9A 3O8RA 3F9GA 2OLGA 3D49H 2GZ8A 1AUJA 2UWPA 3Q3XA 1G3EA 4GUXA 2KA9A 1KWAA 2ALVA 3PLBA 4JOGA 1HAYB 2F3CE 3O5NA 3SNEA 1FMGA 1NTPA 1NY22 1P0SH 1WAYB 2FEQH 2PTCE 2ZF0H 4LZ1H 3EYDA 3NPSA 2GVFA 3U8TH 5E11A 1A5GH 1Y5UT 2QYIA 1FXYA 4CR9A 1AFQC 2IN2A 2F9BH 2ZG0H 5JBAS 3M5LA 4UU5A 1BOQA 1NFUA 1Z8GA 2XC0A 1DXPA 1S6HA 2PUXB 1PPZA 3LGUA 1ZPCA 4CRCA 2QC2A 1EZXC 2XRCA 5F67A 1L0ZA 2KG2A 3L4FD 2HWLB 3PO1C 1O3OA 5A0AE 1QL9A 1B0EA 3ID2A 1UEPA 2AFQB 1L1GA 1WQSA 1BHXB 2AYWA 1AFEH 5A8XA 3R69A 4LK4A 1THSH 2BD8A 4JMYA 3GYMA 1EPTC 5DPAA 1MAXA 2PKAB 2H2ZA 3A7ZA 5FBEA 1BTWA 3F1SB 1MMJN 4A1VA 3S7HB 2VJ1A 3SI4H 3GCOA 1G3DA 2OUAA 4YT7H 1CT4E 3ID3A 2LUIA 4XBBA 4K6YA 1ESAA 1AQ7A 4I8GA 5LGOA 2JREA 3T26A 2WPIS 1EZUC 2DAZA 2HALA 4YDPA 3MHWU 1T4VH 3SOEA 2EDZA 1K1IA 1Z1JA 2GT8A 2LNCA 1NC6A 1WJLA 2VZ5A 3GDSA 1TNHA 4UEHH 5JBBS 5L2YH 2PNTA 2WL7A 2AS9A 3LH3A 3NXPA 3RXJA 2QKTA 1KTSB 4NWLA 1EUFA 3FFGA 3SFJA 1EX3A 2YOLA 3PMJA 3M5OA 2DJTA 1FAXA 1TRYA 4O9VA 1NROH 2IWQA 3PS4A 1IOEA 1BMMH 3PV5A 4E34A 3CBXA 1QLCA 5B6LA 2GX4A 4RSPA 1MCTA 2UUYA 1ZMLA 3CYYA 2VIWA 1TPAE 3SU2A 2BOHB 2R3YA 3MNBA 1SC8U 5JBCS 2FZZA 1O3BA 1OSSA 2P8OB 4ZMAH 3C27B 2B7DH 1EOLA 3SUGA 1LHFH 2BLQA 3MNXA 1E38B 3PM3A 3QZQA 1GBEA 5JDUB 4Q2NA 1TOMH 1NFWA 1VCQA 4IBLH 3LDXH 1GI6A 1UJ1A 1MKXH 1EB2A 1HAOH 1O3IA 2WUCA 2G4UA 1C5WB 1MTNC 2RRMA 4WH6A 3TGJE 5TCCA 3DHKH 2R9PA 2C8XB 4JL7A 3JZ2B 2FI4E 1TGCA 5FCRA 3SHWA 5EOKA 2EI7A 1IQHA 1FIWA 1KLJH 2RA0A 4I7YH 1UTJA 2ZU4A 3PMAB 1SQAA 4NIXA 3MU8A 5F03A 3RXPA 3ZVAA 2K1QA 2BD9A 3TGKE 2OBQA 2ZU5A 1TX8A 1MFLA 3GSLA 1O2SA 3I4WA 3TIUA 3SUFA 1SGIB 1C5QA 4AZ2B 1ZJKA 5HEYA 3SBKA 1FCFA 2BXTH 4ZKNU 1LVMA 1Y3XA 2ZCHP 2H5CA 1D5GA 2ZCKP 1NU7B 3TITA 2BDGA 3LPRA 1C1VH 3M7UA 1AWHB 3FZDA 3OY5U 1BA8B 4OGXA 1P2KA 2FXRA 2G52A 3RMLH 4CH8B 2ZQ2A 4YOIA 3ZYDA 4FUHA 3P8FA 2A7CA 3M35A 3AVZA 4WWYA 3LIWA 3AW0A 1EB1H 4ZROA 2GCTC 2GDDA 2GGVB 3L33A 1ESBA 1TGNA 3HPMA 2AMQA 1C2DA 1Y5BT 3SOSA 1JRTA 2Z9IA 1S83A 3A84A 2ZNKH 1ZHPA 1FC9A 3LJOA 4NWKA 1FY4A 4B2CA 4ABAA 1AIXH 2ZHQH 2BDYA 5HEBA 1NTEA 1AGJA 1YLCA 1YPGH 1HNEE 3GCNA 2KAIB 1V6DA 2XWBI 3P8GA 1EOJA 1GQ5A 1UJVA 2FE5A 5I7ZA 1IQIA 2TGTA 3LGWA 3VGCC 2P3WA 1O2QA 2G2LA 1YBWA 1QQ4A 4X2WA 1O31A 1JIMA 2W5EA 4Y71A 3UOUA 1K28D 2FN5A 1GHWH 1YGCH 2J34A 1PPBH 1GI1A 2CHAB 4SGAE 1N6FA 4OS4A 1O3GA 1PPGE 1S85A 2YNAA 4VGCB 1GHAF 2AMPA 4ZAEA 4E05H 1MTWA 1Q3PA 3PB1E 4FUIA 3SU3A 1QTFA 1A61H 5DO4H 2FS8A 5HGGA 2FX6A 1K1NA 1B0FA 1V2OT 4KTSA 5HFDA 2G55A 4YESB 3TNTA 1QRWA 2VIDA 1HYLA 1GBKA 1CHGA 4GSOA 4D9RA 2ZFPH 3RC6A 1O30A 1O5EH 1VGCC 5ABWA 2GMTC 1P2OA 2ZECA 1U6QA 3KN2A 4AMHA 1N7EA 1IQNA 5A09A 1UMAH
chains in the Genus database with same CATH superfamily
2K1ZA 1KEFA 2CMYA 3R0FA 2ZHEH 1IQGA 3S7KB 3KQCA 1Y3YA 2RA3A 4FUFA 2BYGA 2G4TA 1W2KH 5E2OA 1UCYK 1XVMA 3HKIB 1TMUH 3JZ1B 1L6OA 8ESTE 2YNBA 2PW8H 3AXAA 3MH6A 1RIWC 4K75A 4AN7A 1C4U2 1N6DA 1O2MA 1MBMA 4ZKSU 4Y7AA 4YXWD 1ANBA 1C5TA 1GBDA 1SGFA 4OS2A 1X5RA 1GBHA 1UHPA 2A4RA 1OWKA 2B9LA 3P8NA 3ZZ5A 3M36A 3TH2H 3SJIA 2DC2A 1Z7KA 1TP3A 2CSSA 1AN1E 3A7WA 4YLQH 2EY4C 2K8IA 1CVWH 3IITA 7GCHF 1O3JA 2ZTZA 5T6GA 1MU6B 2QKUA 3M5NA 1WI2A 2VIPA 3BEFB 2J38A 2KZ4A 1C1UH 3SUDA 1A1RA 2V3MA 1CA0C 3OYPA 3F0PA 2TGAA 2QG1A 1HRTH 1DT2A 2LOBA 5LPRA 4LMMA 2OGPA 1UEZA 2ZP0H 2ZDVH 3F0OA 3U69H 2M10A 1GI0A 2W7UA 4NMVA 4X6NA 2EGNA 3M61U 1BTUA 4IGDA 1MQ5A 2VVVA 2HGAA 1BBRK 1Z1IA 2L97A 2Y5FA 1MAYA 2JXOA 2VSPA 2V3OH 3ZVGA 5GWZA 4JOFA 1TQ0B 5DN6D 2ZTYA 2G51A 4NMPA 2DB5A 2H5DA 1D3DB 2F9PA 3FP7E 2YUBA 1Q3OA 3CNRA 1FC6A 3H5CB 3VFEA 5JPMH 1YCPK 1GJ6A 4LOYH 1SPJA 1GMCF 5J4QA 1SG8B 4NMTA 1V2VT 1BRUP 4QT8C 3RXSA 1AO5A 1Q31A 3UREA 1JOUB 1P02A 2F91A 1O5AB 1IQMA 1GMHF 1RY4A 2O8WA 5CHAC 1V2WT 1N99A 4AFQA 1QBVH 1P04A 1ZZZA 1L1JA 1CO7E 4BTTB 2ZFSA 3P17H 2EEGA 3BTQE 1H8DH 2G5NA 1HXFH 2I0LA 4H6SB 1X7AC 4BTUB 2H3MA 1T2MA 1UFXA 3TJVA 2F9VA 1ZPBA 5FB8C 3MU5A 3BTDE 3LT3A 5C5OA 4BXSA 1E0FD 1C1PA 3EA9A 2FTMA 4TY7A 1KXFA 3SW2B 5GPIB 3W94A 2EDPA 1ELBA 1TYNA 2PKAA 4ZXYH 2EDVA 3GICB 3UQVA 1LVOA 4JORA 4DOQA 3NZIA 1C2LA 4K5ZA 1OWEA 4UE7H 3V3MA 4I32A 3R3GB 1GHAG 2R3UA 1C5XB 3AW1A 2BZAA 3E16B 5FL7D 4XE4A 1GQ4A 1SLVB 2EEHA 1ELDE 5C3NA 5E0JA 1G2MA 1GBLA 2VIOA 4MPUA 1G2LA 2ESTE 1LPKB 1XKBC 2PUQH 4ABDA 4JZDH 2Y82A 1O5GH 3ITIA 2PKSC 3PDZA 2FLBH 4CRFA 4UFEH 3FANA 4ZXXH 2IWNA 1W9QA 1DM4B 1FY8E 1O37A 3HATH 5B6OA 2VGCC 2JETC 4BXWA 3M7TA 1UF1A 3HPTB 1UTLM 5EQRA 5EU8A 3R68A 1QL7A 1M5ZA 1X6DA 4RKOB 4X1QU 2QF0A 3OTJE 5L2ZH 4Y8YA 5CMXH 1EAIA 2CSJA 1K1MA 2OC1A 2VWOA 3PO1B 1GJ9B 2QAAA 2Q6GA 2LELA 4JOJA 2ZGHA 5FXLA 1V2NT 1ZSLA 3ZZ8A 4B6EA 1LMWB 3A80A 1TB6H 4OS1A 4DT4A 3PMHB 4D9QA 1P05A 1ZPZA 4GHQA 5AFYH 1H1BA 2RG3A 1F0SA 1ZTJA 1A4WH 2QIQA 2ZFFH 1F5LA 2QV1A 1QQUA 3HGPA 3MMGA 1N7FA 5GLJA 1TNKA 4JYTA 1KXAA 3QIKA 2Z9KA 3GY2A 1UVUH 1TP5A 3RM0H 2KCAA 2FWWA 1WOFA 2ZDMA 5EYZA 4B6FA 3BTGE 2R0LA 3AAVA 2J95A 3U28C 1OWIA 2ZWLH 5GIBA 3FVFB 1SOZA 2AGIX 3MYWA 3RMMH 2ALPA 3KCGH 3V12A 4OAJA 1ANCA 2EEKA 1NFXA 2SNVA 3A82A 4FGMA 2Y5HA 3SNDA 1MQ6A 1MABB 2UWOA 5EZ0A 1GI3A 3GY4A 2V90A 2TRMA 4AGJA 3KQ5A 3MH7A 6LPRA 3N7EA 3SN8A 1V2PT 1P9SA 4J2YB 1C1MA 4B74A 1K1PA 1GBIA 2I6SA 1FI8A 1WF7A 2C90B 8GCHG 4ABGA 1N1LA 3TGIE 1JBUH 4XDEA 5E8EH 1NRNH 4INKA 5LPEA 5JXBA 1GBFA 4MNVA 3SU0A 3GCTG 3ZVCA 3LC5A 3Q3KA 2BLWA 2DLSA 2B0FA 4AYVB 1QB9A 1IQJA 1WSSH 5C1XA 2D90A 1PQAA 1YF4A 1FONA 1QURH 1GG6B 3TVJB 4O03A 5AHGH 3K82A 1GMCG 5C2ZA 1F92A 1W8BH 9LPRA 1GMHG 2YUYA 2FO9A 3DJAA 3I77A 1D3PB 3BG4B 1MD8A 3MNCA 3K6ZA 4Q63A 4I8KA 4AX9H 4ZHMU 4DIHH 3I78A 1TNGA 3UAIC 5E6PB 2KQFA 3NUMA 4Y11E 1GCDA 3K6YA 1SB1H 3RU4D 5I46H 3VXFH 5HETA 3CS0A 1BIOA 6CHAB 2SGQE 1AKSA 3DIWA 1GBTA 5A2MH 3KZDA 4ABIA 3SJKA 5T6DA 5ILBA 3B9FH 4WMFA 1O2HA 1E34B 1ZHRA 2BY5X 2KOMA 1UTNA 2BX4A 4NFEA 1C5VA 3ZVEA 4Y6DA 3VEQB 1TE0A 4BNRA 1O2WA 1DFPA 2EV8A 1KXEA 1O3FA 1C2EA 1PPCE 1TONA 3FZZA 3T25A 1A3BH 1CHOF 4Q7ZA 4WYUA 1E35B 3QGLA 4K8BA 5DP3A 2EEIA 1UM1A 2CV3A 3KQDA 1HDTH 1V2TT 1D3TB 2ULLA 1TGSZ 2QF5A 1TQ7B 3GYLB 2F5YA 3S9CA 1S0RA 2A4GA 1TRMA 2PGQB 3SHAH 4WF8A 1GCTB 3SI3H 1G9IE 4X1RU 5H4IB 1YPMH 2ODPA 4ACBA 1LVBA 3WY8A 2LC6A 1M9UA 3UUZA 4TWWA 1FPCH 5GJ4B 4OEOA 1LVYA 1N8OC 1YP9A 4WMDA 1UK4A 4OEPA 4MLFB 1Y59T 1P1DA 2SFAA 5F6MA 1EJMA 4XRNA 3DT0H 3SV9A 1PQ7A 2GKVE 1V5LA 2PDZA 1C5LH 2RCZA 4ISHH 3S9BA 1C1WH 1GL1A 2WINI 4YO9A 3EA8A 4JYVH 1BT7A 1QAVA 5G1DA 1O5CB 1UVPA 3A88A 4GAWA 4JZIA 1ELTA 2KYLA 1EJNA 2H3LA 1O3AA 1DY9A 5D13A 1J17T 4CHAB 2GZVA 4AYYB 2ZPLA 1ZRKA 4EDJA 1SQTA 1VB7A 3RXMA 4XSKU 2H9EH 1LHDH 4JJ0A 1EZSC 2B5TB 2DMZA 4NMSA 4AG2A 2VRFA 1NBME 3SHUA 2BDBA 1CGIE 4K78A 1XUKA 4IW4E 2Z7FE 2QXJA 4XFQA 3I29A 2G5MB 3LKWA 3R0HA 4YM9A 4Y76A 1K1LA 3U9AH 3KIDU 1U39A 1GHZA 1SGCA 3SQHE 2SGDE 2KCPA 5C17A 1HB0B 1AVGH 4BTIB 1T4UH 1G37A 5IYTA 2BLVA 2Z9JA 1NRRH 1H9IE 1O35A 2AEIH 4FUEA 1EP5A 6GCHF 1VKYA 2P59A 3L6PA 4E06H 2PZDA 3VB3A 3RXVA 5KECA 1ZOKA 2BQ7B 4BOHA 2CK3D 1OBZA 3WKMA 4FUCA 1VGCB 3RXQA 2FOHA 1TPSA 2FLRH 5HFEA 2VINA 5A8YA 2SGPE 2R0KA 3ZRTA 1BTZA 2ZDKA 2V7QD 2VWNA 2TPIZ 3BEUA 5FBIA 4WVPE 3TJUA 4UD9H 3ZV9A 5KGOA 1VITH 1ZRBA 2H9HA 1ELEE 4NIVA 2VNTA 3A7YA 1Y3WA 4E35A 2OK5A 2UZCA 3DCLA 4K2YA 1BMLA 1O2NA 2BD3A 1O2ZA 3NCVA 1G9OA 1FN8A 1NS3A 1SFIA 2AINA 3PRBA 4KP0A 1RGRA 1TALA 1TMBH 4YTAA 2BVSH 1X5QA 1EJAA 1GJAB 1O3EA 1RTFB 3STIA 5HYOA 1UO6A 4WMEA 3RL8A 1TOCB 2OC7A 1PQ5A 4X1PU 5C20A 1U3BA 1LPZB 3MFJA 1SR5C 4FUBA 1EKBB 1QHRB 3PROA 5EJZA 2ZCLP 1XX9A 4HI3A 3BTEE 1P3CA 3M3SA 1OBYA 1GL0E 2J98A 3O8BA 3BV9B 4AFUA 3EE7A 4TPYA 4I8HA 5JYIA 1A0HB 3KF2A 1IQFA 1OHHD 2M0VA 2IJOB 1F5RA 1NRPH 4DG4A 1W7GH 3RXUA 1P2JA 4NGAH 3ZZ6A 2O8TA 3CP7A 1YY3A 4WXIA 1Q2WA 3QZRA 1KY9A 1Z6EA 1C1RA 1CHOG 3D62A 3RU4T 2A2XH 2ANWA 3EGKH 1MKXK 4THNH 4Y0ZE 5PTPA 1WXRA 4BAMB 1LTOA 2FYRA 1OP2A 2H2BA 3B23B 5HDYA 4AORA 5HIYA 5BPEA 2K0QA 3GABA 1BJUA 2HNTC 1QL8A 3TJNA 1DX5M 2TBSA 1VCWA 1J14A 3TSWA 4BAHB 2W7SA 1LHEH 1C1TA 2PSYA 1C2MA 1OS8A 4Y79A 2GZ7A 2PTNA 2KJKA 2OD3B 2I6VA 1WCZA 2ZFRH 1EAXA 1BQYA 4UDWH 2ZO3H 1ZMNA 2EC9H 2CXVA 2SGAA 2BTCE 3F2GA 3OTPA 4JOHA 3PRDA 1IAUA 1TGBA 1PQ8A 2NWNA 3F3BA 2P93A 2O2TA 3GY5A 2ANKH 2AGGX 3EGHC 2XCFA 1V5QA 1JIRA 1VZQH 1IQEA 1GDUA 2HLCA 2VVUA 1YM0A 2WPMS 1GBCA 3E90B 3CENA 1S0QA 1SGNE 2J92A 2P16A 1UJDA 3AASA 4KFWA 1IHJA 2YMSD 3SZEA 1O5BB 1VITF 3SHCH 4NSYA 1EPTA 1KYNA 2OXSA 1FQ3A 3KQEA 2BD5A 1XXDA 2BY8X 1V6BA 1O2LA 4NNLA 3BIVH 1SGDE 2A5IA 2ZHWH 3UNSA 1T32A 4X0WU 1GHYH 1AKSB 2A2QH 3SU4A 4CRDA 2FNEA 2IWPA 1CU1A 4SGBE 1KXDA 5HFCA 4XOJA 1LO6A 2Y5GA 6GCHG 1K0HA 3H7OA 3SJOA 3B76A 2BD2A 1KTTB 1F0TA 4F48B 4TT3D 3RXHA 2ZI2H 1IQLA 3AAUA 1BTHH 3QK1A 1P57B 3RXRA 5C67A 5DTHA 1SVPA 2PHBA 2PWXA 3I18A 2W3KA 2WPJS 1AVXA 2BY9X 2VGCB 2PLXA 1Y8TA 1W0YH 3ATKA 1J15A 3F9EA 1PDRA 3RXDA 3ZZ7A 2O8LA 3SNAA 3LGTA 3STJA 3P70B 3A8CA 1P09A 3GCHB 1O2PA 1YPHC 4AFZA 1AB9B 1T7CA 3M5MA 3VG8A 3RXEA 2DLUA 4Q2QA 1BUIA 1NRSH 4I33A 1FPHH 2V35A 5EJ1A 1BCUH 3Q76A 2FI5E 4Z8JA 1LHGH 2Q1JA 1ABIH 3TJOA 3RDZA 4FUJA 2J4IA 1UITA 1FY1A 5DP5A 5GCHF 4GHTA 1DS2E 4PROA 1SBWA 3SUZA 1QAVB 5ESTE 4RN6A 1QNJA 2PP6A 1JMOH 3A86A 4HTCH 1C1SA 2PSXA 1FNIA 2VBCA 4ISOA 1YLNA 3GY6A 1UJUA 3ODDA 1C9PA 3PMBB 3MO6A 5F8TA 2A5KA 2FM2A 2YT8A 3FKSD 1C2GA 4F4OC 1SL3A 1UVTH 2Z9LA 2OS6A 2OQUA 2ZPQA 5AVDA 1S6FA 3LJJA 2FI3E 4JZEH 1TNJA 1HFDA 2Y80A 2VIQA 2XTTB 1OX1A 2Y6TA 1EZQA 3RXAA 1CA8B 2GV6A 1UCYH 2FPZA 2ZFQH 1SQRA 2DE9A 2ZA5A 4D7FA 1OPHB 2JOAA 3VXEH 1HJAB 3B8JA 3M3TA 2ZGXH 1BDAA 2QF4A 3F2FA 2FP7B 1GI9B 1TWXB 2R2WU 3SV6A 1BTYA 3E0PB 4GLYA 4O3UA 2WPLS 4YLUA 2P3TB 5SGAE 1DPOA 1XUGA 2A4QA 1UVSH 1S5SA 4CRGA 2OP9A 4WY3A 1DE7H 1RGQA 1HAHH 3URDA 2EHRA 1OYTH 1K2I1 2ZC9H 1JWTA 2EGOA 4FXGH 2JILA 3A7TA 3FY5A 4Y10E 2X7ZA 4Z1MD 1GI4A 2VB0A 2Z3EA 1HGTH 2P8OC 1AD8H 1UHBB 2ZQ1A 3FP8E 3EQ0H 3PV4A 3ZIAD 2M0UA 1O33A 4MG3A 1C5RA 2F0AA 1V2MT 1LCYA 1FJSA 2W6JD 4NXRA 3MU0A 4U2WA 3DFLA 3F9FA 3O8CA 2W6ID 2BVXH 1GBBA 1V2UT 3UWJH 2STBE 2IOTA 3LU9B 4A1TA 1GI8B 1BBRH 1GGDC 1DOJA 2FESH 1SI5H 2XBXA 4WXVA 4MPAA 4CBOA 5HFFA 1V2ST 1A46H 2CF9H 1MTVA 2I1NA 1ZGIA 3BG8A 1V2KT 1GDNA 3NCLA 5JB8S 2Z3CA 4P2AB 1VITG 2KR7A 1WI4A 4IS5A 3RXKA 4XHVA 1HLTH 2J98B 2AH4X 2EAQA 1YPJH 1OXGA 1YKTA 1YCPH 3K50A 3KZEA 1SGQE 2IPHA 5BRRE 1DWCH 1K21H 1O0DH 2JH5D 1OZIA 1WIFA 1O3NA 2FOMB 3KEEA 4WYTA 3T62A 4U32A 4ABEA 4BAQB 1FX0B 1O34A 3QX5H 1CBWB 1HXEH 1GBMA 1Z71A 2C3SA 3BTFE 2ZU3A 1S82A 3SGBE 1TQ3A 1D6RA 2YMSC 2XNIA 1X9ZA 1AZ8A 5EQSA 1XMNB 4H42U 5G1EA 3QUMP 3RLWH 5AFZH 3RU4E 3UR9A 3TK6A 1U37A 3KDKA 1N8OB 3ZZAA 2FOEA 1SQOA 3URCA 1W7XH 3BPUA 2ZPMA 4DY7B 4JOKA 2PFEA 4MPXA 2QXGA 4JOPA 1FLEE 4NIYA 1Z8RA 3QTVH 5HF4A 4ACAA 1F5KU 4FETA 3ZVBA 1DLEA 3DFJA 4TY6A 2H6MA 1X45A 4TYDA 3TK5A 2ZZUH 3TSZA 1AFQB 1ESTA 1BFEA 1Q7XA 1BB0B 4IC5A 2W4FA 1GJ7B 1DDJA 4Y0YE 5EXLA 3UIRA 1QJ7B 4H6TA 1ABJH 1WQVH 3KL6A 4R0IA 3VB5A 3DUXH 2ZIQH 4Z33A 4WJG2 2EI6A 1MU8B 4K1SA 4B73A 4CRAA 3UQOA 2L74A 1GJBB 3EDXB 3MWIU 3O8DA 2OZFA 2LC7A 3OY6U 1EXFA 3P92A 1N6XA 4AC9A 2QCYA 3Q3YA 1XUJA 2WSSD 1JXPA 1XUFA 4IN1A 2ASUB 2XC4A 3MNSA 2OINA 1UK2A 3U8RH 2AGEX 2NU2E 3EA7A 3SZNA 1P11E 3QJMA 5T6FA 1UTOA 1EFRD 1K1JA 2UUJB 3S69A 2CHAC 1CT0E 3QGNB 2BXUH 1EPTB 2XC5A 4M9FA 2ODQA 1G36A 1G30B 3PLKA 1T8NA 1YPEH 4VGCC 4K76A 4NZLA 1NO9H 4X6PA 3GY8A 3OE7D 3CBYA 3MI4A 1UTMA 2BMGB 2V3HH 4GVUA 1C2IA 2REYA 2MX6A 4ABFA 3ZYEA 3ID4A 2ANMH 2GD4B 2NU1E 3FOAA 1KLIH 1ARBA 1GDQA 5EQQA 3ATWA 7GCHG 1UEQA 2H1UA 3GY7A 3ZZBA 1W9OA 3LGVA 2HPQH 2SGFE 4ZH8A 4Q80A 3TK9A 1Z8JB 2ZGCA 4X2YA 3KQBA 4DGJA 4P00A 3GS9A 1GI5A 4BAOB 5F3XA 1SLXB 4DURA 3MH5A 2AMDA 4ISIH 1KMHB 1HAZB 3QE1A 1HIAB 1O39A 2K20A 4NA8A 5DP9A 1LHCH 4MQAA 1MKWK 4K1TA 4HOPB 1HPGA 1L2EA 1MUEB 1C5OH 3LGYA 7LPRA 1COWD 4X2VA 1V2LT 1ETRH 2BD4A 3KHFA 1O2UA 1VJ6A 2Y7ZA 3ZZ4A 3A81A 1YPKH 4MNYA 4MPVA 1FY5A 1QJ6B 2EQNA 1OYQA 3QJNA 1OWHA 2E7KA 1NU9A 2Q6FA 5GDSH 2KPLA 3WKLA 3U1IB 1AMHA 2XBYA 1E1QD 1WV7H 5HEDA 1W9EA 3JXTA 2JJ2D 3RXCA 1MTNB 4DJZB 1ARCA 5IK2D 4GPGA 1GJCB 1WHDA 1NFYA 1FDPA 1VA8A 1TIOA 1VJAU 4KTUA 2L4SA 5C1UA 3DD2H 5EPYA 1E1RD 1WBGB 5EGMA 1RTLA 2HLDD 3T27A 2OTVA 1K9OE 1O2KA 1KXCA 2ILNA 2HVXA 1MFGA 3OEHD 1XKAC 3DA9B 2QBWA 2OC8A 1V1TA 3SU1A 4NMOA 2QT5A 1ANEA 1V2QT 2A7HA 5HJ1A 4Q3HA 2ZDNA 3EE0B 3M7QA 1NM6A 1EAUA 5FX5A 3PTNA 1HV7A 3VB7A 3A85A 4IMQA 4RI0A 2FS9A 3A8AA 5HFBA 4NZQA 1WTGH 1WFVA 3SUEA 3PTBA 1VCPA 3DSPA 1TMTH 3RP2A 5ETXA 3ZZ3A 4JZFH 2IJD1 2I4SA 4U30A 4B1TA 1ANDA 2P95A 4I8JA 5DP7A 1NRQH 2I0IA 2O9QA 2VU8E 1CT2E 3NK8A 5LPFA 1SLWB 2ODYB 1SSXA 4P0CA 5FPYA 2GCTB 1YYY1 3RXIA 1P06A 1IHTH 3FP6E 2VPHA 1V62A 1O3KA 4FVBA 3SGAE 1W0KD 2M0ZA 1GVZA 4NA7A 4X8UH 2H2CA 2ZDLA 2HE4A 4MVNA 3RM2H 3SO3A 2LPRA 4O3TA 1MC7A 1MZDA 4AOQA 1C2KA 4ABJA 4TWYA 3LOXA 3OX7U 4Y8ZA 1GJDB 1WYKA 2XCNA 2UWLA 1UEWA 1QIXB 4O97A 3E17A 2KPKA 4CREA 2C8ZB 2DUCA 3ESTA 3QLPH 3VGCB 4B2BA 2FCFA 1UM7A 1DSTA 1T31A 1O3PB 1TA2A 4Q7YA 1P2NA 2KM0A 1B8QA 1GJ5H 3E6PH 3QTOH 3ZVFA 3ZZ9A 1D3QB 1DICA 4ABBA 1V2JT 1E79D 3ENSB 4FUGA 5K7RA 1HUTH 2KV8A 4CRBA 4ISLA 1W14U 2HNTF 3S9AA 2XBVA 1BITA 4X6MA 5DGJA 1DWEH 1UTQA 4HFPB 2VH6A 3DJ1A 5F8ZA 1ELCA 1QRZA 3BTWE 4B71A 1EQ9A 1O2GH 1ZOMA 4ABHA 4H11A 1AE8H 2G8TA 1C2JA 4HGCA 2M3MA 2VSVA 1MH0A 1DANH 1MZAA 1SLUB 1UW7A 1UTKA 2WHXA 1C2HA 2GEFA 3E91A 3HK6B 2VWRA 1QA0A 2W7RA 2BDIA 2H9TH 2WYJA 3O46A 3E3TA 3SNBA 3SV8A 1G3CA 3V13A 1LDTT 2QKVA 1U38A 1ZHMA 2C8YB 4HZHA 1A7SA 1HAIH 2FYQA 1T8LA 3NKKA 1B5GH 2A31A 2EJYA 1HAVA 1FY3A 2Z9GA 3SV7A 3T29A 1QRXA 3VPKA 2NU0E 4CR5A 1ELAA 2THFB 2AIPA 1X8SA 1QY6A 1EASA 2GMTB 2Z17A 1F2SE 2D8IA 2JH0D 4FU9A 3UFAA 5FCKA 2GTBA 1SGEE 1WG6A 2QA9E 3CBZA 1UHBA 3V7TA 4E7RG 1GI7B 3CS7A 1ZLRA 2YTWA 3QO6A 2BDHA 2W3IA 5HM2A 3MQKC 3GDVA 3ZZDA 1L4DA 1XUIA 1O3MA 3MU4A 1UK3A 1RIWB 2D2DA 1B7XB 1HJ9A 1SHYA 3HKJB 1THPB 3BTHE 2UUKB 3G01A 3M37A 3UNRA 3UY9A 1N6YA 2LP6A 2RDLA 2Q3GA 1C5UA 1RTKA 2ZPRA 1QBNA 2FOAA 2CN0H 5A0CA 1KSNA 3LNYA 4A1XA 4H4FA 2F9OA 2G5VA 2OQ5A 4IN2A 5T1VA 5HIZA 5K0HA 2OCSA 1RD3B 4RT1A 4X8SH 5JB9S 1CGHA 1GI2A 2V0BA 1TA6A 2EXGA 4OS7A 4A6LA 4O06A 2FDAA 3BEIB 1CA0B 3P6ZB 4K3JA 3LNXA 2BY7X 1TNIA 4I86A 3HK3B 4NA9H 3DJ3A 2TIOA 3RMNH 2OCVB 4UFDH 1H8IH 1E37B 1O5DH 2WUBA 2ZGJA 2GT7A 4KTCA 3VB4A 4XBCA 4L8NA 1CQQA 1A3EH 2HPPH 1TX7A 1PFXC 1INCA 2QF3A 1FUJA 5G4BA 3Q00A 1GHXH 2YT7A 3KNXA 2UUFB 1SGRE 2ZHFH 4Q6HA 5I25A 5A2PA 1GG6C 1CGJE 1O2VA 2B8OH 1TX6A 1ETSH 2OC0A 3SGQE 2QGRA 4K69A 2XXLA 2JH6D 1NT1A 5FHTA 1BHXF 1DY8A 2HOBA 3I1EA 1GGDB 5HF1A 1MD7A 3ZVDA 1Y7NA 3VQFA 4K72A 5TCAA 1RRKA 3BG4C 1D4PB 2OMJA 3LH1A 4TPIZ 5EW1H 4Q7XA 1GM1A 1C4Y2 2IPQX 1P01A 5DK1A 2WV5A 1C4V2 2CF8H 1BJVA 2RCEA 2CS5A 3RL7A 3WWBA 1HAGE 5CHAB 3ID1A 4Q2PA 1Z87A 2JKHA 2AWWA 5DP8A 5CDFE 2QXHA 5HM9A 6CHAC 4OGYA 1OWJA 3TLOA 3EGGC 1TPOA 1NPMA 3KHVA 4NSVA 2J97A 5L6NH 1Y3VA 1BTPA 3RC5A 7ESTE 5B42A 1QFKH 4E3BA 1UCYE 2FOFA 4D7GA 4X8VH 4NNMA 1W13U 5DP4A 3UWIA 3Q77A 1C5MD 2EEJA 3RXLA 1FC7A 1O2RA 1V2RT 3ZV8A 2C4FH 1OP8A 4GVCA 3MTYA 2J2UA 3C1KA 2XW9A 3W95A 2NU4E 2Z94A 3A87A 3RMOH 1NN6A 1TABE 3UPEA 1VAEA 3QN7A 1O2JA 1ZTKA 2CJIA 2GDEH 1GCTC 3OAAD 1QAUA 2EGKA 2J9NA 5HXFA 3S0NA 2A32A 3V0XA 3RXGA 1VJ9U 3RUOA 1ZGVA 1T8MA 3N7OA 1WF8A 1DVAH 4IMZA 4Y7BA 3TSVA 3MH4A 5FPTA 3U1JB 1PJPA 1P2QA 6ESTA 2V1WA 4YZUA 2XBWA 2FTLE 2SNWA 2L4TA 3D23A 1C9TA 2BOKA 1IQKA 5J4SA 2FOGA 3PWCA 1SGFG 3DSOA 1C5SA 4OS6A 4GCHF 5HMAA 5KEDA 3QGJA 2PKSB 2L6OA 4JCNA 1WFGA 2XYAA 1FV9A 1BBRE 1GVKB 2Q9VA 1SHHB 2JETB 4Q4LA 4ZKOU 1TFXA 1SKYE 1EATA 2D8WA 2O8MA 1GPZA 2DM8A 4G69A 4GHNA 3BTTE 2D26C 4WH8A 4NCYA 4Z6AH 4CHAC 1X5NA 1D9IA 1GHBF 1ETTH 1BRAA 1YWUA 5FPSA 3U8OH 1HIAA 1R6JA 1AHTH 2J5UA 1ELVA 1BE9A 1RFNA 1WTHD 1DSUA 3GY3A 2WV4A 3RXTA 4UFGH 3RLYH 4HOPA 1I16A 4I8LA 3RXOA 1TBZH 3RXBA 4KKDA 5DKMA 2BX3A 2HGTH 3E8LA 3TH4H 1RS0A 2PR3A 5CHBA 2KJDA 1TGTA 3LONA 1J9CH 1TBRH 1S81A 5E0HA 4A7IB 2XOKD 3PWBA 3T28A 1A2CH 1F7ZA 3UTUH 2J94A 2BYAX 4NIWA 4LZ4B 2DE8A 1MBQA 2ZFTA 1OKXA 3NWUA 1DWBH 2OSGA 5EXNA 1A5IA 5AF9H 3A7XA 2BLOA 1C5PA 3QDOA 3ELAH 1TPPA 3TPIZ 1QB1A 7KMEH 2ZU2A 5DJ7A 1ELGA 2A0QB 3FO8D 3IWMA 4J1YA 4DIIH 1W0ZU 4JZ1A 2KL1A 1C5NH 1OBXA 5E0GA 2DKRA 1N7TA 3A83A 2FIRH 1IU0A 1EP6A 1SMFE 1GVLA 2FOBA 1RXPA 1KXBA 3SJ9A 1K1OA 4INLA 9ESTA 3PYHA 3ATMA 1AVWA 1JRSA 3E0NB 1HCGA 1ZMJA 2BDCA 2OPGA 5L30H 1H8HD 2GZ9A 1OOKB 4ZHLU 2Z3DA 4ZUHA 1GMDF 2GV7A 3H09A 2JIKA 2WYGA 3BIUH 2P3FH 4D76A 4Q2OA 4AB9A 1P8VC 1I92A 1ELFA 1FN6A 4MNXA 1G32B 1QCPA 5GXPA 4KELA 1HAVB 1XVOA 2I04A 3TMHA 1WU1A 1KDQA 1O2YA 1O2IA 3HVQC 4AGKA 3K65B 1XXFA 3OU0A 2A45B 2D92A 3OEED 1UTPA 5EODA 1KIGH 5A8ZA 3U98H 2KJPA 1GBJA 8KME2 1P3EA 1PYTD 1L4ZA 3GJ9A 4JOEA 1YLDA 3LC3A 5H3JA 4NMRA 4Q2KA 1NF3C 2HVYB 4A5TS 1ZYOA 2STAE 1F0UA 4UONA 1RJXB 4NXQA 1IU2A 5C5NA 1J16A 2JIZD 5C1YA 3SNCA 3GDUA 3TU7H 3UOPA 3KYFA 3A7VA 3SU5A 1Z86A 2QN5T 4A92A 1TRNA 4F49A 3PDVA 1O2XA 3T2NA 2WPDD 4MPWA 4MTBA 1O36A 4YOJA 1AZZA 1AE5A 5F8XA 1WHAA 1FAKH 8GCHF 1L1NA 1N6EA 5FX6A 3IG6B 1C1OA 3CH8A 2JINA 3A8BA 3F9HA 1QGFA 3UB0A 1MTSA 5EW2H 2F9NA 4AG1A 4Y8XA 1P10A 2I6QA 5A0BA 3QDZB 3GCTF 4JK5A 2RFKC 5E2PA 1H9HE 1O5FH 8LPRA 2O8UA 1O2TA 5DP6A 1RZXA 2ZTXA 5DG6A 3GGEA 1YPLH 3SJ8A 1TAWA 2GCHF 1LKBA 1DWDH 3K9XB 1FZZA 3UR6A 1LQEA 2A7JA 4IC6A 4UFFH 3HPKA 1GWAA 1QA7A 4GCHG 4U01A 3SV2H 2R2MB 1PPEE 1C1QA 4K60A 2EA3A 1D6WA 1DXWA 4UU6A 4XD7D 3K1RA 1O2OA 1YC0A 2PKTA 1P1EA 5DSFA 1W3CA 2D1JA 2HNTE 1MTUA 4INHA 4B75A 1W12U 1AWFH 1ZJDA 2PKUA 2MHOA 2AWUA 1P2MA 1TLDA 1GHBG 2HE2A 2VH0A 2ZEBA 2XWAA 4MNWA 4X2XA 1QR3E 2FX4A 2NU3E 4MDSA 1AY6H 1F0RA 5E22A 3SORA 5EPNA 1W10U 4XBDA 3MO3A 1C2FA 2ANYA 2BDAA 5GNDA 2Y81A 3W1EA 1UVOA 2R4HA 1HBTH 2FOCA 2AERH 2AIQA 4CH2B 2G81E 3SQEE 3N7DA 4R2ZA 1Y5AT 1SFQB 5GCHG 1P12E 1T8OA 2GP9B 4ISNA 1W11U 4GVDA 1RGWA 4JYUH 1H8ED 4BAKB 1WDIA 4X1SU 1KLTA 4NFFA 1BRBE 4B2AA 1DLKB 4JK6A 4ASHA 5JBTA 3H7TA 1WH1A 4YYXA 4B76A 2A5AA 2GJGA 4NMQA 3K2UA 2ZGBH 2P94A 4PQWA 1XUHA 4YT6H 3KGPA 4DW2U 2V6NA 4BANB 2BY6X 4NG9H 4E7NA 3RLEA 5LH8A 4X6OA 2Q6DA 1THRH 2KCOA 1O3HA 3GCHC 4FU7A 2VWMA 2VWLA 1AB9C 3F2HA 3MO9A 2CGAA 3MOCA 2FMJA 2EI8A 3A8DA 1IHSH 4AB8A 3VQGA 3ODFA 5T3HA 2WV9A 4KGAA 1ZSKA 4OS5A 2F9UA 1GMDG 4NXPA 1C5YB 2ENOA 2JDID 5C0UA 1E36B 3GOVB 1ZSJA 4LXBH 3HGNA 3OSYA 4REYA 4Z0KA 2LA8A 5E1YA 5E21A 2KOJA 2KFWA 2JSNA 2ZDAH 1HAXB 1XZ9A 1Y3UA 3BTKE 1K22H 4M7GA 3BF6H 1K32A 2M5TA 1A0LA 4K1EA 1SGTA 1GBAA 2JWEA 1YPHE 1O32A 3A89A 2PA1A 1GJ8B 3SU6A 1ZUBA 1NZQH 4X8TH 1BMAA 3DSGA 2ZPSA 1ACBE 2KCYA 2OBOA 3T5FH 1BZXE 1LKAA 2Z6BD 2KBSA 3NFKA 1GJ4H 1A0JA 1HAPH 1XM1A 3MU1A 2IWOA 1LQDB 2ZKSA 3M3VA 3QWCH 2F83A 1QB6A 5EIYA 1C5ZB 1BTXA 1MKWH 2BD7A 2P3UB 3F68H 1CSOE 2C8WB 3RC4A 1DUEA 1ORFA 2SGEE 3ATLA 4AFSA 2C93B 3RXFA 3TNSA 2BZ6H 2PV9B 3NRLA 1SOTA 1P9UA 1QBOA 2BHGA 2ZU1A 1HJAC 1WUNH 2TGPZ 2AHME 1ZR0A 4FUDA 1A5HA 1V3XA 1PYTC 1BRCE 1EAWA 4K8YA 5TJXA 1J8AA 2RDEA 4FVDA 2BM2A 1DUAA 4F8KA 1TNLA 3ATIA 1G3BA 1OP0A 5IDKA 1TBQH 1SGYE 1Z6JH 2KRGA 4HG6A 1MCVA 4N6XA 4FU8A 4D8NA 1ZTLA 2QXIA 2GCHG 4TSFD 4YOGA 3BSQA 1AI8H 5HKKD 5FAHA 2G00A 3GISB 1PPFE 5EXMA 2VIVA 1FIZA 1VR1H 3WWFA 2WPHS 2QY0B 4Q6SA 1Z8IB 1O3CA 4R8TB 2PGBB 1BMNH 2HRVA 4DVAU 4RKJB 4ZHAA 1P2IA 3DORA 1O38A 2KOHA 1SGPE 4ZKRU 1CE5A 4RT0A 2TGDA 2BQ6B 4DCDA 3E1XB 2QE7D 3P8OA 2KAIA 3UNQA 1ID5H 1KDQB 2M0TA 1O3LA 3LGIA 5CE1A 2KAWA 1AU8A 3ZZCA 1OWDA 4CBNA 2KX4A 1H9LB 3F6UH 1H4WA 4ASUD 3L3TA 3PV2A 2OQSA 1O3DA 4DT7B 1NESE 1YCPM 1YBOA 1LPGB 1P03A 3P95A 3NGHA 1S84A 2VVCA 2ZHDA 3WW7A 1AUTC 2A4OA 2FODA 2Y7XA 3PLPA 4I31A 2BVRH 3NFLA 2JJ1D 2W26A 3FAOA 4KFVA 3CC0A 1HJ8A 4ESTE 1CBWC 1QJ1B 3EAJA 1C1NA 1Q3XA 2BQWB 2BB4A 1GHVH 1PPHE 3D65E 1DITH 2A1DB 4X1NU 3BTME 2WPKS 2AWXA 5EG4A 4OM9A 5ESBA 3TH3H 3VB6A 3BN9A 3O8RA 3F9GA 2OLGA 3D49H 2GZ8A 3KYGA 1AUJA 2UWPA 3Q3XA 1G3EA 4GUXA 2KA9A 1KWAA 2ALVA 3PLBA 4JOGA 3AK5A 1HAYB 2F3CE 3O5NA 3SNEA 1FMGA 1NTPA 1NY22 4JJ3A 1P0SH 1WAYB 2FEQH 2PTCE 2ZF0H 3EYDA 4LZ1H 3NPSA 2GVFA 3U8TH 5E11A 1A5GH 1Y5UT 2QYIA 1FXYA 5F53A 4CR9A 1AFQC 2IN2A 2F9BH 2ZG0H 5JBAS 3M5LA 4UU5A 1BOQA 1NFUA 1Z8GA 2XC0A 1DXPA 1S6HA 2PUXB 1PPZA 3LGUA 1ZPCA 4CRCA 2QC2A 1EZXC 2XRCA 5F67A 1L0ZA 2KG2A 3L4FD 2HWLB 3PO1C 1O3OA 5A0AE 1QL9A 1B0EA 3ID2A 1UEPA 2AFQB 1L1GA 1WQSA 1BHXB 2AYWA 1AFEH 5A8XA 3R69A 4LK4A 1THSH 2BD8A 4JMYA 3GYMA 1EPTC 5DPAA 1MAXA 2PKAB 2H2ZA 2M2AA 3A7ZA 5FBEA 1BTWA 3F1SB 1MMJN 4A1VA 3S7HB 2VJ1A 3SI4H 3GCOA 1G3DA 2OUAA 1S6LA 4YT7H 1CT4E 3ID3A 2LUIA 4XBBA 4K6YA 1ESAA 1AQ7A 4I8GA 5LGOA 2JREA 3T26A 2WPIS 1EZUC 2DAZA 2HALA 4YDPA 3MHWU 1T4VH 3SOEA 2EDZA 1K1IA 1Z1JA 2GT8A 2LNCA 1NC6A 1WJLA 2VZ5A 3GDSA 1TNHA 4UEHH 5JBBS 5L2YH 2WZQA 2PNTA 2WL7A 2AS9A 3LH3A 3NXPA 3RXJA 2QKTA 1KTSB 4NWLA 1EUFA 3FFGA 3SFJA 1EX3A 2YOLA 3PMJA 3M5OA 3N99A 2DJTA 1FAXA 1TRYA 4O9VA 1NROH 2IWQA 4ZCNA 3PS4A 3FN8A 1IOEA 1BMMH 2F43B 3PV5A 4E34A 3CBXA 1QLCA 5B6LA 2GX4A 4RSPA 1MCTA 2UUYA 1ZMLA 3CYYA 2VIWA 1TPAE 3SU2A 2BOHB 2R3YA 3MNBA 1SC8U 5JBCS 2FZZA 1O3BA 1OSSA 2F4LA 2P8OB 4ZMAH 3C27B 2B7DH 1EOLA 3SUGA 1LHFH 2BLQA 3MNXA 1E38B 3PM3A 3QZQA 1GBEA 5JDUB 4Q2NA 1TOMH 1NFWA 1VCQA 4IBLH 3LDXH 1GI6A 5EJLA 1UJ1A 1MKXH 1EB2A 1HAOH 1O3IA 2WUCA 2G4UA 1C5WB 1MTNC 2RRMA 4WH6A 3TGJE 5TCCA 3DHKH 2R9PA 2C8XB 4JL7A 3JZ2B 2FI4E 1TGCA 5FCRA 3SHWA 5EOKA 2EI7A 1IQHA 1FIWA 1KLJH 2RA0A 4I7YH 1UTJA 2ZU4A 3PMAB 1SQAA 4NIXA 3MU8A 5F03A 3RXPA 3ZVAA 1QZ8A 2K1QA 2BD9A 3TGKE 4FOUC 2OBQA 2ZU5A 1TX8A 1MFLA 3GSLA 1O2SA 3I4WA 3TIUA 4P02A 3SUFA 1SGIB 1C5QA 4AZ2B 1ZJKA 5HEYA 3SBKA 1FCFA 2BXTH 4ZKNU 1LVMA 1Y3XA 2ZCHP 2H5CA 1D5GA 2ZCKP 1NU7B 3TITA 2BDGA 2YMSB 3LPRA 1C1VH 3M7UA 1AWHB 3FZDA 3OY5U 1BA8B 4FLNA 1P2KA 2FXRA 4OGXA 2G52A 3RMLH 4CH8B 2XNDD 2ZQ2A 4YOIA 3ZYDA 4FUHA 3P8FA 2A7CA 3M35A 3AVZA 4WWYA 3LIWA 1BMFD 1NBMD 3AW0A 1EB1H 4ZROA 2GCTC 2GDDA 2GGVB 3KDGA 1ESBA 3L33A 5C94A 1TGNA 3HPMA 2AMQA 1C2DA 1Y5BT 3SOSA 5C0TA 1JRTA 2Z9IA 1S83A 3A84A 2ZNKH 1ZHPA 1FC9A 3LJOA 4NWKA 1FY4A 4B2CA 4ABAA 1AIXH 5IL9A 2ZHQH 2BDYA 5HEBA 1NTEA 1AGJA 1YLCA 4F55A 1YPGH 1HNEE 3GCNA 2KAIB 1V6DA 2XWBI 3P8GA 1EOJA 1GQ5A 1UJVA 2FE5A 5I7ZA 1IQIA 2TGTA 3LGWA 3VGCC 2P3WA 1O2QA 2G2LA 1YBWA 1QQ4A 4X2WA 1O31A 1JIMA 2W5EA 4Y71A 3OFND 3UOUA 1K28D 2FN5A 1GHWH 1YGCH 2J34A 1PPBH 1GI1A 2CHAB 4SGAE 1N6FA 4OS4A 1O3GA 1PPGE 1S85A 2YNAA 4VGCB 1GHAF 2AMPA 4ZAEA 4E05H 1MTWA 1Q3PA 3PB1E 3SYJA 4FUIA 3SU3A 1QTFA 1A61H 5DO4H 2FS8A 5HGGA 2FX6A 1K1NA 1B0FA 1V2OT 1W0JD 5HFDA 2G55A 4KTSA 4YESB 3TNTA 1QRWA 2VIDA 1HYLA 1GBKA 1CHGA 4GSOA 4D9RA 2ZFPH 3RC6A 1O30A 1O5EH 1VGCC 5ABWA 2GMTC 1P2OA 2ZECA 1U6QA 3KN2A 4AMHA 1N7EA 1IQNA 5A09A 1UMAH
chains in the Genus database with same CATH topology
2K1ZA 1KEFA 2CMYA 3R0FA 2ZHEH 1IQGA 3S7KB 3KQCA 1Y3YA 2RA3A 4FUFA 2BYGA 2G4TA 1W2KH 5E2OA 1UCYK 1XVMA 3HKIB 1TMUH 3JZ1B 1L6OA 8ESTE 2YNBA 2PW8H 3AXAA 3MH6A 1RIWC 4K75A 4AN7A 1C4U2 1N6DA 1O2MA 1MBMA 4ZKSU 4Y7AA 1ANBA 1C5TA 1GBDA 1SGFA 4OS2A 1X5RA 1GBHA 1UHPA 2A4RA 1OWKA 2B9LA 3P8NA 3ZZ5A 3M36A 3TH2H 3SJIA 2DC2A 1Z7KA 1TP3A 2CSSA 1AN1E 3A7WA 4YLQH 1CVWH 3IITA 7GCHF 1O3JA 2ZTZA 5T6GA 1MU6B 2QKUA 3M5NA 1WI2A 2VIPA 3BEFB 2J38A 1C1UH 3SUDA 1A1RA 1CA0C 3OYPA 2TGAA 2QG1A 1HRTH 1DT2A 2LOBA 5LPRA 4LMMA 2OGPA 1UEZA 2ZP0H 2ZDVH 3U69H 2M10A 1GI0A 2W7UA 4NMVA 4X6NA 2EGNA 3M61U 1BTUA 4IGDA 1MQ5A 2VVVA 2HGAA 1BBRK 1Z1IA 2L97A 2Y5FA 1MAYA 2JXOA 2VSPA 2V3OH 3ZVGA 5GWZA 4JOFA 1TQ0B 2ZTYA 2G51A 4NMPA 2DB5A 2H5DA 1D3DB 2F9PA 3FP7E 2YUBA 1Q3OA 1FC6A 3H5CB 3VFEA 5JPMH 1YCPK 1GJ6A 4LOYH 1SPJA 1GMCF 5J4QA 1SG8B 4NMTA 1V2VT 1BRUP 4QT8C 3RXSA 1AO5A 1Q31A 3UREA 1JOUB 1P02A 2F91A 1O5AB 1IQMA 1GMHF 1RY4A 2O8WA 5CHAC 1V2WT 1N99A 4AFQA 1QBVH 1P04A 1ZZZA 1L1JA 1CO7E 4BTTB 2ZFSA 3P17H 2EEGA 3BTQE 1H8DH 2G5NA 1HXFH 2I0LA 4H6SB 1X7AC 4BTUB 2H3MA 1T2MA 1UFXA 3TJVA 2F9VA 1ZPBA 5FB8C 3MU5A 3BTDE 3LT3A 5C5OA 4BXSA 1E0FD 1C1PA 3EA9A 2FTMA 4TY7A 1KXFA 3SW2B 5GPIB 3W94A 2EDPA 1ELBA 1TYNA 2PKAA 4ZXYH 2EDVA 3GICB 3UQVA 1LVOA 4JORA 4DOQA 3NZIA 1C2LA 4K5ZA 1OWEA 4UE7H 3V3MA 4I32A 3R3GB 1GHAG 2R3UA 1C5XB 3AW1A 2BZAA 3E16B 4XE4A 1GQ4A 1SLVB 2EEHA 1ELDE 5C3NA 5E0JA 1G2MA 1GBLA 2VIOA 4MPUA 1G2LA 2ESTE 1LPKB 1XKBC 2PUQH 4ABDA 4JZDH 2Y82A 1O5GH 3ITIA 2PKSC 3PDZA 2FLBH 4CRFA 4UFEH 3FANA 4ZXXH 2IWNA 1W9QA 1DM4B 1FY8E 1O37A 3HATH 5B6OA 2VGCC 2JETC 4BXWA 3M7TA 1UF1A 3HPTB 1UTLM 5EQRA 5EU8A 3R68A 1QL7A 1M5ZA 1X6DA 4RKOB 4X1QU 2QF0A 3OTJE 5L2ZH 4Y8YA 5CMXH 1EAIA 2CSJA 1K1MA 2OC1A 2VWOA 3PO1B 1GJ9B 2QAAA 2Q6GA 4JOJA 2ZGHA 5FXLA 1V2NT 1ZSLA 3ZZ8A 1LMWB 3A80A 1TB6H 4OS1A 3PMHB 4D9QA 1P05A 1ZPZA 4GHQA 5AFYH 1H1BA 2RG3A 1F0SA 1ZTJA 1A4WH 2QIQA 2ZFFH 1F5LA 2QV1A 1QQUA 3HGPA 3MMGA 1N7FA 5GLJA 1TNKA 4JYTA 1KXAA 3QIKA 2Z9KA 3GY2A 1UVUH 1TP5A 3RM0H 2FWWA 1WOFA 2ZDMA 5EYZA 3BTGE 2R0LA 3AAVA 2J95A 1OWIA 2ZWLH 5GIBA 3FVFB 1SOZA 2AGIX 3MYWA 3RMMH 2ALPA 3KCGH 3V12A 4OAJA 1ANCA