3GCNA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with omp peptide (yqf)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
300
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Mechanisms of allosteric activation of the DegS protease by OMP-peptide binding and protein-substrate binding
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 300
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcnA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA01
1A3BH 2D8WA 1O5BB 1QBOA 4WH8A 1TX8A 1O5AB 2YNAA 3STIA 2YOLA 3E90B 1GDNA 1NRQH 2NU3E 2ENOA 1Y7NA 2KBSA 3MU8A 1PPZA 1MKWH 1SGFA 3TIUA 3QLPH 4FVDA 3MNSA 3QK1A 1KLJH 1U39A 1QJ7B 2OD3B 1TYNA 1Q3XA 2ZFRH 1OP8A 2Y5GA 3BIVH 3T27A 2BY9X 1TRMA 2Z9LA 3QDOA 1NESE 2PGBB 1OKXA 5DP7A 1WQVH 4Y7BA 3ZVGA 1T31A 3ZZCA 1AN1E 2A7HA 5DK1A 3CP7A 2FTMA 1N7EA 2D8IA 1K28D 1P3CA 3QTVH 3RXHA 1XVOA 3HGNA 1C5YB 2QC2A 2FOAA 2ZTYA 3ZZ5A 4O3TA 3GGEA 3URDA 1P02A 2FOGA 2DLUA 1TMTH 2VWNA 4K8YA 3IWMA 1TBQH 1RFNA 1LVYA 3M36A 1DWEH 4B74A 1U37A 4AOQA 2WUCA 4HGCA 5L30H 1H8DH 3A8DA 1X5RA 1JWTA 4TY7A 1LHGH 4U32A 3PM3A 3M3VA 3HKIB 4KKDA 4NZLA 1ZMJA 3BTTE 1IAUA 4Y11E 5EXNA 2V0BA 4NXPA 1O2LA 3KZEA 1FY4A 3UTUH 1TNLA 1Z7KA 5C5OA 2ZTZA 3UWJH 3GSLA 3O46A 5GXPA 2F9VA 4ABDA 7GCHG 4K3JA 4QT8C 1C2MA 2TPIZ 1VR1H 4MVNA 4YTAA 2H3LA 2BD5A 2BY6X 3JZ1B 3A7YA 1L1JA 2IWQA 2UUJB 3Q3YA 1SOZA 2I0LA 5DTHA 2ZC9H 6ESTA 2SGDE 1YP9A 2VWLA 3GCHC 3RU4T 3SFJA 1TOCB 1VCWA 1F0TA 2ZU2A 1O2NA 1E34B 3K65B 4FUCA 1O32A 3EAJA 1ETSH 1C1SA 2QY0B 1C5UA 1P8VC 1FQ3A 3ID2A 1OWKA 1HAYB 5FCKA 1C1PA 1TGTA 1AI8H 1QLCA 1TONA 2PKSB 3U9AH 3MH7A 1JRSA 5I46H 1UEPA 2AMDA 4LOYH 1V6BA 3UQOA 4K6YA 1QBNA 1FXYA 2G5MB 2ZFTA 2BDYA 1ZJKA 1O2UA 1GL1A 1RTLA 2NU2E 3GCHB 4FGMA 2ZPMA 2OCSA 1CBWB 1P1EA 1TQ3A 3SJ9A 2BXUH 5LPFA 3EE0B 4LZ1H 3MWIU 2KJKA 1UTJA 1TA6A 2M5TA 2M0TA 4GVCA 1VGCC 3TK9A 1MZAA 3ZYEA 1AVGH 2W7UA 1P57B 2REYA 1L1NA 1LPKB 1SSXA 2XW9A 2YNBA 2OSGA 3NCLA 2F91A 3NKKA 4K2YA 3STJA 1KEFA 2A0QB 4NIXA 3HATH 1CT2E 4X6OA 1TNGA 1P9SA 1GBDA 2CHAC 2EGNA 3VQGA 1FCFA 2DLSA 2H2BA 1IQHA 1E36B 4CRGA 3L4FD 5HFCA 4Q6SA 1BHXF 4MPVA 2V6NA 5F03A 1YBWA 3O5NA 2ZWLH 1Z8JB 1YF4A 3SNCA 1VGCB 1AKSA 4DOQA 3TSWA 1ANDA 2WPMS 3G01A 2R2MB 4K60A 2H5CA 2Z9GA 1KXAA 4MNVA 2KOMA 1GMHF 3KNXA 1Y3WA 4ISIH 1CA8B 2I1NA 3M61U 1RS0A 3FZZA 1C1WH 1KYNA 1TX6A 2GCHF 3LH3A 2CHAB 4CR9A 2AINA 3NFLA 3VQFA 5DP5A 1WHAA 1QAVA 1EPTB 3EA9A 5T6GA 1ELFA 3SJKA 4DCDA 1AFQC 2FLBH 7ESTE 3H7TA 1TGNA 1C1RA 1NS3A 2KOHA 5H4IB 4YM9A 1ESBA 3SUDA 1DOJA 1RTFB 1J16A 1HXEH 3CS7A 1V6DA 2FOHA 3KN2A 3HPMA 4HTCH 3LPRA 5IYTA 4L8NA 2STAE 1CVWH 4MNWA 3LONA 1W2KH 1XZ9A 3VB4A 4TWYA 4UEHH 4AFSA 4I7YH 1TIOA 3SU2A 2JWEA 3I77A 3LJOA 4X1SU 1CHGA 2O8WA 1AUJA 1GHXH 5E0HA 1D3TB 1TMUH 1ANEA 2F9BH 1IQIA 1QRWA 2J2UA 1FIZA 2TGTA 1P2OA 1GBMA 1K21H 1N99A 1O2JA 2PKAA 1G3CA 4MNXA 1Y3YA 2FYQA 1TBRH 5J4SA 3DJ3A 2OP9A 2CJIA 2W3KA 3E16B 1EAUA 2ZF0H 1OWIA 3F9FA 3U8OH 2GTBA 3C1KA 1EAXA 2B0FA 1QFKH 1GVKB 1G36A 1RD3B 4JZ1A 3U8TH 1BBRE 3SNBA 1QA7A 1UJUA 3IG6B 2VZ5A 1EOJA 1GJ6A 2WV5A 1OBZA 3SN8A 1P0SH 5C67A 3SJ8A 1X5NA 1AZ8A 1O3AA 1DM4B 1UTLM 1A3EH 4DW2U 3M35A 1MU6B 4UDWH 1KXEA 1MTWA 1L6OA 2D90A 3QWCH 3UUZA 1D4PB 2FLRH 1OWDA 1WI4A 1Q2WA 3A7WA 2A2XH 4X6NA 1EAIA 1WJLA 3U69H 1D6RA 2AH4X 1KDQA 3GY4A 1GCTC 4MG3A 2ZHWH 3P6ZB 1DSUA 3MTYA 4NNLA 1AVXA 2OZFA 3PMBB 1RZXA 3UOUA 1NZQH 3I29A 2Z9JA 3MFJA 1GBTA 3SHUA 2QN5T 1AMHA 2VIPA 4Y10E 1GHYH 4E06H 1ABJH 8GCHG 2FOBA 3TMHA 1S85A 2KPKA 2P3FH 1DDJA 3KIDU 5DP6A 3ODDA 1MD8A 4YESB 1WYKA 4Q2PA 1KTTB 3K2UA 1GI7B 3TGKE 2WUBA 2FPZA 2BLWA 4ABEA 3S9CA 1GCTB 4ABIA 5HEDA 4I33A 4X2WA 4KP0A 3BSQA 4CBNA 2QYIA 1SGFG 1IHSH 3HVQC 2ZHQH 4AG2A 2WYJA 2M3MA 2GCHG 4THNH 5F6MA 1UTMA 1OWJA 1O5FH 1CGIE 1MBMA 1EASA 1GHVH 5E0JA 2C8YB 1FN8A 2GDEH 3RLWH 5CHAC 3UNQA 3SOEA 1ZR0A 3S0NA 2OGPA 1K1OA 4MPAA 1BTHH 1C4Y2 3DFJA 1NRSH 3A82A 3QGLA 1GBHA 4ABBA 4GVDA 1AQ7A 3QN7A 1VITF 1BCUH 2KL1A 4M7GA 1HJ9A 4MNYA 1K9OE 2ZPQA 3NPSA 1S81A 4NWKA 1YLDA 1P12E 3BEFB 1L4ZA 1H4WA 5CMXH 4Y8ZA 1DS2E 1CSOE 4Y8XA 1HB0B 2F83A 5C5NA 2BD9A 1PPGE 1HAVB 4Y6DA 1O3HA 1YKTA 1ZGIA 1A5GH 2BHGA 2O8MA 4JK5A 1B5GH 2HALA 3MO9A 5HF1A 1O35A 3ZZBA 1WI2A 2LA8A 3RXVA 1Z71A 4B1TA 2XC0A 1AVWA 1UJ1A 5H3JA 1NFYA 4NMPA 1W11U 4RI0A 4Q80A 2FESH 2FX4A 2WYGA 4NIWA 5E8EH 2CF9H 1HIAA 1V62A 2G2LA 5C1UA 2JOAA 3A8BA 5A0CA 3PV4A 4JCNA 2FWWA 4U30A 1ORFA 2CGAA 2SGAA 4FUGA 4NNMA 1DXWA 3ZZDA 1TNIA 3V13A 3TNTA 2H2ZA 3O8BA 1J17T 2WV4A 2FOCA 4UFGH 2RRMA 1NROH 5T6FA 2ZGJA 3PLBA 2BVXH 2G5NA 1SGRE 2BQ7B 1WFVA 1P09A 1O3KA 1IQNA 1O3FA 3RXMA 2FMJA 1KLIH 1ARBA 5F3XA 2QIQA 1TNJA 2P94A 2EJYA 1IQLA 1ZLRA 5EQRA 2FS8A 3PMJA 2PUXB 2B9LA 2C3SA 1TALA 1WHDA 3T25A 1QY6A 1EB2A 1P04A 1N6EA 1FZZA 3A80A 1LO6A 1CGJE 3ESTA 1XXDA 2UUKB 3F1SB 4AMHA 5F8ZA 3VEQB 2Z94A 2HPQH 3GOVB 4Y8YA 1AUTC 1AFEH 3K50A 1FIWA 3RXDA 3HGPA 5HM2A 4K1SA 1P06A 1V5QA 1MAXA 5T6DA 3HK3B 1TPPA 3RXSA 1O2XA 1HFDA 2CN0H 1UK4A 1A2CH 3M5NA 3CYYA 1FY5A 2BX3A 3VFEA 4ZHLU 3RLEA 1DFPA 1JXPA 2FN5A 3GDVA 1SFQB 2YT7A 1HJAB 1GHWH 4O06A 1SL3A 4NA8A 2EI8A 5HFEA 5C20A 1QB6A 4D9QA 1K32A 1O3MA 1ZPBA 4BNRA 4NIYA 1SGTA 1Z1IA 3A81A 3LGIA 4KTSA 2FE5A 4IW4E 2K1ZA 3H5CB 3SU0A 3F68H 2QBWA 5I7ZA 1P2MA 4JYUH 7LPRA 1O2SA 4XHVA 1AWHB 4IS5A 4FUIA 4INLA 1VITG 1HAHH 3TH3H 1ZOKA 2VU8E 3E3TA 4CRFA 2JH0D 1C1OA 4MDSA 2EDPA 1TOMH 1Q31A 4AGJA 1UM7A 1YLCA 1W7XH 2AS9A 2XBYA 1TB6H 3A7VA 3VGCC 1H8IH 3ATKA 4YT7H 2ZI2H 2WPJS 1QRZA 1SQAA 3SJIA 3SV6A 4K8BA 1UVSH 3PYHA 2ZDNA 1SI5H 1QB9A 1GBBA 1MC7A 4OAJA 4B76A 1PPEE 3ZZ8A 1ZHRA 2HOBA 2SFAA 1WIFA 1JRTA 1C5MD 1LVMA 1UTOA 3A89A 5E0GA 3SORA 4HOPB 1O36A 2C8WB 1O3LA 1CE5A 3ZYDA 2VWMA 4KELA 5JB8S 1TNKA 4FUFA 3RMNH 4GSOA 1CO7E 3ITIA 3SV2H 3TU7H 2FS9A 3T5FH 1BOQA 1VB7A 1EZQA 1GBCA 1U3BA 5I25A 4R2ZA 1CT4E 3VGCB 4K76A 1OP2A 1SLXB 5FAHA 1GQ5A 1SGIB 2Z9IA 2LC6A 2BB4A 2QT5A 3KQCA 4O97A 1EATA 2JH5D 2FOEA 3F9EA 5FX6A 1C2IA 3I78A 1LTOA 1CT0E 1XUIA 1BDAA 3CENA 4UONA 1C2DA 1WBGB 2ZFFH 4BAKB 1SQTA 5GNDA 2P16A 1UEZA 1UCYH 7GCHF 2I6VA 1GJBB 2OC1A 3FFGA 3RXFA 2OTVA 3VXFH 3A84A 2VWRA 3MNBA 1A5HA 2FODA 3PWCA 5K7RA 1G37A 1GGDC 4FUDA 3BTHE 1DWBH 1MUEB 4ZROA 1K1NA 2PUQH 2ZDKA 3ID3A 5AHGH 1C2GA 1PPHE 2KAIA 1LVOA 3EA8A 1BRCE 4XDEA 1CHOG 5DKMA 4JZIA 2ANYA 2QGRA 4NMSA 2CF8H 2IN2A 1E38B 1DWDH 3V7TA 1V2KT 1MQ5A 1HGTH 2XWAA 1ZHMA 4WY3A 3PLPA 2I04A 1C5QA 2XC4A 3OYPA 2HGAA 1N1LA 2BLVA 4ISHH 1O2IA 3AW1A 4HZHA 3R68A 4XOJA 1ABIH 3RM0H 2BDIA 1GGDB 3T26A 1VCQA 1KXFA 2A45B 4NA7A 1GI8B 5HFBA 3MH4A 1T4VH 3BTEE 2KRGA 2W5EA 4YLQH 1Y3XA 1LPGB 4R0IA 1T2MA 4NWLA 2EDZA 1LHEH 3TITA 4ABGA 1KWAA 4AFQA 2NU4E 3NFKA 2FM2A 1KXCA 2F9UA 3F9GA 2PWXA 3ATIA 1A1RA 1G2MA 2BDBA 2KV8A 3I4WA 2JINA 2WPKS 4AYYB 9LPRA 1P10A 3Q3XA 1GI2A 4D7FA 3SNEA 4BTTB 5EYZA 3CBXA 3LGVA 5J4QA 3QJMA 3DFLA 5EODA 2R4HA 3M3SA 2QF3A 4NMOA 1ELGA 3FVFB 3EQ0H 2XBVA 4INHA 2H9HA 3RXTA 3RXCA 3UFAA 4K5ZA 3PLKA 5LH8A 2EI6A 2ZP0H 1MMJN 4NMQA 1GHAF 1UO6A 1DLEA 2PHBA 3HPTB 1HAPH 1TRYA 2UUFB 4O3UA 1Y8TA 1EP5A 3ZVAA 3GDSA 1GBFA 2ZHEH 2GZ9A 5EZ0A 1HV7A 1GBLA 3HPKA 3GYLB 3NGHA 2Z6BD 2EEHA 1F5LA 2R3UA 4K1TA 1ZSJA 5EXLA 5FCRA 4ZKSU 1C2JA 1O3CA 2O2TA 2QXHA 1D3QB 8KME2 1N7TA 3SJOA 9ESTA 2XRCA 2PTCE 2FXRA 1GI1A 2GMTC 2VJ1A 4TWWA 5EW2H 4D7GA 2ODYB 4NMRA 2EEGA 3AAVA 2OINA 4E7NA 2PKUA 2KYLA 2PZDA 1HNEE 1G32B 4OGXA 1AIXH 1FLEE 4B2CA 1C5VA 1PDRA 3AASA 2KG2A 1FI8A 2OPGA 4YO9A 1VZQH 3V0XA 2A1DB 1A5IA 3GY8A 2HVXA 2ZPSA 4BXWA 4D9RA 1P01A 2A4GA 2BD2A 4JORA 1ZGVA 2AFQB 1VJAU 1O3JA 1W0YH 2TRMA 3PO1C 3RMOH 1BRAA 3RXPA 2ZA5A 1MH0A 2LNCA 2KQFA 2OXSA 3ATLA 1IQGA 1DUEA 4JOGA 1WQSA 2ZFQH 4UFFH 3VB5A 1F7ZA 4AG1A 1V2MT 4A6LA 2LOBA 1C2FA 1P2JA 1TA2A 3O8DA 2KOJA 1EXFA 1V2UT 1SGYE 1LPZB 2DM8A 3BTGE 4GLYA 2PDZA 3I18A 2FI4E 3GICB 3LOXA 1V2QT 5DO4H 3ID1A 3RC4A 3LIWA 1GJ8B 1OWHA 3SV8A 4X2XA 3PV5A 3ZVFA 1Q7XA 2EEKA 3PO1B 2QA9E 2PNTA 1JOUB 2H5DA 3GY3A 4E7RG 4YOJA 2Z17A 4BXSA 1FN6A 1EKBB 3RMMH 4FU8A 5AF9H 2ZEBA 1QIXB 2Z7FE 3M37A 5FPTA 5HYOA 3VPKA 1TP3A 1AGJA 1LQDB 3E91A 1YPHE 4MPUA 2ESTE 2QG1A 1UTPA 3E17A 1T32A 2PTNA 3ZV8A 1A4WH 2ZZUH 4BAQB 2FTLE 4H42U 3TJOA 8GCHF 4UFEH 2QKVA 1YPKH 4J1YA 3L33A 1C5SA 1GL0E 1O2WA 2M0ZA 1BJUA 3JXTA 5A2PA 2ZGXH 1Z8RA 1F5KU 1QL9A 1GHAG 2VNTA 4RSPA 4JOHA 3OU0A 2O8UA 1DE7H 3ID4A 3DHKH 5EPYA 3SU3A 4NA9H 4ABAA 1FC6A 4WWYA 1HDTH 1O2VA 4H6TA 5FBIA 4I8GA 1YC0A 1BHXB 1HAZB 3OY6U 3PB1E 3KQDA 1PQAA 1OOKB 3UIRA 3VB7A 2PV9B 5C2ZA 4NXQA 2ZQ1A 4OS7A 2I6QA 4JZEH 1QGFA 4YOIA 3SHCH 2ZG0H 1ZTLA 2JH6D 5L2ZH 2XCFA 1SLWB 1LHDH 2VINA 3P8OA 1F2SE 5SGAE 4PQWA 3R0FA 1C1UH 2QCYA 1SLUB 3AW0A 3QGJA 4CRDA 2VH0A 2BD4A 5HDYA 2TBSA 1MCVA 1QA0A 3U1IB 5A8XA 1QQUA 4Q7YA 1V2TT 3SU1A 2BOHB 1GJ7B 2B7DH 1CA0C 1QURH 5HGGA 4OS2A 4Y0YE 3UNRA 4K69A 1L0ZA 4FU7A 1UHBB 1ZMNA 4A1VA 1OBYA 1Z8GA 4BOHA 2A7JA 2DUCA 5FHTA 3RU4D 1YPEH 1A0JA 2AERH 4IN2A 1WTGH 3TJUA 1S6FA 1KXDA 4DG4A 1AFQB 2EDVA 3ZZ9A 4NSVA 1D3PB 2VH6A 1P1DA 1R6JA 2ODPA 3MO6A 3BPUA 4Y7AA 2DE8A 1ZZZA 3V3MA 4D8NA 1FPHH 3FZDA 3BEUA 2M0VA 4ASHA 4YZUA 4E05H 1IQFA 5C1XA 4NXRA 1S82A 1CA0B 3BTDE 1K1MA 1EOLA 3UREA 4UU5A 3ZZ4A 3UQVA 1H9HE 1D6WA 1O3IA 1BQYA 2FOFA 1JBUH 1OPHB 5JBTA 1GCDA 2LC7A 4KFWA 1WU1A 3K6ZA 5HFDA 2ZQ2A 3PDZA 4ZXYH 1L2EA 3BG4C 5C3NA 3SHAH 2ALPA 1GJ4H 2ZDMA 1UEWA 2OS6A 1O2HA 3F6UH 4X1QU 1LKBA 1FMGA 4XSKU 2NWNA 2Y6TA 3U1JB 1J14A 3RXGA 4DGJA 1GI5A 4OEPA 1IU0A 2GKVE 1OX1A 4CH2B 1DT2A 4X1PU 4XFQA 3NZIA 1VITH 2C93B 2RA3A 4Q2KA 4ZKNU 3V12A 2F9NA 1HLTH 1UJDA 1MTSA 2ODQA 3GY2A 2P3WA 2YT8A 1NU9A 4JYTA 5BRRE 1GBIA 5CE1A 1QB1A 4NFEA 2GZ8A 3PTNA 2WINI 8ESTE 3WKMA 4DT7B 1FY3A 1SVPA 1OS8A 2ANKH 1G2LA 3UR6A 4I31A 2ALVA 2FP7B 3P70B 2WPIS 5E1YA 1I16A 2QKTA 3QE1A 2DAZA 2ZPLA 4DIIH 4TPYA 4HI3A 2MX6A 3D23A 1LKAA 5GCHG 3TK6A 2HWLB 4GHQA 5LPRA 5AFYH 4HOPA 3K9XB 2Z3DA 4PROA 1RJXB 1BTPA 2ZU4A 2VIQA 2BQ6B 1NU7B 2BLOA 2HNTE 1B0FA 2W26A 4X1NU 3S9AA 2QAAA 1V2RT 1MTNC 1QNJA 5HF4A 2AWWA 1YCPK 3ZZAA 1C4V2 3PMHB 5EQQA 1WF8A 3P8FA 1BFEA 2F9OA 3LKWA 5DGJA 1MBQA 1S84A 2R0KA 3A87A 2DMZA 4VGCC 1GVLA 2GCTC 4GCHG 5EXMA 5HJ1A 4WH6A 4AB8A 3OTPA 3GY6A 2ZU3A 3BTQE 1BUIA 5AVDA 2AYWA 2JILA 3LU9B 4J2YB 2QKUA 3OY5U 4I8HA 3LNYA 2BDCA 5BPEA 2RCEA 3URCA 4SGAE 4ZKOU 5CHAB 1GM1A 5EPNA 1NM6A 2H6MA 3BTKE 3QJNA 2KA9A 4NIVA 1EUFA 5DP3A 1SHYA 2AGGX 2VVVA 1ZTKA 5FPYA 3B9FH 2YUYA 1S0RA 1UTNA 2PSYA 2XC5A 1A7SA 2P8OC 1XM1A 1GDQA 2AMPA 2EXGA 2EHRA 1WOFA 3NUMA 4VGCB 1E37B 2GCTB 1RIWC 1SBWA 3WKLA 2OC7A 2VGCC 1XVMA 3GCOA 1C1QA 4LXBH 3TJNA 2Z3CA 2HGTH 4WVPE 4I8KA 3PTBA 1WG6A 1RGQA 2ZCKP 4A5TS 3U98H 3SU5A 1GBAA 3A85A 2Y80A 2V90A 1W0ZU 1PJPA 1O3DA 1O2KA 2BX4A 1K1PA 4AYVB 3M5OA 2G4TA 4P0CA 2OLGA 2VSVA 1FY1A 4FUJA 1NFXA 3KGPA 1O5DH 1GMDF 1PQ7A 2P8OB 2ANWA 2DB5A 4JL7A 1WSSH 3LT3A 4BAHB 1UK3A 1F0SA 1ZSKA 4RKJB 3SQEE 1DLKB 1RIWB 1XMNB 4OS1A 2VGCB 4O9VA 5JYIA 1GBKA 4AFUA 5DPAA 3Q3KA 1GVZA 1V2OT 2BDAA 3E8LA 4JOFA 2VVCA 1ELVA 1QL7A 4X8TH 3SO3A 1PPFE 1SLVB 1TPOA 2ZDAH 2D26C 2Q6FA 4BTIB 1MFLA 2H2CA 1DY8A 3E0NB 1CHOF 3D62A 3ZRTA 2V3OH 1YCPH 1UITA 3MU4A 1P05A 1VJ9U 3CBZA 1XKAC 5LGOA 1ZRBA 1ETRH 1C1TA 4X6PA 3KHFA 1BBRK 5A8ZA 2F9PA 2GVFA 3BIUH 3WY8A 2JETC 4B2AA 5IDKA 2BMGB 2WL7A 1F0RA 5AFZH 1FPCH 2ZTXA 5JXBA 1F5RA 1DSTA 4ZH8A 3SV7A 3T28A 2YUBA 3TH4H 1C5PA 4TPIZ 2BVSH 3AAUA 2L97A 3EGGC 1BTXA 2C4FH 2RG3A 1WV7H 1N6YA 3A7ZA 1V2LT 1HPGA 2NU0E 3SNDA 5A8YA 4Z6AH 2Y7XA 4OGYA 5G1EA 1KDQB 2FI5E 3SUFA 4ZAEA 1M9UA 2CV3A 1WF7A 3LH1A 4YDPA 3QZRA 1O2QA 3TSZA 5EW1H 2OQSA 1GI4A 4JOPA 1H9IE 1EJMA 2SGFE 2JETB 3VXEH 1RXPA 1TQ7B 4JOEA 1C5LH 3MU5A 4ISLA 5T3HA 5EGMA 2JKHA 3BTME 4X1RU 3RXIA 1O3NA 1KLTA 4NG9H 3D49H 4BAOB 2W7RA 1MCTA 4NZQA 3SW2B 3U8RH 4R8TB 3P17H 2BLQA 3RU4E 4X6MA 5F8TA 1BITA 2GV6A 2Z3EA 4NSYA 1ARCA 1AB9C 4UU6A 2VPHA 3BV9B 1AZZA 4B71A 1WH1A 1SGEE 4IGDA 1PPBH 2TGAA 3SGAE 4A1XA 1F0UA 3K82A 5DP4A 1O2RA 2CSSA 1SB1H 1NN6A 2IWNA 2YTWA 1OXGA 4AGKA 1MKWK 1EZSC 1C1VH 1YCPM 2JIKA 1Z1JA 1GMCF 5GPIB 2X7ZA 1O2TA 2AWUA 1XUGA 5HEBA 2PFEA 2H9EH 4X8UH 1FUJA 1THRH 1EZUC 1FY8E 4FXGH 1W9QA 1S83A 3LDXH 1GQ4A 1GMDG 3ZVBA 2V1WA 3UY9A 4FU9A 1Q3PA 1TAWA 3DORA 1V2PT 3LJJA 4BAMB 1W8BH 3EDXB 1AY6H 3R0HA 3GDUA 1BTWA 1AWFH 3JZ2B 1BBRH 5GDSH 3OTJE 3M5LA 3QTOH 1NF3C 2OUAA 5E11A 4H4FA 1C5XB 1YPLH 3E6PH 1O3GA 2GT8A 2XYAA 1VCPA 1EB1H 4E35A 4U01A 2OC0A 2H9TH 3RXQA 3RXLA 3UNSA 1C1MA 1C2KA 1FC7A 2BVRH 5HXFA 2O8LA 1HAIH 4YYXA 4WMFA 4ESTE 3MMGA 2WPHS 3A7TA 3F9HA 3MNXA 4Q7ZA 1UK2A 1OYQA 2BDHA 3T2NA 4A7IB 2JXOA 5L6NH 2G51A 4K78A 1P2NA 1YPJH 1HIAB 1X45A 5DP8A 4X2YA 3E0PB 1W9EA 1FAXA 1GJ9B 1NRPH 3P92A 5PTPA 4BANB 4DURA 1PQ5A 3B76A 2GD4B 3TNSA 2F0AA 1PPCE 1MZDA 3TSVA 1HUTH 3R69A 5EQSA 2BY5X 1UVOA 1TFXA 4CRAA 4XBCA 3PV2A 2A32A 1O3OA 4AN7A 5G1DA 1SG8B 1S0QA 1GI3A 2G81E 4Y71A 1KY9A 2ZDLA 1NPMA 1HCGA 3RP2A 2FI3E 4JZDH 4ZMAH 1JMOH 1UMAH 1O39A 4N6XA 1ESAA 2Q1JA 2HLCA 1ELTA 2G5VA 5B6LA 1O0DH 1VAEA 1V1TA 1WTHD 2ZO3H 1RGWA 1T8NA 1V2WT 3NK8A 3UPEA 1Y5UT 2A4QA 1P3EA 1EPTA 1GBJA 4F49A 4B73A 1P03A 4MQAA 5GIBA 2D2DA 2FCFA 5A0BA 4Z0KA 2BYAX 2L4TA 4ZUHA 3SU4A 4E3BA 1L4DA 2Z9KA 1DVAH 2C8XB 1GJAB 5TCCA 1DANH 1V3XA 1C5TA 2BQWB 1NO9H 1ZRKA 2TIOA 4XBDA 2B5TB 1Q3OA 3P8NA 2V3HH 1K22H 3QX5H 5HMAA 1V2NT 1RTKA 2D92A 4OS5A 4UD9H 5FBEA 2Q6GA 1UHBA 1UHPA 4AZ2B 1TNHA 3MH6A 2D1JA 3W95A 1ZUBA 1SQOA 3TH2H 3S69A 3TJVA 2EI7A 4DIHH 1YPGH 2R9PA 1FC9A 2A5AA 2RDLA 3ZZ3A 1T8LA 4GVUA 1O3PB 2BZ6H 4MLFB 1ANCA 1Z6EA 1QQ4A 2G00A 2OQ5A 3TVJB 1GMCG 4ZHAA 2GZ7A 3A88A 1QTFA 1O33A 3TGIE 1XKBC 5JBCS 4D76A 3BTFE 1NTEA 1ELEE 1ACBE 4B2BA 4CREA 3NXPA 3CS0A 4G69A 3O8CA 2L4SA 3SNAA 4YLUA 2DJTA 2BOKA 1XXFA 1IHJA 2THFB 3A8CA 2KPLA 1I92A 2HNTC 1FJSA 2J9NA 1W10U 1XX9A 1HAOH 3C27B 1O3BA 2G8TA 1O2PA 1GWAA 3SGBE 3SI3H 4UE7H 1LQEA 1TWXB 1THSH 5FX5A 1IQKA 3RM2H 3RUOA 1XUJA 1ZTJA 3ENSB 3OSYA 2PKSC 2ZCHP 1TQ0B 2J94A 4LK4A 1JIMA 3PROA 2IOTA 3UR9A 2HNTF 4Q2NA 4AFZA 4Q6HA 3MH5A 3DJ1A 2VIVA 4GAWA 1O30A 2BTCE 2FO9A 3E1XB 1HYLA 5TCAA 3RXKA 4XE4A 2RA0A 1O37A 2PA1A 3SZNA 2PKTA 1GJ5H 1OZIA 2A7CA 2GMTB 3MNCA 4GUXA 1NFWA 1MFGA 3KQEA 2PW8H 5D13A 3O8RA 3TGJE 1CBWC 1ZSLA 1VJ6A 2UUYA 3RXAA 2XBWA 1QAUA 3LNXA 4I32A 1AHTH 3DIWA 3GY7A 1T8MA 2OQUA 1K1JA 2Y5FA 1G9IE 1C4U2 1EJAA 2BY7X 3KZDA 4ZKRU 1NRNH 1AE5A 2UZCA 4YT6H 2XNIA 3Q77A 3OX7U 1WFGA 3ZVCA 2EGOA 1SGQE 2JREA 2DC2A 3LGWA 1O2OA 5F8XA 2A5KA 4WMDA 1GJCB 3DT0H 4Y76A 2G55A 2EAQA 4KFVA 1GHZA 3ZVDA 3PMAB 3EA7A 1WUNH 1RRKA 1YYY1 2A4OA 1OYTH 1GI6A 1Z8IB 1G30B 2M0UA 4WF8A 2GDDA 4CH8B 3PS4A 4KGAA 1O31A 4Y0ZE 1NFUA 1O34A 2KAIB 3SGQE 2XBXA 1EX3A 3GYMA 3Q00A 3MO3A 1B7XB 1EQ9A 1B8QA 1GPZA 1Y5BT 1CQQA 4IC5A 1MD7A 1HAVA 3NWUA 4JZFH 4A92A 2HRVA 3S9BA 2VRFA 1ANBA 2PGQB 1EPTC 1W12U 2R2WU 4INKA 1A46H 4O03A 3RXUA 2B8OH 4A1TA 4CHAC 5GCHF 2VSPA 1NRRH 4WXVA 1LHCH 2SGPE 1BB0B 4X8SH 4P2AB 4NFFA 1OSSA 2EA3A 5JDUB 3KF2A 1D9IA 1G3BA 2W3IA 2Y81A 2QV1A 2FDAA 2UWOA 2OBQA 1V2JT 5L2YH 1FAKH 5JBAS 1QJ1B 1THPB 3DUXH 1N6FA 1GJDB 1GHBF 5B6OA 4H6SB 1QBVH 1NT1A 2CS5A 3W94A 4ISNA 3ZV9A 4FVBA 1ELDE 2GT7A 4RN6A 2WPLS 3M7TA 4GCHF 5JBBS 1N6XA 4CHAB 1P9UA 2BDGA 2EGKA 5LPEA 2VIWA 2G4UA 2GZVA 1ELAA 2PLXA 2FZZA 4JK6A 1BTZA 3RXBA 2F5YA 1AO5A 1N8OC 1L1GA 3M7QA 2BD3A 2GX4A 5F67A 2LPRA 1O2ZA 3QIKA 1SGPE 4NGAH 2FX6A 2P59A 3ELAH 4I8LA 4ZXXH 2ZHDA 3S7HB 4Z8JA 3MI4A 4CR5A 1LMWB 2VIDA 5GLJA 1O5GH 1O2GH 1Z6JH 1TABE 3GISB 2QXIA 2Q3GA 1J15A 1HRTH 1LVBA 4GHNA 1P2QA 1F92A 1SPJA 3LC3A 3DD2H 1PQ8A 4IMZA 4UFDH 1E35B 2FIRH 2EEJA 1UCYE 1MKXK 3ATMA 3KL6A 2MHOA 3EGKH 3ODFA 3RL8A 1HAGE 2AIQA 3A8AA 3A86A 3PWBA 1N8OB 4YOGA 1A0LA 1O5EH 2ZDVH 1W9OA 6CHAC 4OEOA 1C1NA 1MTVA 4X0WU 4ABJA 2J95A 1UFXA 1BMLA 3EGHC 2PSXA 4FUHA 1IQJA 4KTUA 1H1BA 2FNEA 2BY8X 2XWBI 3BTWE 2OC8A 4AX9H 2ILNA 2A31A 8LPRA 3L3TA 2EV8A 2AWXA 1T7CA 4JYVH 1HXFH 1K1IA 2KJPA 3TPIZ 1P2IA 1YPMH 1P11E 1UVPA 2SGQE 4B75A 3SHWA 3BG4B 5HETA 2ZFPH 1C5WB 3ZZ6A 1QR3E 3M7UA 1W14U 2BXTH 2Y7ZA 5FPSA 2QXJA 3LGYA 3RXJA 6CHAB 3M5MA 1S6HA 2HE2A 4Q3HA 1TE0A 4CRBA 2XCNA 1OWEA 5JPMH 4KTCA 5GJ4B 1BIOA 1SHHB 4K72A 3RXOA 3Q76A 1BZXE 1G3EA 2P3UB 1X5QA 1O2MA 3ZZ7A 1UF1A 1N7FA 2K20A 5A09A 2IWPA 2OCVB 3QZQA 6LPRA 5DJ7A 1SMFE 2P93A 2PR3A 5FB8C 3H7OA 1TPSA 1U6QA 2XXLA 3FANA 1BJVA 4CBOA 1GMHG 1BE9A 1NY22 3SU6A 3CC0A 3DJAA 1BRBE 2GP9B 1BTUA 1BA8B 2IWOA 1BMMH 4H11A 5ESTE 3CBYA 1GHBG 1GBEA 1G3DA 5G4BA 7KMEH 2C90B 2TGDA 2GGVB 2J4IA 1QL8A 1TLDA 1UM1A 1DY9A 3T62A 3HKJB 6GCHF 2ZGBH 3TK5A 1P2KA 4E34A 1W3CA 1QCPA 4DJZB 1DX5M 1CGHA 2SNVA 3MYWA 1X8SA 2Y5HA 4GHTA 1U38A 1C5ZB 3P8GA 4F8KA 1ELCA 4WYTA 1TGCA 1MKXH 1IU2A 2Y82A 3CH8A 5HEYA 4JOKA 1AU8A 1TRNA 1ETTH 4Y79A 5ABWA 1MTNB 1Y3VA 1V2VT 2I0IA 3QDZB 2AGIX 1OBXA 2OMJA 1UTQA 1FV9A 1B0EA 2UWLA 3GJ9A 1AKSB 2FYRA 5E2PA 1E0FD 4DVAU 1TPAE 4ABFA 2ZGCA 2A5IA 2M10A 2GV7A 1SC8U 2G52A 1ZYOA 2EC9H 2I4SA 5EOKA 4RKOB 3KHVA 2C8ZB 1X7AC 3FP6E 1SGNE 1AD8H 2ZPRA 3QO6A 3SUEA 4NCYA 1VA8A 2BM2A 4TYDA 3A83A 5C1YA 1KIGH 1DPOA 1ZPCA 2AEIH 4IMQA 4XBBA 4AORA 2BD8A 1QAVB 1ESTA 4ABHA 3BN9A 2NU1E 4X2VA 2SNWA 5JB9S 3GCNA 1A0HB 1Y5AT 3FP8E 3B8JA 3VB6A 3K6YA 4SGBE 3KEEA 2TGPZ 3GY5A 1MAYA 4EDJA 1NC6A 2W7SA 3DA9B 2Q6DA 3A7XA 3L6PA 1Z86A 1WAYB 1GI9B 1GG6C 3ATWA 3SI4H 2VWOA 3MHWU 3ZVEA 1UVTH 5TJXA 3LGUA 4LMMA 1SFIA 1O38A 2QF0A 1DUAA 2DKRA 3QGNB 3RC5A 4HFPB 1LCYA 4DY7B 1TMBH 2VIOA 2EEIA 1BTYA 2PKAB 1HAXB 5E22A 1HJAC 2ZCLP 1Z87A 1G9OA 3SQHE 3MU1A 3IITA 1ZHPA 2IPHA 1ELBA 2J92A 4FUBA 1LHFH 2IJOB 1W7GH 1C2EA 2ZKSA 3MOCA 2STBE 5E6PB 1PYTD 3FP7E 1EP6A 1TP5A 1K1LA 1W13U 1WCZA 1O3EA 1D5GA 2QXGA 1PYTC 1NTPA 1GG6B 1S5SA 1DICA 1C5OH 5DG6A 3UOPA 2CXVA 2O8TA 2VVUA 1D3DB 1GDUA 4OS4A 4AB9A 2ZGHA 2R0LA 1DITH 2DE9A 3RDZA 1UCYK 4BTUB 1CU1A 3BG8A 4MPXA 1T4UH 1YGCH 1RGRA 1V2ST 1T8OA 1X6DA 1H9LB 3BF6H 2AGEX 3P95A 3GCTF 3LGTA 1XUFA 4NMTA 2ZU1A 6GCHG 1J9CH 1V5LA 2HE4A 4I8JA 3AXAA 1OP0A 2XTTB 3SV9A 2R3YA 2AMQA 4WXIA 2A2QH 1C5RA 2V35A 3PDVA 1HJ8A 1SOTA 3TLOA 1C2LA 2H3MA 3SBKA 1LDTT 1XUKA 1Y3UA 2ULLA 3MU0A 3SUZA 5A2MH 2BD7A 1Y59T 3RL7A 1KTSB 3SOSA 1A61H 1C9PA 4NMVA 1C9TA 1MTUA 1MU8B 3T29A 2KAWA 1TBZH 4IN1A 5ETXA 2K1QA 5GWZA 2Q9VA 4LZ4B 1YPHC 1BMAA 5EU8A 4ISOA 5K0HA 1ZPZA 1FDPA 2KJDA 1C2HA 3FAOA 2VB0A 1MQ6A 2CSJA 2ZIQH 2F3CE 3VB3A 2AIPA 4WMEA 2FOMB 1SR5C 3RXRA 3S7KB 4GPGA 4OS6A 2P3TB 2ZU5A 3SUGA 1ID5H 4U2WA 1O2YA 4CRCA 1EZXC 1UJVA 2UWPA 1FNIA 2W4FA 3KCGH 4X8VH 1ZMLA 3AVZA 1DWCH 1UVUH 3RLYH 4IBLH 1TGSZ 3R3GB 4Z33A 1M5ZA 1BT7A 2ZHFH 1EAWA 2ZNKH 3RXEA 1C5NH 2ZFSA 4WYUA 1AB9B 1YM0A 3HK6B 4Q2QA 3BEIB 4K1EA 1INCA 4JMYA 4REYA 1ZOMA 5E21A 2ZECA 3I1EA 1YBOA 1QJ6B 3N7OA 5EG4A 1QHRB 1J8AA 3K1RA 2BZAA 2RCZA 1IQEA 1SGDE 5HM9A 1KXBA 1XUHA 5A0AE 4Q2OA 5ESBA 2BYGA 3UWIA 3M3TA 1IQMA 1TGBA 3RC6A 4MPWA 1IOEA 1UEQA 1HBTH 1EJNA 5FXLA 1N6DA 1AE8H 1IHTH 2LUIA 1JIRA 3D65E 4FUEA 4F4OC 1QRXA 3B23B 1PFXC 1TX7A 5HFFA 2CMYA 4ZHMU 2E7KA 2SGEE 4MTBA 2FEQH 4WJG2 3RMLH 1O5CB 3KQBA 1RY4A 2A4RA 4JOJA 4K75A 2J38A 1GI0A 1FONA 3FY5A 1DXPA 1ZJDA 5DP9A 2ASUB 4TY6A 5E2OA 1SGCA 2J34A 1UTKA 1KSNA 3GCTG 2P95A 1BRUP 4Q7XA 4IC6A 3LC5A 3QUMP 2H1UA 2OBOA 2HPPH 1K2I1 2O9QA 3EYDA 2I6SA 1BMNH 2ANMH
chains in the Genus database with same CATH superfamily
1A3BH 2D8WA 1O5BB 3KYFA 3N7EA 1QBOA 4WH8A 1TX8A 1O5AB 2YNAA 3STIA 2YOLA 3E90B 1GDNA 1NRQH 2NU3E 2ENOA 1Y7NA 2KBSA 3MU8A 1PPZA 1NBMD 1MKWH 1SGFA 3TIUA 3QLPH 4FVDA 3MNSA 3QK1A 1KLJH 1U39A 1QJ7B 2OD3B 1TYNA 1Q3XA 2ZFRH 1OP8A 2Y5GA 3BIVH 3T27A 2BY9X 1TRMA 2Z9LA 3QDOA 1NESE 2PGBB 1OKXA 5DP7A 1WQVH 4Y7BA 3ZVGA 1T31A 3ZZCA 1AN1E 2A7HA 5DK1A 3CP7A 2FTMA 5EJ1A 1N7EA 2D8IA 1K28D 1P3CA 3QTVH 3RXHA 1XVOA 3HGNA 1C5YB 2QC2A 2FOAA 2ZTYA 3ZZ5A 4O3TA 3GGEA 3URDA 1P02A 5T1VA 3F0OA 2FOGA 2DLUA 1TMTH 2VWNA 4K8YA 3IWMA 1TBQH 1RFNA 1LVYA 3M36A 1DWEH 4B74A 1U37A 2J98B 4AOQA 2WUCA 4HGCA 5L30H 1H8DH 3A8DA 1X5RA 1JWTA 4TY7A 1LHGH 4U32A 3PM3A 5KEDA 3M3VA 3HKIB 4KKDA 4NZLA 1ZMJA 3BTTE 1IAUA 4Y11E 5EXNA 2V0BA 4NXPA 1O2LA 3KZEA 1FY4A 3UTUH 1TNLA 3W1EA 1Z7KA 5C5OA 2ZTZA 3UWJH 3GSLA 3O46A 5GXPA 2F9VA 4ABDA 7GCHG 3FN8A 4K3JA 4QT8C 1C2MA 2TPIZ 1VR1H 3F2FA 4MVNA 4YTAA 2H3LA 2BD5A 2BY6X 4DT4A 2WHXA 3JZ1B 3A7YA 1L1JA 2IWQA 2UUJB 3Q3YA 1SOZA 2I0LA 5DTHA 2ZC9H 6ESTA 2SGDE 1YP9A 2VWLA 3GCHC 3RU4T 3SFJA 1TOCB 1VCWA 1F0TA 2ZU2A 1O2NA 1E34B 3K65B 4FUCA 1O32A 3EAJA 1ETSH 1C1SA 2KFWA 2QY0B 1C5UA 1P8VC 1FQ3A 3ID2A 1OWKA 1HAYB 5FCKA 1C1PA 1TGTA 1AI8H 1QLCA 1TONA 2PKSB 3U9AH 3MH7A 2VBCA 1JRSA 5I46H 1UEPA 2AMDA 2KM0A 4LOYH 1V6BA 3UQOA 4K6YA 1QBNA 1FXYA 2G5MB 2ZFTA 2BDYA 1ZJKA 1O2UA 1GL1A 1RTLA 2NU2E 2YMSC 3GCHB 4FGMA 2ZPMA 2OCSA 1CBWB 1P1EA 1TQ3A 3SJ9A 2BXUH 5LPFA 3EE0B 4LZ1H 3MWIU 2KJKA 1UTJA 1TA6A 2M5TA 5IL9A 2M0TA 4GVCA 1VGCC 3TK9A 1MZAA 3ZYEA 1AVGH 2W7UA 1P57B 2REYA 1L1NA 1LPKB 1SSXA 2XW9A 2YNBA 2OSGA 3NCLA 2F91A 3NKKA 4K2YA 3STJA 1KEFA 2A0QB 4NIXA 4F55A 3HATH 1CT2E 4X6OA 1TNGA 1P9SA 1GBDA 2CHAC 2YMSB 2EGNA 3VQGA 1FCFA 2DLSA 2H2BA 1IQHA 1E36B 4CRGA 3L4FD 5HFCA 4Q6SA 1BHXF 2GEFA 4MPVA 2V6NA 5F03A 1YBWA 3O5NA 2ZWLH 1Z8JB 1YF4A 3SNCA 1VGCB 1AKSA 4DOQA 3TSWA 1ANDA 2WPMS 2WSSD 3G01A 2HLDD 2R2MB 4K60A 2H5CA 2Z9GA 1KXAA 4MNVA 2KOMA 1GMHF 3KNXA 1Y3WA 4ISIH 1CA8B 2I1NA 3M61U 1RS0A 3FZZA 1C1WH 1KYNA 1TX6A 2GCHF 3LH3A 2CHAB 4CR9A 2AINA 3NFLA 3VQFA 5DP5A 1WHAA 1QAVA 1EPTB 3EA9A 5T6GA 1ELFA 3SJKA 1VKYA 4DCDA 1AFQC 2FLBH 7ESTE 3H7TA 1TGNA 1C1RA 1NS3A 2KOHA 5H4IB 4YM9A 1ESBA 3SUDA 1DOJA 1RTFB 1J16A 1HXEH 3CS7A 4M9FA 1V6DA 2FOHA 3KN2A 3HPMA 4HTCH 3LPRA 5IYTA 4L8NA 2STAE 1CVWH 4MNWA 3LONA 1W2KH 1XZ9A 3VB4A 4TWYA 4UEHH 4AFSA 4I7YH 1TIOA 3SU2A 2JWEA 3I77A 3LJOA 4X1SU 1CHGA 2AHME 2O8WA 1AUJA 1GHXH 3N7DA 5E0HA 1D3TB 1TMUH 1ANEA 2F9BH 1IQIA 1QRWA 2J2UA 1FIZA 2TGTA 1P2OA 1GBMA 1K21H 1N99A 1O2JA 2PKAA 1G3CA 4MNXA 1Y3YA 4B6FA 2FYQA 1TBRH 5J4SA 3DJ3A 2OP9A 2CJIA 2W3KA 3E16B 1EAUA 2ZF0H 1OWIA 3F9FA 3U8OH 3FKSD 2GTBA 3C1KA 4ACAA 1EAXA 2B0FA 1QFKH 1GVKB 1G36A 1RD3B 4JZ1A 3U8TH 1BBRE 3SNBA 1QA7A 1UJUA 3IG6B 2VZ5A 1EOJA 1GJ6A 2WV5A 1OBZA 3SN8A 1P0SH 5C67A 3SJ8A 1X5NA 1AZ8A 1O3AA 1DM4B 1UTLM 1A3EH 4DW2U 3M35A 1MU6B 4UDWH 1KXEA 1MTWA 1L6OA 2D90A 3QWCH 3UUZA 1D4PB 2FLRH 1OWDA 1WI4A 1Q2WA 3A7WA 2A2XH 2JDID 4X6NA 1EAIA 1WJLA 1WDIA 3U69H 1D6RA 2AH4X 1KDQA 3GY4A 1GCTC 4MG3A 2ZHWH 3P6ZB 1DSUA 3MTYA 4NNLA 1AVXA 2HVYB 2OZFA 3PMBB 1RZXA 1NBME 3UOUA 1NZQH 3I29A 2Z9JA 3MFJA 1GBTA 3SHUA 2QN5T 1AMHA 2VIPA 4Y10E 1GHYH 4E06H 1ABJH 8GCHG 2FOBA 3TMHA 1S85A 2KPKA 2P3FH 1DDJA 3KIDU 5DP6A 3ODDA 1MD8A 4YESB 1WYKA 4Q2PA 1KTTB 3K2UA 1GI7B 3TGKE 2WUBA 2FPZA 2BLWA 4ABEA 3S9CA 1GCTB 4ABIA 5HEDA 4I33A 5HKKD 4X2WA 4KP0A 3BSQA 4CBNA 2QYIA 1SGFG 1IHSH 3HVQC 2ZHQH 2JJ1D 4AG2A 2WYJA 2M3MA 2GCHG 4THNH 5F6MA 1UTMA 1OWJA 1O5FH 1CGIE 1MBMA 1EASA 1GHVH 5E0JA 2C8YB 1FN8A 2GDEH 3RLWH 5CHAC 3UNQA 3SOEA 1ZR0A 3S0NA 2OGPA 1K1OA 4MPAA 1BTHH 1C4Y2 3DFJA 1NRSH 3A82A 3QGLA 1GBHA 4ABBA 4GVDA 1AQ7A 3QN7A 1VITF 1BCUH 2KL1A 4M7GA 1HJ9A 4MNYA 1K9OE 2ZPQA 3NPSA 1S81A 4NWKA 1YLDA 1P12E 3BEFB 1L4ZA 1H4WA 5CMXH 4Y8ZA 1DS2E 1CSOE 4Y8XA 1HB0B 2F83A 5C5NA 2BD9A 1PPGE 1HAVB 4Y6DA 1O3HA 1YKTA 1ZGIA 1A5GH 2BHGA 2O8MA 4JK5A 1B5GH 2J5UA 2HALA 3MO9A 5HF1A 1O35A 3ZZBA 1WI2A 2LA8A 3RXVA 1Z71A 4B1TA 2XC0A 1AVWA 1UJ1A 5H3JA 1NFYA 4NMPA 1W11U 4RI0A 5C0UA 4Q80A 2FESH 2FX4A 1YWUA 2WYGA 4NIWA 5E8EH 2CF9H 1HIAA 1V62A 2G2LA 5C1UA 2JOAA 3A8BA 5A0CA 3PV4A 4JCNA 2FWWA 4U30A 1ORFA 2CGAA 2SGAA 4FUGA 4NNMA 1DXWA 3ZZDA 1TNIA 3V13A 3TNTA 2H2ZA 3O8BA 1J17T 2WV4A 2FOCA 4UFGH 2RRMA 1NROH 5T6FA 1BMFD 2ZGJA 3PLBA 2BVXH 2G5NA 1SGRE 2BQ7B 1WFVA 1P09A 1O3KA 2CK3D 4JJ0A 1IQNA 1O3FA 3RXMA 3NCVA 2FMJA 1KLIH 1ARBA 5F3XA 2QIQA 1TNJA 2P94A 2EJYA 1IQLA 1ZLRA 5EQRA 2FS8A 3PMJA 2PUXB 2B9LA 2C3SA 1TALA 1WHDA 3T25A 1QY6A 1EB2A 1P04A 1N6EA 1FZZA 3A80A 1S6LA 1LO6A 1CGJE 3ESTA 4F48B 1XXDA 2UUKB 3F1SB 4AMHA 5F8ZA 3VEQB 2Z94A 2HPQH 3GOVB 4Y8YA 1AUTC 1AFEH 3K50A 1FIWA 3RXDA 3HGPA 5HM2A 4K1SA 1P06A 1V5QA 1MAXA 5T6DA 3HK3B 1TPPA 3RXSA 1O2XA 3OFND 1HFDA 2CN0H 4TSFD 1UK4A 1A2CH 3M5NA 2LP6A 3CYYA 1FY5A 2BX3A 3VFEA 4ZHLU 3RLEA 1DFPA 1JXPA 2FN5A 3GDVA 1SFQB 2YT7A 1HJAB 1GHWH 4O06A 1SL3A 4NA8A 2EI8A 5HFEA 5C20A 1QB6A 4D9QA 1K32A 1O3MA 1ZPBA 4BNRA 4NIYA 1SGTA 1Z1IA 3A81A 3LGIA 4KTSA 2FE5A 4IW4E 2K1ZA 3H5CB 3SU0A 3F68H 2QBWA 5I7ZA 1P2MA 4JYUH 7LPRA 1O2SA 4XHVA 1AWHB 4IS5A 4FUIA 4INLA 1VITG 1HAHH 3TH3H 1ZOKA 2VU8E 3E3TA 4CRFA 2JH0D 1C1OA 4MDSA 2EDPA 3U28C 3FO8D 1TOMH 1Q31A 4AGJA 1UM7A 1YLCA 1W7XH 2AS9A 2XBYA 1TB6H 3A7VA 3VGCC 1H8IH 3ATKA 4YT7H 2ZI2H 2WPJS 1QRZA 1SQAA 3SJIA 3SV6A 4K8BA 1UVSH 3PYHA 2ZDNA 1SI5H 1QB9A 1GBBA 1MC7A 4OAJA 4B76A 2J97A 1PPEE 3ZZ8A 1ZHRA 2HOBA 2SFAA 1WIFA 1JRTA 1C5MD 1LVMA 1UTOA 3A89A 5E0GA 3SORA 3KDKA 4HOPB 1O36A 2C8WB 4RT0A 1O3LA 1CE5A 3ZYDA 2VWMA 4KELA 5JB8S 1TNKA 4FUFA 3RMNH 4GSOA 1CO7E 3ITIA 3SV2H 3TU7H 2FS9A 4I86A 3T5FH 1BOQA 1VB7A 1EZQA 1GBCA 1SKYE 1U3BA 3N99A 5I25A 4R2ZA 1CT4E 3VGCB 4K76A 1OP2A 1SLXB 5FAHA 1GQ5A 1SGIB 2Z9IA 1E1RD 2LC6A 2BB4A 3PRDA 2QT5A 3KQCA 4O97A 1EATA 2JH5D 2FOEA 3F9EA 5FX6A 1C2IA 3I78A 1LTOA 1CT0E 1XUIA 1BDAA 3CENA 4UONA 1C2DA 1WBGB 2ZFFH 4BAKB 1SQTA 5GNDA 2P16A 1UEZA 1UCYH 7GCHF 2I6VA 1GJBB 2OC1A 3FFGA 3RXFA 2OTVA 3VXFH 3A84A 2VWRA 3MNBA 1A5HA 2FODA 3PWCA 5K7RA 1G37A 1GGDC 4FUDA 3BTHE 1DWBH 1MUEB 4ZROA 1K1NA 2PUQH 2ZDKA 3ID3A 5AHGH 1C2GA 1PPHE 2KAIA 1LVOA 3EA8A 1BRCE 4XDEA 1CHOG 3WWBA 4RT1A 5DKMA 4JZIA 2ANYA 2QGRA 4NMSA 2CF8H 2IN2A 1E38B 1DWDH 3V7TA 1H8ED 1V2KT 1MQ5A 1HGTH 2XWAA 1ZHMA 4WY3A 3PLPA 2I04A 1C5QA 2XC4A 3OYPA 2HGAA 1N1LA 2BLVA 4ISHH 1O2IA 3AW1A 4HZHA 3R68A 4XOJA 1ABIH 3RM0H 2BDIA 1GGDB 3T26A 1VCQA 1KXFA 2A45B 4NA7A 1GI8B 5HFBA 3MH4A 1T4VH 3BTEE 2KRGA 2W5EA 4YLQH 1Y3XA 1LPGB 4R0IA 1T2MA 4NWLA 2EDZA 1LHEH 3TITA 4ABGA 1KWAA 4AFQA 2NU4E 3NFKA 2FM2A 1KXCA 2F9UA 3F9GA 2PWXA 3ATIA 2K8IA 1A1RA 1G2MA 2BDBA 2KV8A 3I4WA 1SQRA 4P02A 2JINA 2WPKS 4AYYB 9LPRA 1P10A 3Q3XA 1GI2A 4D7FA 3SNEA 3SYJA 4ZCNA 4BTTB 5EYZA 3CBXA 3LGVA 5J4QA 3QJMA 3DFLA 5EODA 2R4HA 3M3SA 2QF3A 4NMOA 1ELGA 3FVFB 3EQ0H 2XBVA 4INHA 2H9HA 3RXTA 3RXCA 3UFAA 4K5ZA 3PLKA 5LH8A 2EI6A 2ZP0H 1MMJN 4NMQA 1GHAF 1UO6A 1DLEA 2KCOA 2PHBA 3HPTB 1HAPH 1TRYA 2UUFB 4O3UA 1Y8TA 1EP5A 3ZVAA 3GDSA 1GBFA 2ZHEH 2GZ9A 5EZ0A 1HV7A 1GBLA 3HPKA 3GYLB 3NGHA 2Z6BD 2EEHA 1F5LA 2R3UA 4K1TA 1ZSJA 5EXLA 5FCRA 4ZKSU 1C2JA 1O3CA 2O2TA 2QXHA 1D3QB 8KME2 1N7TA 3SJOA 9ESTA 2XRCA 2PTCE 2FXRA 1GI1A 2GMTC 2VJ1A 4TWWA 5EW2H 4D7GA 2ODYB 4NMRA 2EEGA 3AAVA 2OINA 4E7NA 2PKUA 2F43B 2KYLA 2PZDA 1HNEE 1G32B 4OGXA 1AIXH 1FLEE 4B2CA 1C5VA 1PDRA 3AASA 2KG2A 1FI8A 2OPGA 4YO9A 1VZQH 3V0XA 2A1DB 1A5IA 3GY8A 2HVXA 2ZPSA 4BXWA 3F0PA 4D9RA 1P01A 2A4GA 2BD2A 2L6OA 4JORA 1ZGVA 2AFQB 1VJAU 1O3JA 1W0YH 2TRMA 3PO1C 3RMOH 1BRAA 2KX4A 3RXPA 2ZA5A 1MH0A 2LNCA 2KQFA 2OXSA 3ATLA 1IQGA 1DUEA 4JOGA 1WQSA 2ZFQH 4UFFH 3VB5A 1F7ZA 4AG1A 1V2MT 4A6LA 2LOBA 1C2FA 1P2JA 1TA2A 2YMSD 3O8DA 2KOJA 1EXFA 1V2UT 1SGYE 1W0KD 1LPZB 2DM8A 3BTGE 4GLYA 2PDZA 3I18A 2FI4E 3GICB 3LOXA 3UB0A 1V2QT 5DO4H 3ID1A 3RC4A 3LIWA 1GJ8B 1OWHA 3SV8A 4X2XA 3PV5A 3ZVFA 1Q7XA 2EEKA 3PO1B 2QA9E 2PNTA 1JOUB 2H5DA 2L74A 3GY3A 4E7RG 4YOJA 2Z17A 4BXSA 5FL7D 1FN6A 1EKBB 3RMMH 4FU8A 5AF9H 2ZEBA 1QIXB 2Z7FE 3M37A 5FPTA 5HYOA 3VPKA 1TP3A 1AGJA 1LQDB 3E91A 1YPHE 4MPUA 2ESTE 2QG1A 1UTPA 3E17A 1T32A 2PTNA 3ZV8A 1A4WH 2ZZUH 4BAQB 2FTLE 4H42U 2W6ID 3TJOA 8GCHF 4UFEH 2QKVA 1YPKH 4J1YA 3L33A 1C5SA 1GL0E 2XOKD 1O2WA 2M0ZA 1BJUA 3JXTA 5A2PA 2ZGXH 1Z8RA 1F5KU 1QL9A 1GHAG 2VNTA 4RSPA 4JOHA 3OU0A 2O8UA 1DE7H 3ID4A 3DHKH 5EPYA 3SU3A 4NA9H 4ABAA 1FC6A 4JJ3A 4WWYA 1HDTH 1O2VA 4H6TA 5FBIA 4I8GA 1YC0A 1BHXB 1HAZB 4B6EA 3OY6U 3PB1E 3KQDA 1PQAA 1OOKB 3UIRA 3VB7A 3VG8A 2PV9B 5C2ZA 4NXQA 2ZQ1A 4OS7A 2I6QA 4JZEH 1QGFA 4YOIA 3SHCH 2ZG0H 1ZTLA 2JH6D 3DSGA 5L2ZH 2XCFA 1SLWB 1LHDH 2VINA 3P8OA 1F2SE 5SGAE 4PQWA 2RFKC 3R0FA 1C1UH 2QCYA 1SLUB 3AW0A 3QGJA 4CRDA 3AK5A 2VH0A 2BD4A 5HDYA 2TBSA 1MCVA 1QA0A 3U1IB 5A8XA 4HG6A 1QQUA 4Q7YA 1V2TT 3SU1A 2BOHB 1GJ7B 2B7DH 1CA0C 1QURH 5HGGA 4OS2A 4Y0YE 3UNRA 4K69A 1L0ZA 4FU7A 1UHBB 1ZMNA 5C0TA 3GS9A 4A1VA 1OBYA 1Z8GA 3KYGA 4BOHA 2A7JA 2DUCA 5FHTA 3RU4D 1YPEH 1A0JA 2AERH 4IN2A 1WTGH 3TJUA 1S6FA 1KXDA 4DG4A 1AFQB 2EDVA 3ZZ9A 1FX0B 4NSVA 3F2HA 1D3PB 2VH6A 1P1DA 1R6JA 3F3BA 2ODPA 3MO6A 3BPUA 4Y7AA 2DE8A 1ZZZA 3V3MA 4D8NA 1FPHH 3FZDA 3BEUA 2M0VA 4ASHA 4YZUA 4E05H 1IQFA 5C1XA 4NXRA 1S82A 1CA0B 3BTDE 1K1MA 1EOLA 3UREA 4UU5A 3ZZ4A 3UQVA 1H9HE 1D6WA 1O3IA 1BQYA 2FOFA 1JBUH 1OPHB 5JBTA 1GCDA 2LC7A 4KFWA 1WU1A 3K6ZA 5HFDA 2ZQ2A 3PDZA 4ZXYH 1L2EA 3BG4C 5C3NA 3SHAH 2ALPA 1GJ4H 2ZDMA 1UEWA 2OS6A 1O2HA 3F6UH 4X1QU 5HIZA 1LKBA 1FMGA 4XSKU 2NWNA 2Y6TA 3U1JB 1J14A 3RXGA 4DGJA 1GI5A 4OEPA 1IU0A 2GKVE 1OX1A 4CH2B 1DT2A 4X1PU 3OE7D 4XFQA 3NZIA 1VITH 2C93B 2RA3A 4Q2KA 4ZKNU 3V12A 2F9NA 1HLTH 1UJDA 1MTSA 2ODQA 3GY2A 2P3WA 2F4LA 2YT8A 1NU9A 4JYTA 5BRRE 1GBIA 5CE1A 1QB1A 4NFEA 2GZ8A 3PTNA 2WINI 8ESTE 3WKMA 4DT7B 1FY3A 1SVPA 1OS8A 2ANKH 1G2LA 3UR6A 4I31A 2ALVA 2FP7B 3P70B 2WPIS 5E1YA 1I16A 2QKTA 3QE1A 2DAZA 2ZPLA 4DIIH 4TPYA 4HI3A 2MX6A 3D23A 1LKAA 5GCHG 3TK6A 2HWLB 4GHQA 5LPRA 5AFYH 4HOPA 3K9XB 2Z3DA 4PROA 1RJXB 1BTPA 2ZU4A 2VIQA 2BQ6B 1NU7B 2PP6A 2BLOA 2HNTE 1B0FA 2W26A 4X1NU 3S9AA 2QAAA 1V2RT 1MTNC 1QNJA 5HF4A 2AWWA 1YCPK 3ZZAA 1YLNA 3UAIC 1C4V2 3PMHB 5EQQA 1WF8A 3P8FA 1BFEA 2F9OA 3LKWA 5DGJA 1MBQA 1S84A 2R0KA 3A87A 2DMZA 4VGCC 1GVLA 4TT3D 2GCTC 4GCHG 5EXMA 5HJ1A 2EY4C 4WH6A 4AB8A 3OTPA 3GY6A 2ZU3A 3BTQE 1BUIA 5AVDA 2AYWA 2JILA 3LU9B 4J2YB 2QKUA 3OY5U 4I8HA 3LNYA 2BDCA 5BPEA 2RCEA 3URCA 4SGAE 4ZKOU 5CHAB 1GM1A 5EPNA 1NM6A 2H6MA 3BTKE 3QJNA 2KA9A 4NIVA 1EUFA 5DP3A 1SHYA 2AGGX 2VVVA 1ZTKA 5FPYA 3B9FH 2YUYA 1S0RA 1UTNA 2PSYA 2XC5A 1A7SA 2P8OC 1XM1A 1GDQA 2AMPA 2EXGA 2EHRA 1WOFA 3NUMA 4VGCB 1E37B 2GCTB 1RIWC 1SBWA 3WKLA 2OC7A 2VGCC 1XVMA 3GCOA 1C1QA 4LXBH 3TJNA 2Z3CA 2HGTH 4WVPE 4I8KA 3PTBA 1WG6A 1W0JD 1RGQA 2ZCKP 4FETA 4A5TS 3U98H 3SU5A 1GBAA 3A85A 2Y80A 2V90A 1W0ZU 1PJPA 1O3DA 1O2KA 2BX4A 1K1PA 1WXRA 4AYVB 3M5OA 2G4TA 4P0CA 2OLGA 2VSVA 1FY1A 4FUJA 1NFXA 3KGPA 1O5DH 1GMDF 1PQ7A 2P8OB 2ANWA 2DB5A 4JL7A 1WSSH 3LT3A 4BAHB 1UK3A 1F0SA 1ZSKA 4RKJB 3SQEE 1DLKB 1RIWB 1XMNB 4OS1A 2VGCB 4O9VA 5JYIA 1GBKA 4AFUA 5C94A 5DPAA 3Q3KA 1GVZA 1V2OT 5EJZA 2BDAA 3E8LA 4JOFA 2VVCA 1ELVA 1QL7A 4X8TH 4XRNA 1PPFE 1SLVB 1TPOA 2ZDAH 2D26C 3SO3A 2Q6FA 4BTIB 1MFLA 2H2CA 1DY8A 3E0NB 1CHOF 3D62A 3ZRTA 2V3OH 1YCPH 1UITA 3MU4A 1P05A 1VJ9U 3CBZA 1XKAC 5LGOA 1ZRBA 1ETRH 1C1TA 3KDGA 4X6PA 5F53A 3KHFA 1BBRK 5A8ZA 2F9PA 2GVFA 3BIUH 3WY8A 3MQKC 2JETC 4B2AA 5IDKA 2BMGB 2WL7A 1F0RA 5AFZH 1FPCH 2ZTXA 5JXBA 1F5RA 1DSTA 4ZH8A 3SV7A 3T28A 2YUBA 3TH4H 1C5PA 4TPIZ 2BVSH 3AAUA 2L97A 3EGGC 1BTXA 2J98A 2C4FH 2RG3A 1WV7H 1N6YA 3A7ZA 1V2LT 1HPGA 2NU0E 3SNDA 5A8YA 4Z6AH 2JSNA 2Y7XA 4OGYA 5G1EA 1KDQB 2FI5E 3SUFA 4ZAEA 1M9UA 2CV3A 1WF7A 3LH1A 4YDPA 3QZRA 1O2QA 3TSZA 5EW1H 2OQSA 5KECA 1GI4A 4JOPA 1H9IE 1EJMA 2SGFE 2JETB 3VXEH 1RXPA 1TQ7B 4JOEA 1C5LH 3MU5A 5C17A 4ISLA 5T3HA 5EGMA 2JKHA 3BTME 4X1RU 3RXIA 1O3NA 1KLTA 4NG9H 3D49H 5CDFE 4BAOB 2W7RA 1MCTA 4NZQA 3SW2B 3U8RH 4R8TB 3P17H 2BLQA 3RU4E 4X6MA 5F8TA 1BITA 2GV6A 2Z3EA 4NSYA 4ACBA 1ARCA 1AB9C 4UU6A 2VPHA 3BV9B 1AZZA 4B71A 1WH1A 1SGEE 4IGDA 1PPBH 2TGAA 3SGAE 4A1XA 1F0UA 3K82A 5DP4A 1O2RA 2CSSA 1SB1H 1NN6A 2IWNA 2YTWA 1OXGA 4AGKA 2WZQA 1MKWK 1EZSC 1C1VH 1YCPM 3KQ5A 2JIKA 1Z1JA 1GMCF 5GPIB 2X7ZA 1O2TA 2AWUA 1XUGA 5HEBA 2PFEA 2H9EH 4X8UH 1FUJA 1EZUC 1FY8E 1THRH 4FXGH 1W9QA 1S83A 3LDXH 1GQ4A 1GMDG 3ZVBA 2V1WA 3UY9A 4FU9A 1Q3PA 1TAWA 3DORA 1V2PT 4OM9A 3LJJA 4BAMB 1W8BH 3EDXB 1AY6H 3R0HA 3GDUA 1BTWA 3PRBA 1AWFH 3JZ2B 1BBRH 5GDSH 3OTJE 3M5LA 3QTOH 1NF3C 2OUAA 5E11A 4H4FA 1C5XB 1YPLH 3E6PH 1O3GA 2GT8A 2XYAA 1VCPA 1EB1H 4E35A 4U01A 2OC0A 2H9TH 3RXQA 3RXLA 3UNSA 1C1MA 1C2KA 1FC7A 2BVRH 5HXFA 2O8LA 1HAIH 4YYXA 4WMFA 4FOUC 3MMGA 4ESTE 2WPHS 3A7TA 3F9HA 3MNXA 4Q7ZA 3DCLA 1UK2A 1OYQA 4Z1MD 2BDHA 3T2NA 4A7IB 2JXOA 5L6NH 2G51A 4K78A 1P2NA 1YPJH 1HIAB 1X45A 5DP8A 4X2YA 3E0PB 1W9EA 1FAXA 1GJ9B 1NRPH 3P92A 5PTPA 4BANB 4DURA 1PQ5A 3B76A 2GD4B 3TNSA 2F0AA 1PPCE 1MZDA 3TSVA 1HUTH 3R69A 5EQSA 2BY5X 1UVOA 1TFXA 4CRAA 4XBCA 3PV2A 2A32A 1O3OA 4AN7A 5G1DA 1SG8B 1S0QA 1GI3A 2G81E 4Y71A 1KY9A 2ZDLA 1NPMA 1HCGA 3RP2A 2FI3E 4JZDH 4ZMAH 1JMOH 1UMAH 1O39A 4N6XA 1ESAA 2Q1JA 2HLCA 1ELTA 2G5VA 5B6LA 1O0DH 1VAEA 1V1TA 1WTHD 2ZO3H 1RGWA 1T8NA 1V2WT 3NK8A 3UPEA 1Y5UT 2A4QA 1P3EA 1EPTA 3CNRA 1GBJA 2QF5A 4F49A 1P03A 4MQAA 5GIBA 4B73A 2D2DA 2FCFA 5A0BA 4Z0KA 2BYAX 2L4TA 4ZUHA 3SU4A 4E3BA 1L4DA 1MABB 1DVAH 2C8XB 2Z9KA 1GJAB 4Q4LA 5TCCA 1DANH 1V3XA 1C5TA 5B42A 2BQWB 1NO9H 1ZRKA 2TIOA 4XBDA 2B5TB 1Q3OA 3P8NA 2V3HH 1K22H 3QX5H 5HMAA 1V2NT 1RTKA 2D92A 4OS5A 4UD9H 5FBEA 2Q6GA 1UHBA 1UHPA 4AZ2B 1TNHA 3MH6A 2D1JA 3W95A 1ZUBA 1SQOA 3TH2H 3S69A 3TJVA 2EI7A 4DIHH 1YPGH 2R9PA 1FC9A 2A5AA 2RDLA 3ZZ3A 1T8LA 4GVUA 1O3PB 2BZ6H 4MLFB 1ANCA 1Z6EA 1QQ4A 2G00A 2OQ5A 3TVJB 1GMCG 4ZHAA 2GZ7A 3A88A 1QTFA 1QZ8A 1O33A 3TGIE 1XKBC 5JBCS 4D76A 3BTFE 1NTEA 1ELEE 1ACBE 4B2BA 4CREA 3NXPA 3CS0A 4FLNA 4G69A 3O8CA 2L4SA 1E79D 3SNAA 4YLUA 2DJTA 2BOKA 1XXFA 1IHJA 2IPQX 2THFB 3A8CA 2KPLA 1I92A 2HNTC 1FJSA 2J9NA 1W10U 1XX9A 1HAOH 3C27B 1O3BA 1K0HA 2G8TA 1O2PA 5EIYA 1GWAA 3SGBE 3SI3H 4UE7H 1LQEA 1TWXB 1THSH 5FX5A 1IQKA 3RM2H 3RUOA 1XUJA 1ZTJA 3DSPA 3ENSB 3OSYA 2PKSC 2ZCHP 1TQ0B 2J94A 4LK4A 1JIMA 3PROA 2IOTA 3UR9A 2HNTF 4Q2NA 4AFZA 4Q6HA 3MH5A 3DJ1A 2VIVA 4GAWA 1O30A 2BTCE 2FO9A 2XNDD 3E1XB 1HYLA 5TCAA 3RXKA 4XE4A 5IK2D 2RA0A 1O37A 2PA1A 3SZNA 2PKTA 1GJ5H 1OZIA 2A7CA 2GMTB 3MNCA 4GUXA 1NFWA 1MFGA 3KQEA 2PW8H 5D13A 3O8RA 3TGJE 1CBWC 1ZSLA 1VJ6A 1X9ZA 4ASUD 2UUYA 3RXAA 2XBWA 1QAUA 3LNXA 2KR7A 4I32A 1AHTH 3DIWA 3GY7A 1T8MA 2K0QA 2OQUA 1K1JA 2Y5FA 1G9IE 2KZ4A 3FOAA 1C4U2 1EJAA 2BY7X 3KZDA 4ZKRU 1NRNH 1AE5A 2UZCA 4YT6H 2XNIA 3Q77A 3OX7U 1WFGA 3ZVCA 2EGOA 1SGQE 2JREA 2DC2A 3LGWA 1O2OA 5F8XA 2A5KA 4WMDA 1GJCB 3DT0H 4Y76A 2G55A 2EAQA 4KFVA 1GHZA 3ZVDA 3PMAB 3EA7A 1WUNH 1RRKA 1YYY1 2A4OA 4YXWD 1OYTH 1GI6A 1Z8IB 1G30B 2M0UA 4WF8A 2JJ2D 2GDDA 4CH8B 3PS4A 4KGAA 1O31A 4Y0ZE 1NFUA 1O34A 2KAIB 3SGQE 2XBXA 1EX3A 3GYMA 3Q00A 3MO3A 1B7XB 1EQ9A 1B8QA 1GPZA 1Y5BT 1CQQA 4IC5A 1MD7A 1HAVA 3NWUA 4JZFH 4A92A 2HRVA 3S9BA 2VRFA 1ANBA 2PGQB 1EPTC 1W12U 2R2WU 4INKA 1A46H 4O03A 3RXUA 2B8OH 4A1TA 4CHAC 5GCHF 2VSPA 1NRRH 4WXVA 1LHCH 2SGPE 1BB0B 4X8SH 4P2AB 4NFFA 1OSSA 2EA3A 5JDUB 3KF2A 1D9IA 1G3BA 2W3IA 2Y81A 2QV1A 2FDAA 2UWOA 2OBQA 1V2JT 5L2YH 1FAKH 5JBAS 1QJ1B 1THPB 3DUXH 1N6FA 1GJDB 1GHBF 5B6OA 4H6SB 1QBVH 1NT1A 2CS5A 3W94A 4ISNA 3ZV9A 4FVBA 1ELDE 2GT7A 4RN6A 2WPLS 3M7TA 4GCHF 5JBBS 1N6XA 5KGOA 4CHAB 1P9UA 2BDGA 2EGKA 5LPEA 2VIWA 2G4UA 2GZVA 1ELAA 2PLXA 2FZZA 4JK6A 1BTZA 3RXBA 2F5YA 1AO5A 2JIZD 1N8OC 1L1GA 3M7QA 2BD3A 2GX4A 5F67A 2LPRA 1O2ZA 3QIKA 1SGPE 4NGAH 2FX6A 2P59A 3ELAH 4I8LA 4ZXXH 2ZHDA 3S7HB 4Z8JA 3MI4A 4CR5A 1LMWB 2VIDA 5GLJA 1O5GH 1O2GH 1Z6JH 1TABE 3GISB 2QXIA 2Q3GA 1J15A 1HRTH 1LVBA 4GHNA 1P2QA 1F92A 1SPJA 3LC3A 3DD2H 1PQ8A 4IMZA 4UFDH 1E35B 2FIRH 2EEJA 1UCYE 1MKXK 3ATMA 3KL6A 2MHOA 3EGKH 3ODFA 3RL8A 1HAGE 2AIQA 3A8AA 3A86A 3PWBA 1N8OB 4YOGA 1COWD 1A0LA 1O5EH 2ZDVH 1W9OA 6CHAC 4OEOA 1C1NA 1MTVA 4X0WU 4ABJA 2J95A 1UFXA 1BMLA 3EGHC 2PSXA 4FUHA 1IQJA 4KTUA 1H1BA 2FNEA 2BY8X 2QF4A 2XWBI 2OC8A 3BTWE 4AX9H 2ILNA 2A31A 8LPRA 3L3TA 2EV8A 2AWXA 1T7CA 4JYVH 5DN6D 1HXFH 1K1IA 2KJPA 3TPIZ 1P2IA 1YPMH 1P11E 1UVPA 2SGQE 4B75A 3SHWA 3BG4B 5HETA 2ZFPH 1C5WB 3ZZ6A 1QR3E 3M7UA 1W14U 3OAAD 2BXTH 2Y7ZA 5FPSA 2QXJA 3LGYA 2KCPA 3RXJA 6CHAB 3M5MA 1S6HA 2M2AA 2HE2A 4Q3HA 1TE0A 4CRBA 2XCNA 1OWEA 5JPMH 4KTCA 5GJ4B 1BIOA 1SHHB 4K72A 3RXOA 3Q76A 1BZXE 1G3EA 2P3UB 1X5QA 1O2MA 3ZZ7A 1UF1A 1N7FA 2K20A 5A09A 2IWPA 2OCVB 3QZQA 6LPRA 5DJ7A 1SMFE 5HIYA 2P93A 2PR3A 5FB8C 3H7OA 1TPSA 1U6QA 1E1QD 2XXLA 3FANA 1BJVA 4CBOA 1GMHG 1BE9A 1NY22 3SU6A 3CC0A 3DJAA 1BRBE 2GP9B 1BTUA 1BA8B 2KCAA 2IWOA 1BMMH 1H8HD 4H11A 5ESTE 3CBYA 1GHBG 1GBEA 1G3DA 5G4BA 7KMEH 2C90B 2TGDA 2GGVB 2J4IA 1QL8A 1TLDA 1UM1A 1DY9A 3T62A 3HKJB 6GCHF 2ZGBH 2KCYA 3TK5A 1P2KA 4E34A 1W3CA 1QCPA 4DJZB 1DX5M 1CGHA 2SNVA 3MYWA 1X8SA 2Y5HA 4GHTA 1U38A 1C5ZB 3P8GA 4F8KA 1ELCA 4WYTA 1TGCA 4Q63A 1MKXH 1IU2A 2Y82A 3CH8A 5HEYA 4JOKA 1AU8A 1TRNA 1ETTH 4Y79A 5ABWA 1MTNB 1Y3VA 1V2VT 2I0IA 2IJD1 3QDZB 2AGIX 1OBXA 2OMJA 1UTQA 1FV9A 1B0EA 2UWLA 3GJ9A 1AKSB 2FYRA 5E2PA 1E0FD 4DVAU 1TPAE 4ABFA 2ZGCA 2A5IA 2M10A 2GV7A 1SC8U 2G52A 1ZYOA 2EC9H 2I4SA 5EOKA 4RKOB 3KHVA 2C8ZB 1X7AC 2OK5A 3FP6E 1SGNE 1AD8H 1UW7A 2ZPRA 3QO6A 3SUEA 4NCYA 1VA8A 2BM2A 4TYDA 3A83A 5C1YA 1KIGH 1DPOA 1ZPCA 2AEIH 4IMQA 4XBBA 4AORA 2BD8A 1QAVB 1ESTA 4ABHA 3BN9A 2NU1E 4X2VA 2SNWA 5JB9S 3GCNA 1A0HB 1Y5AT 1EFRD 3B8JA 3FP8E 3VB6A 3K6YA 4SGBE 3KEEA 2TGPZ 3GY5A 1MAYA 4EDJA 1NC6A 2W7SA 3DA9B 2Q6DA 3A7XA 3L6PA 1Z86A 1WAYB 1GI9B 1GG6C 3ATWA 3SI4H 2VWOA 3MHWU 3ZVEA 1YY3A 1UVTH 5TJXA 3SZEA 3LGUA 4LMMA 1SFIA 1O38A 2QF0A 1DUAA 2DKRA 3QGNB 3RC5A 4HFPB 1LCYA 1KMHB 4DY7B 1TMBH 2VIOA 2EEIA 1BTYA 2PKAB 1HAXB 5E22A 1HJAC 2ZCLP 1Z87A 1G9OA 3SQHE 3MU1A 3IITA 1ZHPA 2IPHA 1ELBA 2J92A 4FUBA 1LHFH 2IJOB 1W7GH 1C2EA 2ZKSA 3MOCA 2STBE 5E6PB 1PYTD 2WV9A 1EP6A 3FP7E 1TP5A 1K1LA 1W13U 1WCZA 3GABA 1O3EA 1D5GA 2QXGA 1PYTC 1NTPA 1GG6B 1S5SA 1DICA 1C5OH 5DG6A 3UOPA 2CXVA 2O8TA 2VVUA 1D3DB 1GDUA 4OS4A 4AB9A 2ZGHA 2R0LA 1DITH 2DE9A 3RDZA 1UCYK 4BTUB 1CU1A 3BG8A 4MPXA 1T4UH 1YGCH 1RGRA 1V2ST 1T8OA 1X6DA 1H9LB 3BF6H 3WW7A 2AGEX 3P95A 3GCTF 3LGTA 3ZIAD 1XUFA 3OEED 4NMTA 2ZU1A 6GCHG 1J9CH 1V5LA 5EJLA 2HE4A 4I8JA 3AXAA 1OP0A 2XTTB 3SV9A 2R3YA 5CHBA 2AMQA 3NRLA 4WXIA 2A2QH 1C5RA 2V35A 3PDVA 1HJ8A 1SOTA 3TLOA 1C2LA 2H3MA 3SBKA 1LDTT 1XUKA 1Y3UA 2ULLA 3MU0A 1OHHD 4P00A 3SUZA 5A2MH 2BD7A 3OEHD 1Y59T 3RL7A 1KTSB 3SOSA 1A61H 1C9PA 4AC9A 4NMVA 1C9TA 1MTUA 1MU8B 3T29A 2KAWA 1TBZH 3EE7A 4IN1A 5ETXA 2K1QA 2V7QD 2RDEA 5GWZA 2Q9VA 4LZ4B 1YPHC 1BMAA 2LELA 5EU8A 4ISOA 5K0HA 1ZPZA 1FDPA 2KJDA 2V3MA 1C2HA 3FAOA 2VB0A 1MQ6A 2CSJA 2ZIQH 3F2GA 2F3CE 3VB3A 2AIPA 4WMEA 2FOMB 1SR5C 3RXRA 3S7KB 4GPGA 4OS6A 2P3TB 2ZU5A 3SUGA 1ID5H 4U2WA 1O2YA 4CRCA 1EZXC 1UJVA 2UWPA 1FNIA 2W4FA 3KCGH 4X8VH 1ZMLA 3AVZA 1DWCH 1UVUH 3RLYH 4IBLH 1TGSZ 3R3GB 4Z33A 1M5ZA 1BT7A 2ZHFH 1EAWA 2ZNKH 2EQNA 3RXEA 1C5NH 2ZFSA 4WYUA 1AB9B 1YM0A 3HK6B 4Q2QA 3BEIB 4K1EA 2W6JD 1INCA 4JMYA 4REYA 1ZOMA 3DSOA 5E21A 2ZECA 3I1EA 2GJGA 1YBOA 3WWFA 1QJ6B 3N7OA 2WPDD 5EG4A 1QHRB 1J8AA 3K1RA 2BZAA 2RCZA 1IQEA 1SGDE 5HM9A 1KXBA 1XUHA 5A0AE 4Q2OA 5ESBA 2BYGA 3UWIA 3M3TA 1IQMA 1TGBA 5DSFA 3RC6A 4MPWA 1IOEA 1UEQA 4XD7D 1HBTH 1EJNA 5FXLA 1N6DA 1AE8H 1IHTH 2LUIA 1JIRA 3D65E 4FUEA 4F4OC 1QRXA 3B23B 1PFXC 1TX7A 5HFFA 5ILBA 2CMYA 3H09A 2E7KA 2SGEE 4ZHMU 4MTBA 2FEQH 4WJG2 3RMLH 1O5CB 3KQBA 1RY4A 2A4RA 4JOJA 4K75A 2J38A 1GI0A 1FONA 3FY5A 1DXPA 1ZJDA 5DP9A 2ASUB 4TY6A 5E2OA 1SGCA 2J34A 1UTKA 1KSNA 3GCTG 2P95A 1BRUP 4Q7XA 4IC6A 3LC5A 3QUMP 2H1UA 2OBOA 2HPPH 1K2I1 2O9QA 3EYDA 2I6SA 1BMNH 2QE7D 2ANMH
chains in the Genus database with same CATH topology
1A3BH 2D8WA 1O5BB 1QBOA 4WH8A 1TX8A 1O5AB 2YNAA 3STIA 2YOLA 3E90B 1GDNA 1NRQH 2NU3E 2ENOA 1Y7NA 2KBSA 3MU8A 1PPZA 1MKWH 1SGFA 3TIUA 3QLPH 4FVDA 3MNSA 3QK1A 1KLJH 1U39A 1QJ7B 2OD3B 1TYNA 1Q3XA 2ZFRH 1OP8A 2Y5GA 3BIVH 3T27A 2BY9X 1TRMA 2Z9LA 3QDOA 1NESE 2PGBB 1OKXA 5DP7A 1WQVH 4Y7BA 3ZVGA 1T31A 3ZZCA 1AN1E 2A7HA 5DK1A 3CP7A 2FTMA 1N7EA 2D8IA 1K28D 1P3CA 3QTVH 3RXHA 1XVOA 3HGNA 1C5YB 2QC2A 2FOAA 2ZTYA 3ZZ5A 4O3TA 3GGEA 3URDA 1P02A 2FOGA 2DLUA 1TMTH 2VWNA 4K8YA 3IWMA 1TBQH 1RFNA 1LVYA 3M36A 1DWEH 4B74A 1U37A 4AOQA 2WUCA 4HGCA 5L30H 1H8DH 3A8DA 1X5RA 1JWTA 4TY7A 1LHGH 4U32A 3PM3A 3M3VA 3HKIB 4KKDA 4NZLA 1ZMJA 3BTTE 1IAUA 4Y11E 5EXNA 2V0BA 4NXPA 1O2LA 3KZEA 1FY4A 3UTUH 1TNLA 1Z7KA 5C5OA 2ZTZA 3UWJH 3GSLA 3O46A 5GXPA 2F9VA 4ABDA 7GCHG 4K3JA 4QT8C 1C2MA 2TPIZ 1VR1H 4MVNA 4YTAA 2H3LA 2BD5A 2BY6X 3JZ1B 3A7YA 1L1JA 2IWQA 2UUJB 3Q3YA 1SOZA 2I0LA 5DTHA 2ZC9H 6ESTA 2SGDE 1YP9A 2VWLA 3GCHC 3RU4T 3SFJA 1TOCB 1VCWA 1F0TA 2ZU2A 1O2NA 1E34B 3K65B 4FUCA 1O32A 3EAJA 1ETSH 1C1SA 2QY0B 1C5UA 1P8VC 1FQ3A 3ID2A 1OWKA 1HAYB 5FCKA 1C1PA 1TGTA 1AI8H 1QLCA 1TONA 2PKSB 3U9AH 3MH7A 1JRSA 5I46H 1UEPA 2AMDA 4LOYH 1V6BA 3UQOA 4K6YA 1QBNA 1FXYA 2G5MB 2ZFTA 2BDYA 1ZJKA 1O2UA 1GL1A 1RTLA 2NU2E 3GCHB 4FGMA 2ZPMA 2OCSA 1CBWB 1P1EA 1TQ3A 3SJ9A 2BXUH 5LPFA 3EE0B 4LZ1H 3MWIU 2KJKA 1UTJA 1TA6A 2M5TA 5IL9A 2M0TA 4GVCA 1VGCC 3TK9A 1MZAA 3ZYEA 1AVGH 2W7UA 1P57B 2REYA 1L1NA 1LPKB 1SSXA 2XW9A 2YNBA 2OSGA 3NCLA 2F91A 3NKKA 4K2YA 3STJA 1KEFA 2A0QB 4NIXA 3HATH 1CT2E 4X6OA 1TNGA 1P9SA 1GBDA 2CHAC 2EGNA 3VQGA 1FCFA 2DLSA 2H2BA 1IQHA 1E36B 4CRGA 3L4FD 5HFCA 4Q6SA 1BHXF 2GEFA 4MPVA 2V6NA 5F03A 1YBWA 3O5NA 2ZWLH 1Z8JB 1YF4A 3SNCA 1VGCB 1AKSA 4DOQA 3TSWA 1ANDA 2WPMS 3G01A 2R2MB 4K60A 2H5CA 2Z9GA 1KXAA 4MNVA 2KOMA 1GMHF 3KNXA 1Y3WA 4ISIH 1CA8B 2I1NA 3M61U 1RS0A 3FZZA 1C1WH 1KYNA 1TX6A 2GCHF 3LH3A 2CHAB 4CR9A 2AINA 3NFLA 3VQFA 5DP5A 1WHAA 1QAVA 1EPTB 3EA9A 5T6GA 1ELFA 3SJKA 4DCDA 1AFQC 2FLBH 7ESTE 3H7TA 1TGNA 1C1RA 1NS3A 2KOHA 5H4IB 4YM9A 1ESBA 3SUDA 1DOJA 1RTFB 1J16A 1HXEH 3CS7A 1V6DA 2FOHA 3KN2A 3HPMA 4HTCH 3LPRA 5IYTA 4L8NA 2STAE 1CVWH 4MNWA 3LONA 1W2KH 1XZ9A