3GCNA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with omp peptide (yqf)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
300
Chain Sequence
b'DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Mechanisms of allosteric activation of the DegS protease by OMP-peptide binding and protein-substrate binding
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 300
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcnA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcnA01
3SN8A 4ZKRU 1TQ0B 1ZR0A 2VSVA 5FPSA 1AB9B 4TPIZ 2QGRA 1DY8A 1YYY1 3RXTA 1D5GA 2GX4A 5AHGH 3ID1A 2ZHFH 1C5ZB 1O37A 3VB7A 1N99A 1N6DA 1YGCH 4HZHA 3DIWA 4NMSA 5EPNA 1V2MT 3GY8A 1NU9A 2M10A 5DP4A 3M37A 1KY9A 2XCNA 5GDSH 1AVWA 1PQ5A 4CRBA 3RLEA 3KQDA 1MCVA 1YCPH 3K2UA 3ATWA 4YO9A 7GCHF 2PNTA 1GBHA 1O3BA 1XUGA 1Y3VA 1TP5A 3SJOA 2KOMA 1JMOH 5CHAB 1NTEA 1OWIA 4YTAA 1JOUB 1SC8U 3QN7A 3DJ3A 5GIBA 3I4WA 1Z86A 1ELFA 1THRH 1AFEH 1WFGA 1G37A 1EP5A 5FAHA 4DIIH 3BTME 4BNRA 2ZGXH 2VVCA 1AN1E 1KXAA 3QDOA 1MKWK 1TONA 3DJ1A 3LGVA 3M3VA 1X6DA 2CN0H 1A3BH 1FLEE 1GJ9B 1N6XA 1SMFE 2ZU4A 1FDPA 1D4PB 2GCTB 2XWAA 1QQ4A 2PGBB 2PKSB 1C5YB 2FO9A 2VH6A 1Q3PA 1GI1A 1MZAA 3U8TH 1E37B 4DW2U 1ZTLA 1BTXA 1T8LA 4YYXA 2BQ6B 2F83A 2H6MA 1XKBC 1O2WA 2EI7A 1ELDE 2GP9B 1IQIA 1B0EA 3SNAA 1C9PA 3LIWA 1EPTA 4JOJA 1XM1A 1CT4E 1FY1A 5K0HA 3DORA 4OS7A 1GBAA 1GL0E 4YDPA 3PLKA 4CR5A 6CHAC 2ANWA 3TNTA 4XE4A 1DY9A 4QT8C 3A85A 1EB2A 1GJCB 1ZMLA 1BOQA 1KYNA 3ODDA 3QK1A 1DXWA 1P03A 3QGLA 5H4IB 1Z71A 5FHTA 2QXHA 3FZDA 1EAWA 1UHBB 1W11U 3SU3A 1KLTA 4X8VH 2AINA 2FOBA 2WUBA 4SGAE 2V6NA 4YLUA 4AG2A 4ZXYH 5HJ1A 1NT1A 3I78A 1OBZA 2IOTA 2ZU1A 2JILA 2ODYB 2QA9E 1MTNB 4NMRA 4K2YA 1TAWA 1FC6A 1UJVA 1NC6A 1EZSC 2TGTA 4I7YH 1UVSH 3TGKE 1OBXA 3ZVDA 3M61U 4X1SU 1S0QA 1CGJE 1Y5BT 5T3HA 1BT7A 3DJAA 1BRAA 3EA8A 3S7HB 4NWKA 3TITA 2VGCB 3RXRA 4INHA 2EI8A 4NZLA 4ZH8A 1O2SA 1K1JA 4WVPE 1K2I1 1S0RA 3ZZBA 4L8NA 1UJ1A 1RJXB 1VB7A 1UJUA 1CSOE 2A7CA 1GVLA 1P2MA 1F7ZA 3PV4A 4FUJA 3ZVEA 1O5FH 1VJ9U 2VIQA 3BN9A 2DJTA 1SQAA 1N7TA 1JWTA 1EJNA 1UTPA 1UO6A 2KL1A 2Y6TA 1EAUA 1O2QA 2XBVA 6ESTA 1SQOA 1GVKB 3RDZA 3OSYA 2HE4A 4I33A 1YPJH 2FEQH 1GI4A 4AYYB 2DLSA 2F3CE 1HIAA 1T4VH 3QJMA 1C2MA 1QB9A 2ZDLA 2JREA 1CT0E 2I4SA 3QE1A 1N6EA 4K72A 2VIVA 3DFJA 2IJOB 1GCDA 5GJ4B 1N6FA 1HXEH 2FZZA 2PR3A 3ITIA 3KZEA 2ASUB 1GMDF 3LH3A 4SGBE 3LGTA 3U1JB 2VINA 1QFKH 1O39A 3UNSA 3U8RH 2D8IA 1K1PA 1UCYH 4Y6DA 2BVXH 4UU5A 4WWYA 3A88A 3A81A 3PS4A 1PPZA 1TB6H 2XCFA 3URCA 1YCPK 1QBOA 3EGKH 3B8JA 3T5FH 4WXIA 4K60A 3AW1A 2OUAA 1DWBH 2Z9GA 5ETXA 3U1IB 1SGPE 1MC7A 4YZUA 1EZUC 2BVRH 3GOVB 1ACBE 1SFIA 2G8TA 9LPRA 2PGQB 2ZU5A 1G9OA 1SLUB 1Y3UA 1O3KA 2QYIA 1G2LA 1WOFA 1W9QA 1UTQA 3ZVAA 5DP5A 1LHFH 3TJUA 2EDPA 3V3MA 4PQWA 1KXCA 1P10A 2H2ZA 5GPIB 4GSOA 1BE9A 3BF6H 4FUBA 3LOXA 1V2LT 3KF2A 4CRDA 1TALA 5HFFA 5A2PA 4ABJA 4NMTA 1G3DA 2BY8X 4U2WA 3NFLA 4K1EA 1C1WH 3TK5A 1C2EA 1V2WT 3EQ0H 3QJNA 1D3TB 5GWZA 3PDZA 3TSVA 5GNDA 1AD8H 2GT7A 3LGWA 4AORA 2VWMA 1WJLA 4U01A 3PMAB 4MQAA 4ABBA 9ESTA 4B1TA 3ATMA 1PPFE 1TOCB 3TPIZ 2KAWA 4DY7B 2OBOA 3IITA 4XSKU 1EOJA 1NRQH 3SHCH 3TSWA 1FN6A 3FP6E 4JK6A 4NIVA 1P8VC 1CT2E 1OXGA 2V90A 1C5NH 2TIOA 4WH6A 4UU6A 2A2QH 5FX5A 4GCHG 2P3WA 2BDAA 1UF1A 2LC6A 4TWYA 3VXEH 1HJAB 1BMAA 2BTCE 2VRFA 1GG6B 4KFVA 3DA9B 1TRNA 2ZFRH 2JH6D 1DLEA 2GKVE 1Z8GA 2Y82A 5EGMA 3HK3B 3R3GB 2OZFA 5DP8A 1UTLM 1KXDA 1N1LA 1KDQA 2KYLA 3EGHC 5HETA 2G5NA 1MFGA 1BBRE 1O5DH 3GICB 4IMQA 1O2IA 5G4BA 4ZAEA 1WQSA 7ESTE 1RFNA 1VAEA 4O9VA 1EASA 3SOSA 1NRRH 3SV8A 3SUEA 5G1EA 4NMPA 2ZDKA 4AFQA 5HM9A 2H3MA 2BLOA 4Q7ZA 3MU0A 4X0WU 1O2VA 5SGAE 2BY5X 2DKRA 2ZPMA 2EEHA 1P2JA 3UIRA 4F49A 5C2ZA 5IDKA 5EQQA 2FOMB 4Y79A 4BAHB 5TCAA 1NZQH 2A4RA 1TE0A 1YPGH 1EP6A 2R2WU 5A8XA 3I77A 4ABDA 1Q3XA 1SGYE 2UUJB 1T8OA 5G1DA 1Y7NA 3BTGE 3P17H 4ZUHA 2I6SA 4MVNA 3LC3A 1FY3A 3MOCA 4Q2OA 2ULLA 5F67A 4X8TH 3SHAH 2NU1E 1EQ9A 4D9RA 1TNKA 1QQUA 2BX4A 1VCWA 1NPMA 1VGCC 1X5NA 1ARBA 1ESBA 2CF9H 2DUCA 2Q6FA 2O8TA 4ISHH 5HFDA 2P3UB 2TRMA 1RS0A 1WUNH 4DURA 2A1DB 2QKUA 2OQSA 1FIZA 4ABHA 1FI8A 7LPRA 1UCYK 2DLUA 5C5NA 5F8XA 3CYYA 1KLJH 4VGCC 3SJ9A 3STIA 3TJNA 1NFXA 1NTPA 5HEYA 3EGGC 2V3HH 3BG8A 1ZGVA 3GY5A 3UOUA 1Z87A 1SFQB 2WPIS 1TGNA 4FUCA 5HGGA 2QT5A 4A1TA 3KIDU 2VIWA 3VXFH 5E22A 2OCVB 1AVGH 3RXEA 4BXWA 1UTMA 2SGFE 2TGPZ 4I8LA 2HNTE 4X2VA 1LVMA 2GCHG 2JWEA 1QB6A 1ZMNA 1F5LA 2VH0A 3UNRA 4Y8XA 1FAKH 2QF3A 4FGMA 4UFEH 1IHTH 3A8DA 1CGHA 3LU9B 2Z7FE 4MNYA 1GHYH 3A7YA 2LPRA 1NO9H 2JETC 2BDIA 3T27A 1L4ZA 2QBWA 1FQ3A 3KQEA 1VCPA 4Y10E 5LPRA 2VZ5A 2A7HA 1SGQE 1MCTA 2ODPA 2D1JA 1O5AB 1VITH 3BTHE 1GI2A 4REYA 1O32A 3DFLA 2H1UA 4CREA 2Y7XA 1UVTH 3EAJA 2OC1A 4ZHAA 3RM0H 2GMTB 1C9TA 2FYRA 2AWUA 3L4FD 5HEBA 1ZJKA 4GPGA 1LHDH 2GV7A 2BYGA 1N8OC 1L1NA 5JXBA 1MTVA 4BANB 5C1UA 3AASA 1AY6H 1WTHD 2I0IA 1K22H 2Y7ZA 1IQNA 1GI5A 4NZQA 1SGNE 3MU4A 1OYTH 4JYVH 2B8OH 1NESE 4H11A 3FZZA 3LT3A 1K9OE 2ZHWH 1GI8B 4Q2KA 3TSZA 3ZZ4A 1A0LA 1HAGE 1BBRK 1WHDA 2W5EA 3GY2A 2Y80A 5HYOA 4HTCH 2JH0D 4H4FA 3O5NA 2RA0A 7GCHG 3FP7E 3SQEE 2GZ7A 4K3JA 5FBIA 4NMOA 2EI6A 1FONA 5C3NA 2A4QA 1UHBA 3NK8A 3S7KB 2ZECA 4I32A 1BTWA 1MKWH 1GBFA 2ZFQH 4PROA 2ALVA 1ELCA 4XOJA 3QIKA 4X2WA 1NFUA 2ZPSA 3M5MA 4B2AA 1O5CB 4NXPA 1QRZA 4D7GA 3P8OA 1GDNA 2ZA5A 2OGPA 2UWOA 2I6QA 2CXVA 3ZYEA 1LVBA 2AFQB 2CF8H 1I16A 4INKA 3D65E 3EYDA 3BTEE 2BDGA 3EA7A 2EC9H 3LGIA 3D49H 1C5RA 1F0RA 1GMCF 3NXPA 5E2PA 6CHAB 2ZO3H 4OS1A 5EG4A 1QA7A 4UDWH 3RXAA 1MAYA 4XBDA 1E35B 3OTJE 1VCQA 1GJBB 5AVDA 3CC0A 1OX1A 1G3CA 1W3CA 2ZGBH 2J94A 3QTOH 2VNTA 3AXAA 1QBNA 4NNLA 2BDHA 2DE9A 1UITA 1ELEE 1SL3A 1LPKB 1XUHA 4NA9H 2FOCA 4NNMA 3K1RA 1P04A 1JBUH 2QXIA 2SGPE 3OU0A 3TLOA 5LPFA 5A0CA 1GHZA 4NGAH 5FCRA 1TBQH 4UD9H 1PYTC 5EXNA 1G30B 3MH7A 3MYWA 1A0HB 1C1VH 1O31A 1FAXA 4R8TB 1O30A 1GHAF 1UM7A 3R0FA 1C1RA 3PB1E 5A09A 2W7RA 2SGDE 1SOTA 2IWPA 3KHFA 2ZDAH 3M5LA 1JRTA 4YOIA 2H2CA 2E7KA 4AG1A 1LKBA 1HLTH 1V2NT 4XBCA 1UVOA 1TBZH 1MD7A 2PTCE 2VVVA 1ELTA 1BB0B 2WV4A 1INCA 2ZG0H 2WYJA 4B71A 3FP8E 1VITF 2A32A 3SHUA 3U98H 4ZKSU 2ZCLP 3PTNA 1UK4A 1LMWB 3M7TA 1J17T 4JOFA 2PKUA 1AZZA 3PV5A 1GJAB 1WV7H 3PTBA 2SGEE 1FMGA 2R0KA 3TK9A 5C1XA 1UVUH 1EUFA 3SJIA 2EEIA 1P01A 5A2MH 1RGRA 1BDAA 1FCFA 3RXDA 2JIKA 2H5DA 2W3IA 5JPMH 1DUAA 2WV5A 5JB8S 4TY7A 1SLXB 1AI8H 1SLWB 3L6PA 1AZ8A 3FAOA 3LC5A 4KTSA 4RSPA 4YESB 3BSQA 1KXBA 2ZPRA 1UHPA 1KTTB 1TPOA 4GUXA 5JBBS 5HF4A 1C5LH 1D3DB 1W13U 3ZZ3A 1HAXB 2YUYA 2H2BA 3QX5H 1C4V2 1V2JT 1PQ7A 1UMAH 1PDRA 2A7JA 2KOHA 4WXVA 1O2RA 2QKTA 1B8QA 4XHVA 1GBMA 1O3GA 1W7XH 1S6HA 2EEKA 4TPYA 4OS2A 2P8OC 3VFEA 3SHWA 1X8SA 1T4UH 4CR9A 4OAJA 2ZC9H 1ARCA 4HFPB 1O3EA 1TNGA 1UEZA 1SGFA 2ALPA 3A7WA 2O8LA 4A1VA 4GVCA 1E34B 4X6NA 1HJ9A 5C20A 1BIOA 1PPEE 1ZSLA 3I18A 1EZQA 2ZKSA 2YOLA 1GWAA 1OWJA 3LJOA 2BOKA 3SGBE 2Q6GA 4YLQH 3TNSA 3MO6A 4Y7AA 1UJDA 2ZDMA 2XNIA 3UPEA 1EZXC 3GDSA 1EAXA 1SGCA 1P57B 3SBKA 4AX9H 1K1OA 3ZZ8A 1C2LA 4OS6A 4JOEA 1E0FD 2HE2A 1MU6B 1TGTA 1DDJA 3SI3H 1DUEA 1QRWA 1C1TA 5EXMA 3BTQE 2FOHA 1OWEA 2MHOA 3GCOA 1GGDC 2KJPA 3A8BA 1C1QA 1IQLA 2TGAA 3F9FA 3KNXA 1A5IA 3PM3A 2F91A 1AIXH 1HPGA 4JYUH 1RXPA 1P06A 3SW2B 1QAUA 1O2TA 4Q7XA 4YOGA 3K6ZA 2ZHDA 2ZTXA 2QXJA 2RCEA 2ZCHP 2R0LA 2FS9A 3ZVGA 4NG9H 1WSSH 3K6YA 2OC0A 2GZ9A 1QAVB 3CH8A 1TQ3A 3E3TA 2W7SA 1HAHH 1TNIA 2G4TA 4CHAC 2PUQH 1ZSKA 3PV2A 4X2XA 1WYKA 1OWHA 1Z8RA 1N7FA 2BY7X 1YKTA 5DJ7A 1H8IH 2FI3E 1C5TA 1C5VA 3UR6A 1K1LA 4JYTA 3NFKA 1AQ7A 2BDYA 2Z9IA 1EJAA 4TYDA 2FTMA 3SGAE 3SUDA 1Y8TA 1QURH 2FXRA 1SLVB 1C2HA 1GHBF 5F8TA 1S6FA 1P3CA 1BUIA 5DKMA 5JB9S 1B7XB 1BMMH 1CBWC 2PHBA 4CBNA 1TPAE 4B73A 3ZYDA 3MTYA 5DP9A 1P9UA 1MUEB 2ANMH 3ZV9A 2YTWA 3VGCC 1CGIE 1GL1A 2A31A 4RKOB 4Q2NA 2AYWA 4Q3HA 3MU8A 1ANEA 1P0SH 3OX7U 5BPEA 2OQUA 1AFQC 2Q9VA 2SNWA 4Y0YE 2P3FH 3HKIB 1KWAA 2FLBH 5FBEA 3TGIE 3SU6A 3ZVFA 1FY4A 1FV9A 1Q2WA 2QY0B 2ZU2A 2ZTYA 1GHVH 1W8BH 3MH4A 2YT7A 1O2YA 3MH5A 5E8EH 1HV7A 1FIWA 5DTHA 1HYLA 1ELGA 2R3YA 1GMHF 2G2LA 1GDUA 1DWDH 2OS6A 4MPAA 2QC2A 4MNXA 1GPZA 3WKMA 1V1TA 3BTTE 2Z3CA 2VVUA 2I04A 4X8SH 1U39A 1P2KA 3SOEA 3M5NA 4CRGA 1MZDA 2AWXA 4UE7H 3LJJA 4YOJA 2ZDNA 2OPGA 3PMBB 3RXCA 1VGCB 5K7RA 1SGIB 2ZCKP 2R3UA 1ANDA 2F9UA 2AMPA 3ZV8A 4D8NA 1C5SA 3E0NB 3BIVH 5TJXA 1P2NA 1XVOA 1V2TT 1RGQA 2LOBA 1SGTA 4R2ZA 1UTKA 1SHHB 2ZU3A 1DFPA 1QA0A 4VGCB 3T26A 4KTCA 3UUZA 1A46H 1ZYOA 4JZDH 2Z3EA 2NU2E 5L6NH 4CBOA 4O97A 2VWRA 5A0BA 1IQFA 3QZRA 3A89A 1PPGE 4NSYA 3KZDA 1UTNA 2PZDA 2BY6X 4DOQA 1OWKA 3RU4T 3TJVA 2KQFA 1OSSA 4JMYA 1P2IA 2G81E 1P3EA 2Z9JA 2QIQA 3MH6A 2MX6A 3K65B 1BHXB 2O8UA 1X5RA 2KAIB 1SOZA 1WTGH 4IW4E 3A8CA 3UQVA 2OXSA 1XMNB 4JOGA 2JETB 1O3FA 2Z3DA 3KN2A 4Y0ZE 2ZI2H 4NMVA 3FANA 1JRSA 5L2YH 5EODA 3E6PH 1W9OA 1X7AC 1GBKA 1H1BA 4BTUB 3ID3A 2G5MB 1SGFG 1EJMA 5FX6A 1PYTD 2M3MA 2DMZA 1M5ZA 1GBJA 4IN1A 2AIQA 1WHAA 2DB5A 4IC6A 4NMQA 3HPKA 4DCDA 4Z8JA 1N8OB 2EDZA 5TCCA 1GM1A 2FX6A 1HXFH 1XUKA 3KQCA 3QWCH 1IQMA 1ZGIA 2IWOA 2BXTH 2ZHEH 4EDJA 1L4DA 3A84A 3GCNA 3GCTF 5AFZH 5AF9H 1YPHE 1WAYB 1AE8H 4ASHA 4MPXA 1RGWA 4P0CA 2QV1A 2B9LA 1C2KA 2HGTH 3B76A 4Y8YA 1AO5A 1GQ5A 1RRKA 4AYVB 2R2MB 1GBCA 1HAVB 4J2YB 1BBRH 3BTWE 3D62A 2CS5A 4JOKA 3PWCA 4FU7A 4ZHMU 1FNIA 3CENA 3ZRTA 1KLIH 1C2IA 5LH8A 2O9QA 3Q3XA 2I0LA 4OS5A 3U8OH 1C5OH 1A7SA 3RXPA 2STAE 5E1YA 4E35A 1O35A 4ABGA 2ZDVH 3F9HA 4Y76A 1OZIA 1C5PA 1C5XB 1YLCA 2PKAB 3SV2H 3RXUA 1ZRKA 2FYQA 1Z1IA 4WMEA 1UFXA 2OBQA 1QL9A 2BXUH 4K5ZA 1HAYB 1MKXH 4IMZA 1IQEA 1NRPH 5HFEA 1CO7E 4AGJA 3A7XA 2W7UA 4B76A 1QJ7B 2TBSA 3VB4A 1ANBA 1OKXA 5EQSA 1ELBA 3S0NA 4JOHA 4JZEH 4KELA 1O3HA 2G00A 1QIXB 3PO1C 1DLKB 2H9TH 3ZZ6A 4DT7B 4FUIA 4AB9A 1OOKB 1WH1A 5DGJA 5AFYH 2C8WB 2OLGA 2AMQA 4THNH 1XXFA 1RY4A 2GGVB 2OCSA 3SUZA 2QG1A 1EX3A 1W14U 1QL8A 1EXFA 1LVYA 5FB8C 3A80A 4Y11E 1UK3A 4XFQA 3VB6A 1VZQH 5GCHF 4K8BA 3UNQA 5E2OA 2FCFA 3E16B 1CA8B 2HOBA 4OEPA 3UREA 2BX3A 1BRCE 2KBSA 4E3BA 1TBRH 3TH2H 1W9EA 1K1MA 1TX8A 2QAAA 1K21H 1KXEA 4YM9A 1F5RA 1TABE 3P8NA 4AFZA 2VSPA 1FC7A 1F2SE 3GDUA 2Y5GA 2P93A 3HPMA 3JZ1B 1A1RA 1NU7B 1WF7A 2XXLA 3MO9A 1XUIA 3H7OA 1J9CH 2FX4A 5HMAA 4LZ4B 1TA6A 1BHXF 1GBDA 1J8AA 1LKAA 1GHAG 3ODFA 4OGYA 4FUFA 1Z7KA 3S69A 2KRGA 1F5KU 4IBLH 5EXLA 3C27B 2EEJA 4BTIB 2BDBA 8LPRA 4ZXXH 2DM8A 1V2QT 1J14A 2EGKA 2PSYA 3EE0B 3EDXB 5FPTA 1B0FA 2C4FH 2STBE 2O8MA 2FOAA 1P02A 3RXVA 1IAUA 3RXLA 1Y3XA 1O34A 2V0BA 1SPJA 3RXBA 1V2RT 1C1SA 2LNCA 4KGAA 2HPPH 5C5OA 1VITG 1OP2A 2AMDA 2Y81A 3S9CA 2NU4E 2OSGA 2VWOA 1DVAH 5F3XA 1O2JA 1YBWA 4BAKB 4KKDA 3E17A 2G52A 1SGDE 4A7IB 2GZ8A 3EA9A 5C67A 2PDZA 3M3TA 3TH4H 1SG8B 3BG4C 3RM2H 5EW2H 1KIGH 4MNWA 2ENOA 4Q7YA 2JINA 1YPHC 2VWNA 3RMMH 4CH8B 1HAOH 4NIWA 3BTDE 1QLCA 1S84A 4JZFH 1SQTA 2UUYA 2W26A 1P11E 3E90B 4I8KA 4P2AB 2NWNA 2AERH 3MNCA 1TMUH 2P8OB 1F0SA 1HRTH 3ATIA 1TP3A 1OS8A 1HNEE 1S81A 2QKVA 2BHGA 5T6GA 4NA7A 2F9BH 3A7ZA 3QO6A 4FU8A 3A83A 2H5CA 4J1YA 4X8UH 2UUKB 2YNAA 1T7CA 1ZOMA 3QLPH 2BLWA 4WJG2 1U37A 4BAMB 3VB5A 1QAVA 3RXOA 4GLYA 2WPHS 1A3EH 2OQ5A 1QTFA 1FY8E 4IC5A 4MG3A 3M35A 2FOEA 2H3LA 5DP3A 5E6PB 3SU1A 3RMLH 1IU2A 4Q6SA 1THSH 3RP2A 1TWXB 1GGDB 4UONA 3SNEA 3SFJA 4I8GA 1C2DA 5F6MA 1O2UA 2CJIA 1DANH 1T32A 1IQHA 2AIPA 3A7TA 2VPHA 2X7ZA 1XUJA 1A61H 4JOPA 4BOHA 2P16A 2BLQA 4AFSA 1ZHRA 1GBIA 1LVOA 1O2MA 2I1NA 2FESH 1C5MD 4IGDA 1B5GH 3OY6U 1MKXK 3A86A 2L97A 3DT0H 3F6UH 3CS7A 2FOGA 1QRXA 1C1UH 3VB3A 1RTFB 5L30H 3QTVH 3GCHC 3M7UA 3IG6B 3IWMA 4E7NA 1L1GA 4G69A 1O2HA 2C8ZB 1IOEA 1NM6A 1ZHPA 2HWLB 2FS8A 1SHYA 1C5WB 1GCTC 5T6FA 4CHAB 2WYGA 3F68H 1ZRBA 4ISOA 2RDLA 1GI0A 2XWBI 4K69A 3E8LA 3BTFE 2EXGA 1CVWH 5C1YA 1O3MA 3WKLA 4GHTA 1TX6A 2C8YB 3QUMP 3SUGA 3W95A 1NROH 1GJ6A 2HNTF 1IHSH 1TOMH 4O03A 3SV6A 3P92A 5DPAA 3M5OA 3ZZ7A 3AAUA 3AVZA 5I46H 2M0VA 1H9LB 1VA8A 1CBWB 1HFDA 1GQ4A 1QJ6B 1PPBH 2ILNA 1J16A 2ZQ1A 4D9QA 3AW0A 3SNCA 5HXFA 2ZEBA 1EPTC 2OC7A 1R6JA 3MFJA 1WU1A 5D13A 1WIFA 3ESTA 5A8YA 3VGCB 4JZ1A 2SGAA 2AGEX 3LGYA 1LHEH 4DJZB 2YUBA 1GHBG 2G5VA 2SNVA 1YBOA 1AFQB 3PDVA 1D6RA 4U32A 2EHRA 4AB8A 1SSXA 4AGKA 2A5IA 2BD4A 1V5QA 1RIWC 2BD2A 4E05H 4CRFA 1MMJN 5HFCA 1XVMA 1DE7H 4DG4A 2VB0A 1QJ1B 3KHVA 1U6QA 1E38B 1O2GH 1CE5A 1H9IE 1WCZA 1QGFA 1SR5C 2ZFTA 1DWEH 1ZHMA 4K78A 1PJPA 2ZWLH 1D6WA 1O36A 2PSXA 2VIDA 2G4UA 1CA0C 4XBBA 1G2MA 3RL7A 2UWPA 1S85A 2KAIA 1HJ8A 1DT2A 1ZPCA 1GBBA 2IPHA 2OTVA 2BOHB 1X5QA 1GMHG 1FY5A 1Y3WA 1DS2E 2HGAA 3K9XB 2BZ6H 4DVAU 4KTUA 3NPSA 1DSUA 5EYZA 2XTTB 1ZMJA 1THPB 3T62A 2P3TB 1NFYA 1IHJA 1W0ZU 3STJA 3KL6A 3H5CB 1D3QB 1VR1H 1O33A 3MHWU 4X6OA 1NFWA 3MI4A 1RTKA 4FVDA 2EEGA 3UR9A 3P6ZB 1AU8A 1HAPH 2Q3GA 1GJ8B 1OP8A 4Y71A 1XUFA 3GY4A 2WPMS 2KA9A 2A45B 1MBMA 1W12U 4NXRA 3JZ2B 1PPCE 3M36A 1TGSZ 4MDSA 1AGJA 1GMDG 5HM2A 4DIHH 3NKKA 3QGJA 1ORFA 2PW8H 1ZPZA 5F8ZA 1V2VT 3RC4A 2WL7A 2ZP0H 2BB4A 3PMJA 4WH8A 2NU3E 1QBVH 3SGQE 5HFBA 4WY3A 1L1JA 4JCNA 5LGOA 1T31A 3FFGA 3LNXA 1NY22 1UTOA 4NA8A 1YM0A 1HAVA 1QY6A 2J34A 2GMTC 2V35A 5E11A 1EB1H 2OD3B 4GVDA 4NXQA 2QXGA 3JXTA 1RTLA 2AH4X 1YLDA 3F9EA 2A4GA 1V6DA 4A6LA 3LH1A 1G32B 3PMHB 3GISB 4A92A 4AZ2B 2PKAA 2TPIZ 4XDEA 1BRUP 3SZNA 1N7EA 2XC0A 2WPLS 1AUJA 2GT8A 5EQRA 3WY8A 1W10U 2OMJA 8GCHF 1ZTJA 2W4FA 2PV9B 2AWWA 1O3DA 2C90B 4B2CA 2AEIH 2VIPA 3SU0A 1O2XA 4NWLA 1QR3E 1V3XA 1NF3C 2XBWA 4GHNA 1TPSA 2XBYA 4NIXA 3V0XA 4CRCA 2B5TB 4LXBH 2REYA 4KP0A 4JZIA 5JYIA 2PLXA 1MD8A 3GCTG 2ODQA 3E0PB 2D90A 2EJYA 3KQBA 4ISNA 2BD3A 1G3EA 5J4QA 3URDA 2A5AA 1W7GH 1C2JA 4NCYA 3MWIU 3M3SA 4X1PU 6GCHF 5HDYA 5E0GA 2C93B 2BQWB 1O0DH 3ATLA 3ELAH 3O8BA 4IS5A 3UWIA 3E91A 1N6YA 4AFUA 1BITA 1SVPA 3HATH 1NN6A 1PQAA 3ID4A 3P8GA 1LCYA 2ZPQA 3SU2A 2LUIA 5DP7A 2CMYA 1IU0A 4AMHA 5J4SA 2FODA 1ZUBA 1S5SA 3CBZA 1EATA 2ZQ2A 3C1KA 3RXMA 2THFB 4KFWA 3PO1B 1BQYA 1BFEA 5A8ZA 1AMHA 1ABIH 4WMFA 3GGEA 1C4Y2 1DSTA 2G55A 3RXFA 2XC5A 5DO4H 1SGRE 4H6SB 4RI0A 2FI5E 5EPYA 2ESTE 3DHKH 3RU4D 4F4OC 1O2LA 2PKTA 5L2ZH 1QHRB 3NGHA 1ANCA 1BTUA 5E0HA 3LONA 2C8XB 3Q3KA 2F5YA 3QGNB 4X2YA 4LK4A 1TNHA 2Z17A 3ZZ5A 3N7OA 2BYAX 3D23A 3M7QA 4FXGH 4Y8ZA 4CH2B 2A4OA 4O3TA 1W2KH 1BJVA 2GVFA 2VU8E 4E06H 1CU1A 5FCKA 4K1TA 5IYTA 1MBQA 3PLBA 1FZZA 4Y7BA 3TJOA 3ATKA 4NSVA 1C5UA 3A7VA 5GCHG 2VWLA 1UVPA 7KMEH 2PWXA 1HBTH 3T2NA 5JBCS 1MQ5A 1HGTH 1HUTH 3GY7A 2ZGCA 1V2PT 3Q3YA 3MO3A 1H4WA 1DITH 2V3OH 2CHAC 3A82A 2GDEH 2WPKS 3R69A 1OWDA 2ZFSA 2G51A 2M0UA 2FN5A 2KJKA 6LPRA 1CHOF 2F9NA 3UFAA 1ETSH 1K1NA 5F03A 5I25A 1DPOA 2W3KA 1UEPA 3CS0A 2ZFPH 1Y5UT 1WF8A 3RXQA 1O2KA 4BTTB 3T28A 1DXPA 3Q77A 2D92A 2XW9A 4DGJA 1YC0A 2ZGJA 2CSJA 1PFXC 2JH5D 3RMNH 1UEWA 2RRMA 1UK2A 2BZAA 5HEDA 1L2EA 3RL8A 3U69H 3P95A 1O3AA 5I7ZA 5JDUB 2Z6BD 2J4IA 3SORA 4ISIH 1FUJA 4ABEA 3RLYH 3H7TA 5DK1A 1Q31A 1Y3YA 1DICA 2BD9A 1GI6A 3BG4B 4ISLA 4Q2QA 1G9IE 1TRYA 2ZFFH 3E1XB 1V2KT 1AB9C 3R0HA 3UWJH 3O46A 2F9PA 4WYTA 1H8DH 2FI4E 1F0UA 1SI5H 2GD4B 3BIUH 1A5GH 2KJDA 1OBYA 1V6BA 3QDZB 4IN2A 1AKSB 1F0TA 3UTUH 1O3PB 3GJ9A 3MU5A 1E36B 1L0ZA 5H3JA 1TNJA 5E21A 2FP7B 3BEUA 2FPZA 2QCYA 4ZKNU 2XC4A 3PYHA 1UM1A 3BPUA 1TPPA 1UCYE 1UTJA 2QN5T 4FUHA 2FMJA 3HVQC 1BTZA 5CHAC 3S9BA 3SUFA 1A5HA 1O3NA 4NIYA 1T2MA 1TMTH 1NS3A 2EAQA 1MTSA 1IQKA 5ESBA 4MPVA 4HOPB 3ZVCA 3FVFB 3V12A 3VPKA 3LGUA 4BXSA 1LQEA 4WYUA 2LA8A 1MFLA 2C3SA 1AUTC 3MNBA 3HK6B 1K32A 2J38A 3W94A 2K20A 2K1ZA 3R68A 2TGDA 1O2PA 3HPTB 5EU8A 1P2QA 2F9OA 2GCTC 3DUXH 1TLDA 1LTOA 1O3IA 1H9HE 1P2OA 2Q1JA 1C1NA 2OC8A 2PKSC 1ZTKA 4B74A 3OTPA 4OS4A 3RMOH 1V62A 1XX9A 1C2FA 1AVXA 1ZOKA 2HRVA 1DX5M 4TY6A 3RU4E 3MNSA 3OY5U 1BTYA 2P94A 5EOKA 4Q6HA 2EDVA 2KOJA 1A4WH 2PTNA 3RXGA 1YP9A 5PTPA 2XYAA 3AAVA 2HPQH 2P95A 3S9AA 2GZVA 3G01A 1YPEH 4X1QU 3GCHB 1AE5A 4M7GA 4E34A 2CSSA 3NWUA 1AWHB 2ZTZA 2EV8A 1BCUH 2FE5A 1P9SA 4ABFA 5ABWA 1GCTB 1WFVA 3SI4H 3SV7A 3BEIB 2VJ1A 1FC9A 1C1PA 1ETRH 2D8WA 1GHWH 4ZHLU 2IWQA 3ZZDA 4ZROA 1I92A 3SNDA 3RXKA 4FU9A 3DD2H 4HI3A 4BAQB 2DE8A 4I31A 1LO6A 1BMLA 1P1EA 1ESTA 1DOJA 4Q2PA 2FM2A 4O06A 1JXPA 2Z9KA 2ZGHA 3RXIA 4UFGH 3ENSB 3MU1A 4MLFB 2WUCA 4GVUA 3RXJA 2NU0E 1ZZZA 2XRCA 1Q7XA 1GMCG 4INLA 3GSLA 2WPJS 2ZIQH 3LKWA 3B9FH 3I29A 1W0YH 3SO3A 4I8JA 2I6VA 3TMHA 2ZF0H 1U38A 3KGPA 4D76A 3TGJE 1Y59T 1IQGA 1X45A 2DC2A 2BMGB 2J92A 3GY3A 1AHTH 2B0FA 5CE1A 1MTNC 1EPTB 2Y5HA 1G36A 1GHXH 1O5BB 2BDCA 2RG3A 3K50A 3LPRA 4LOYH 1Z1JA 2BD5A 1LHCH 4JK5A 1Z8IB 1O3CA 1MU8B 1LDTT 4AOQA 1V5LA 1BZXE 1ELVA 3HKJB 2K1QA 2VGCC 1GBEA 3GYMA 4JL7A 3L3TA 1J15A 2BLVA 1YCPM 1RIWB 3SQHE 2ZZUH 2A2XH 3SJ8A 4K76A 2UUFB 3VQGA 2PFEA 1P09A 3UY9A 5EZ0A 5E0JA 1LHGH 1TIOA 2FDAA 2J2UA 2RCZA 2FLRH 2O2TA 2L4SA 3TK6A 3RXHA 2WINI 2KG2A 1TNLA 3SNBA 4R0IA 1CA0B 1Z8JB 1TX7A 2OINA 3CBYA 2J9NA 1S83A 1O5GH 1T8MA 2B7DH 1EOLA 4Z0KA 1SBWA 2Q6DA 5B6LA 3PROA 3KEEA 3HGNA 4LZ1H 2GDDA 1P12E 2BY9X 3T29A 5B6OA 1ETTH 4ABIA 1JIRA 1GI9B 2OP9A 4WF8A 3Q76A 4A5TS 2BD8A 3B23B 1O3OA 4B2BA 3SV9A 2HLCA 1O3LA 4A1XA 2QF0A 3MNXA 1GJ4H 3V13A 3QZQA 2BQ7B 2IWNA 2AGGX 1ZLRA 1F92A 1Z6EA 1C5QA 1BJUA 2FTLE 1O3JA 4UFDH 4TWWA 3BV9B 2Y5FA 2YT8A 3Q00A 2DAZA 3UQOA 1T8NA 1SB1H 3TU7H 2KPLA 1V2ST 2FIRH 2P59A 2SFAA 1FN8A 8KME2 3GYLB 3TH3H 4CRAA 1HCGA 2A5KA 4Z33A 1HIAB 1C4U2 1TGCA 4K1SA 5T6DA 1HB0B 4RKJB 1OP0A 2JXOA 1FPHH 1TYNA 2IN2A 4FVBA 1LPGB 1L6OA 3LNYA 2ANYA 4I8HA 1RZXA 2FWWA 4Q80A 2BD7A 1YPMH 5FPYA 4HGCA 2PA1A 1O5EH 1TQ7B 1MH0A 1GBLA 1Y5AT 3O8RA 1EKBB 1ZPBA 1CHGA 4MTBA 1BRBE 3LDXH 1GI7B 1S82A 2GV6A 1BTHH 1TGBA 3NCLA 1V2OT 2BM2A 2JOAA 4K75A 4GCHF 1ID5H 3UOPA 4K6YA 1WI4A 4JORA 2M0ZA 1IQJA 3F1SB 2M5TA 2D26C 2FNEA 1CQQA 1XKAC 3GY6A 2M0TA 3K82A 1DWCH 1HDTH 1D3PB 5DP6A 3U9AH 3P70B 4ESTE 1TRMA 1MAXA 1JIMA 1WI2A 1KTSB 1QCPA 1EAIA 1FJSA 4F8KA 2EGOA 4NFFA 4B75A 1KXFA 1HJAC 3HGPA 2H9HA 1GG6C 4OGXA 2KV8A 1GI3A 4UFFH 1DM4B 8GCHG 2H9EH 4BAOB 2EA3A 4GAWA 2CV3A 1FPCH 3CP7A 1WBGB 4X1NU 1YF4A 1MTUA 4NFEA 5JBAS 1GBTA 1TA2A 3OYPA 2UZCA 3VEQB 4MPWA 1A0JA 1O38A 2JKHA 2HALA 1K1IA 1ABJH 3T25A 5LPEA 1TFXA 5DG6A 1FXYA 3RXSA 3NZIA 1NRSH 1VJ6A 4E7RG 1VJAU 4H42U 2Z9LA 1K28D 4WMDA 1UEQA 3L33A 3SJKA 2RA3A 6GCHG 1QNJA 4MPUA 3VQFA 3RC6A 1P05A 3NUMA 1MTWA 1RD3B 4X1RU 4X6MA 5EW1H 1U3BA 1PPHE 3SU5A 4O3UA 1MQ6A 2L4TA 4LMMA 2J95A 2GTBA 2AGIX 2EGNA 3ID2A 2CGAA 3PLPA 1BA8B 3PWBA 4AN7A 2HVXA 2F9VA 2AS9A 3MMGA 3ZZCA 2PUXB 3ZZAA 1KEFA 1C1OA 1KDQB 1HAIH 1BTPA 5BRRE 3ZVBA 1GJ7B 1GVZA 1SGEE 5FXLA 2F0AA 2UWLA 3BEFB 4ABAA 3A87A 5GLJA 1G3BA 3A8AA 2ZPLA 2R4HA 2YNBA 4RN6A 3P8FA 3CBXA 2KPKA 2Z94A 1A2CH 2LC7A 3F9GA 1GJ5H 1O2NA 1Z6JH 1XZ9A 1HAZB 4FUGA 2HNTC 1WG6A 3TIUA 5ESTE 3V7TA 4D7FA 3SU4A 2XBXA 3RUOA 2O8WA 8ESTE 1GJDB 1D9IA 4UEHH 1OPHB 4OEOA 1V2UT 1Q3OA 1M9UA 1C2GA 4MNVA 2V1WA 2BVSH 2ZHQH 3I1EA 4X6PA 1KSNA 1ESAA 4U30A 2GCHF 1BMNH 2CHAB 1O2OA 3RLWH 3KCGH 2D2DA 1ZSJA 1O2ZA 1AKSA 4FUEA 1ZJDA 1TMBH 1PQ8A 3O8DA 4FUDA 2A0QB 3BTKE 4YT7H 1YPLH 4YT6H 2VIOA 4GHQA 4ZMAH 1QL7A 4K8YA 1ELAA 5A0AE 3FY5A 1LQDB 1WQVH 2ZNKH 4ZKOU 4Z6AH 1OYQA 1NRNH 3TVJB 1AWFH 3GDVA 3ZZ9A 2ANKH 4H6TA 1GDQA 3O8CA 5HF1A 3RC5A 1CHOG 1XXDA 5GXPA 4N6XA 2FOFA 1LPZB 1P1DA 2R9PA 5JBTA 4HOPA 2SGQE 1QB1A 5CMXH 1C1MA 1YPKH
chains in the Genus database with same CATH superfamily
3SN8A 4ZKRU 1TQ0B 1ZR0A 2VSVA 5FPSA 1AB9B 4TPIZ 2QGRA 1DY8A 1YYY1 1K0HA 3RXTA 1D5GA 2GX4A 5AHGH 3ID1A 2ZHFH 1C5ZB 1O37A 3VB7A 1N99A 1N6DA 1YGCH 4HZHA 3DIWA 4NMSA 5EPNA 1V2MT 3GY8A 1NU9A 2M10A 5DP4A 3M37A 1KY9A 2XCNA 5GDSH 1AVWA 1PQ5A 3FOAA 3RLEA 4CRBA 3KQDA 1MCVA 1YCPH 3K2UA 3ATWA 4YO9A 7GCHF 2PNTA 1GBHA 1O3BA 1XUGA 1Y3VA 1TP5A 3SJOA 2KOMA 1JMOH 5CHAB 1NTEA 1OWIA 4YTAA 1JOUB 1SC8U 3QN7A 3DJ3A 5GIBA 3I4WA 1Z86A 1ELFA 1THRH 1AFEH 1WFGA 1G37A 1EP5A 3EE7A 5FAHA 4DIIH 3BTME 4BNRA 2ZGXH 2VVCA 1AN1E 1KXAA 3QDOA 1MKWK 1TONA 3DJ1A 3LGVA 3M3VA 1X6DA 2CN0H 1A3BH 1FLEE 1GJ9B 1N6XA 1SMFE 2ZU4A 4XRNA 1FDPA 1D4PB 2GCTB 2XWAA 1QQ4A 2PGBB 3PRBA 2PKSB 1C5YB 2FO9A 2VH6A 1Q3PA 1GI1A 1MZAA 3U8TH 1E37B 4DW2U 1ZTLA 1BTXA 1T8LA 4YYXA 1OHHD 2BQ6B 2F83A 2H6MA 1XKBC 1O2WA 2EI7A 1ELDE 2GP9B 1IQIA 1B0EA 4I86A 3SNAA 4B6EA 1C9PA 3LIWA 1EPTA 4JOJA 1XM1A 1CT4E 1FY1A 5K0HA 3DORA 4OS7A 1GBAA 1GL0E 4YDPA 3PLKA 4CR5A 6CHAC 2ANWA 3TNTA 4XE4A 1DY9A 4QT8C 3MQKC 3A85A 1EB2A 1GJCB 2GEFA 1ZMLA 5IK2D 1BOQA 1KYNA 3ODDA 3QK1A 1DXWA 1P03A 3QGLA 5H4IB 1Z71A 5FHTA 3KDKA 2QXHA 3FZDA 1EAWA 1UHBB 1W11U 3SU3A 1KLTA 4X8VH 2AINA 2FOBA 2WUBA 4SGAE 4XD7D 2V6NA 4YLUA 4AG2A 4ZXYH 5HJ1A 1NT1A 3I78A 1OBZA 1E79D 2IOTA 2ZU1A 2JILA 2ODYB 2QA9E 1MTNB 1COWD 4NMRA 4K2YA 1TAWA 1FC6A 2V3MA 1UJVA 1NC6A 1EZSC 2TGTA 4I7YH 1UVSH 3TGKE 5EJZA 1OBXA 3ZVDA 3M61U 4X1SU 1S0QA 1CGJE 1Y5BT 5T3HA 1BT7A 3DJAA 1BRAA 3EA8A 5DSFA 4NWKA 3TITA 2VGCB 3S7HB 3RXRA 4INHA 2EI8A 4NZLA 4ZH8A 1O2SA 1K1JA 4WVPE 1K2I1 1S0RA 3ZZBA 4L8NA 1UJ1A 1RJXB 1VB7A 1UJUA 1CSOE 2A7CA 1GVLA 1P2MA 1F7ZA 3PV4A 4FUJA 3ZVEA 1O5FH 1VJ9U 2VIQA 4FOUC 3BN9A 2DJTA 1SQAA 1N7TA 1JWTA 1EJNA 1UTPA 1UO6A 2KL1A 4P02A 2Y6TA 1EAUA 1O2QA 2XBVA 6ESTA 1SQOA 1GVKB 2QE7D 3RDZA 3OSYA 2HE4A 4I33A 1YPJH 2FEQH 1GI4A 4AYYB 2M2AA 2DLSA 2F3CE 1HIAA 1T4VH 3QJMA 1C2MA 1QB9A 2ZDLA 2JREA 1CT0E 2I4SA 3QE1A 1N6EA 4K72A 2VIVA 3DFJA 2IJOB 1GCDA 5GJ4B 1N6FA 1HXEH 2FZZA 2PR3A 3ITIA 3KZEA 2ASUB 1GMDF 3LH3A 4SGBE 3LGTA 3U1JB 2VINA 1QFKH 1O39A 3UNSA 3U8RH 2D8IA 2LP6A 1K1PA 1UCYH 4Y6DA 2BVXH 4UU5A 4WWYA 3A88A 3A81A 3PS4A 1PPZA 1TB6H 2XCFA 3URCA 1YCPK 1QBOA 3EGKH 3B8JA 3T5FH 4WXIA 4K60A 3AW1A 2OUAA 3N99A 1DWBH 2Z9GA 5ETXA 3U1IB 1SGPE 1MC7A 4YZUA 1EZUC 2BVRH 3GOVB 1ACBE 1SFIA 2G8TA 9LPRA 2PGQB 2ZU5A 1G9OA 1SLUB 1Y3UA 1O3KA 2QYIA 1G2LA 1WOFA 1W9QA 1UTQA 3ZVAA 5DP5A 1LHFH 3TJUA 2EDPA 3V3MA 4PQWA 1KXCA 1P10A 2H2ZA 5GPIB 4GSOA 1BE9A 3BF6H 4FUBA 3LOXA 1V2LT 3KF2A 4CRDA 1TALA 5HFFA 5A2PA 4ABJA 4NMTA 1G3DA 2BY8X 4U2WA 3NFLA 4K1EA 1C1WH 3TK5A 1C2EA 2HVYB 1V2WT 3EQ0H 3QJNA 1D3TB 5GWZA 3PDZA 3TSVA 5GNDA 1AD8H 2GT7A 3LGWA 4AORA 2VWMA 1WJLA 4U01A 3PMAB 4MQAA 4ABBA 9ESTA 4B1TA 3ATMA 1PPFE 1TOCB 3TPIZ 2KAWA 4DY7B 2OBOA 2K8IA 3IITA 4XSKU 1EOJA 1NRQH 3SHCH 3TSWA 4OM9A 1FN6A 3FP6E 4JK6A 4NIVA 1P8VC 1CT2E 1OXGA 2V90A 1C5NH 2TIOA 2XNDD 4UU6A 4WH6A 2A2QH 5FX5A 4GCHG 2P3WA 2BDAA 1UF1A 2LC6A 3SYJA 4TWYA 3VXEH 1HJAB 1BMAA 2BTCE 2VRFA 1GG6B 4KFVA 3DA9B 1TRNA 2ZFRH 4M9FA 2JH6D 2WHXA 1DLEA 2GKVE 1Z8GA 5C94A 2Y82A 5EGMA 3HK3B 3R3GB 2OZFA 5DP8A 1UTLM 1KXDA 1N1LA 1KDQA 2KYLA 3EGHC 5HETA 1KMHB 1MFGA 1BBRE 1O5DH 2G5NA 3GICB 4IMQA 1O2IA 5G4BA 4ZAEA 1WQSA 7ESTE 1RFNA 1VAEA 1W0JD 4O9VA 1EASA 3GABA 3SOSA 1NRRH 3SV8A 3SUEA 5G1EA 4NMPA 2ZDKA 4AFQA 5HM9A 2H3MA 2BLOA 4Q7ZA 3MU0A 4X0WU 1O2VA 5SGAE 2BY5X 2DKRA 2ZPMA 2EEHA 1P2JA 1X9ZA 3UIRA 4F49A 5C2ZA 5IDKA 5EQQA 2FOMB 4Y79A 4BAHB 5TCAA 1NZQH 2A4RA 1TE0A 1YPGH 1EP6A 2R2WU 5A8XA 3I77A 4ABDA 1Q3XA 1SGYE 2UUJB 1T8OA 2JDID 5HKKD 5G1DA 1Y7NA 3BTGE 3P17H 4ZUHA 2I6SA 4MVNA 3LC3A 1FY3A 3MOCA 4Q2OA 2ULLA 5F67A 4X8TH 3SHAH 2NU1E 1EQ9A 4D9RA 1TNKA 1QQUA 2BX4A 1VCWA 1NPMA 1VGCC 1X5NA 1ARBA 1ESBA 2CF9H 2DUCA 5ILBA 2Q6FA 2O8TA 4ISHH 5HFDA 2P3UB 2TRMA 1RS0A 4Q63A 1WUNH 4DURA 1VKYA 2A1DB 2QKUA 2OQSA 1FIZA 4ABHA 1FI8A 7LPRA 1UCYK 2DLUA 5C5NA 5F8XA 3CYYA 1KLJH 4VGCC 3SJ9A 3STIA 3TJNA 1NFXA 1NTPA 5HEYA 3EGGC 2V3HH 3BG8A 1ZGVA 3GY5A 3UOUA 1Z87A 1SFQB 2WPIS 1TGNA 4FUCA 5HGGA 2QT5A 3CNRA 3KIDU 2VIWA 3VXFH 4A1TA 5E22A 2OCVB 1AVGH 3RXEA 1YLNA 4BXWA 1UTMA 2SGFE 2TGPZ 4I8LA 2HNTE 4X2VA 1LVMA 2GCHG 2JWEA 1QB6A 1ZMNA 1F5LA 2VH0A 3UNRA 4Y8XA 1FAKH 2QF3A 4FGMA 4UFEH 1IHTH 3A8DA 1CGHA 3LU9B 2Z7FE 4MNYA 1GHYH 3A7YA 2LPRA 1NO9H 2JETC 2BDIA 3T27A 1L4ZA 2QBWA 1FQ3A 3KQEA 1VCPA 4Y10E 5LPRA 2VZ5A 2A7HA 1SGQE 1MCTA 2ODPA 2D1JA 1O5AB 1VITH 3BTHE 1GI2A 4REYA 5CDFE 1O32A 3DFLA 2H1UA 4CREA 2Y7XA 1UVTH 3EAJA 2OC1A 4ZHAA 3RM0H 4ACAA 2GMTB 1C9TA 2FYRA 2AWUA 3L4FD 5HEBA 1ZJKA 4GPGA 1LHDH 2GV7A 2BYGA 1N8OC 1L1NA 5JXBA 1MTVA 2L74A 4BANB 5C1UA 3AASA 4F55A 1AY6H 1WTHD 2I0IA 1K22H 2Y7ZA 1IQNA 1GI5A 4NZQA 1SGNE 3MU4A 1OYTH 4JYVH 5HIZA 2B8OH 1NESE 4H11A 1E1QD 3FZZA 3LT3A 1K9OE 3OFND 2ZHWH 3WWBA 1GI8B 4Q2KA 3TSZA 3ZZ4A 1A0LA 1HAGE 1BBRK 1WHDA 2W5EA 3GY2A 2Y80A 5HYOA 4HTCH 2JH0D 4H4FA 3O5NA 2RA0A 7GCHG 3FP7E 3SQEE 2GZ7A 4K3JA 5FBIA 4NMOA 3WW7A 2EI6A 1FONA 5C3NA 4Z1MD 3U28C 2A4QA 1UHBA 3NK8A 3S7KB 2ZECA 4I32A 1BTWA 1MKWH 1GBFA 2ZFQH 4PROA 2ALVA 1ELCA 2J98B 3NRLA 4XOJA 3QIKA 1WDIA 4X2WA 1NFUA 2ZPSA 3M5MA 4B2AA 1O5CB 4NXPA 1QRZA 1UW7A 4D7GA 3P8OA 1GDNA 2ZA5A 2OK5A 2OGPA 2UWOA 2I6QA 2CXVA 3ZYEA 1LVBA 2AFQB 2CF8H 1I16A 4INKA 3D65E 3EYDA 3BTEE 2BDGA 2V7QD 2EC9H 3EA7A 3LGIA 3D49H 1C5RA 1F0RA 1GMCF 3NXPA 2KZ4A 5E2PA 6CHAB 5CHBA 2ZO3H 4OS1A 5EG4A 1QA7A 4UDWH 3RXAA 1MAYA 4XBDA 1E35B 3OTJE 1VCQA 1GJBB 5AVDA 3CC0A 1OX1A 1G3CA 1W3CA 2ZGBH 2J94A 3QTOH 2VNTA 3AXAA 1QBNA 4NNLA 2BDHA 2DE9A 3KDGA 1UITA 1ELEE 1SL3A 1LPKB 1XUHA 4NA9H 2FOCA 4NNMA 3K1RA 1P04A 1JBUH 2QXIA 2SGPE 3OU0A 3TLOA 5LPFA 5A0CA 1GHZA 3OEHD 4NGAH 5FCRA 1TBQH 4UD9H 1PYTC 5EXNA 1G30B 3MH7A 3MYWA 1A0HB 5HIYA 1C1VH 1O31A 1FAXA 4R8TB 1O30A 1GHAF 1UM7A 3R0FA 1C1RA 3PB1E 5A09A 2W7RA 2SGDE 1SOTA 2IWPA 3KHFA 2ZDAH 3M5LA 1JRTA 4YOIA 2H2CA 2E7KA 4AG1A 1LKBA 1HLTH 1V2NT 4XBCA 1UVOA 1TBZH 1MD7A 2PTCE 2VVVA 1QZ8A 1ELTA 1BB0B 2WV4A 1INCA 2ZG0H 2WYJA 4B71A 3FP8E 1VITF 2A32A 3SHUA 3U98H 4ZKSU 2VBCA 2ZCLP 3PTNA 1UK4A 1LMWB 3M7TA 1J17T 4JOFA 2PKUA 1AZZA 3PV5A 1GJAB 1WV7H 3PTBA 2SGEE 1FMGA 2R0KA 3TK9A 5C1XA 2W6JD 1UVUH 1EUFA 2JJ2D 3SJIA 2EEIA 1P01A 5A2MH 1RGRA 1BDAA 1FCFA 3RXDA 5EJLA 2JIKA 2H5DA 2W3IA 5JPMH 1DUAA 2WV5A 5JB8S 4TY7A 1SLXB 1AI8H 1SLWB 3L6PA 1AZ8A 3FAOA 3LC5A 4KTSA 4RSPA 4YESB 3BSQA 1KXBA 2ZPRA 1UHPA 1KTTB 1TPOA 4GUXA 5JBBS 5HF4A 1C5LH 1D3DB 1W13U 3ZZ3A 1HAXB 2JSNA 2YUYA 2H2BA 3QX5H 1C4V2 1V2JT 1PQ7A 1UMAH 1PDRA 2A7JA 2KOHA 4WXVA 1O2RA 2QKTA 1B8QA 4XHVA 1GBMA 1O3GA 1W7XH 1S6HA 2EEKA 4TPYA 4OS2A 2P8OC 3VFEA 3SHWA 1X8SA 1T4UH 4CR9A 4OAJA 2ZC9H 1ARCA 4HFPB 1O3EA 1TNGA 1UEZA 1SGFA 4P00A 2ALPA 3A7WA 2O8LA 4A1VA 4GVCA 1E34B 4X6NA 1HJ9A 5C20A 1BIOA 1PPEE 1ZSLA 3I18A 1EZQA 2ZKSA 2YOLA 1GWAA 1OWJA 3F2FA 3LJOA 2BOKA 5KGOA 3FN8A 3SGBE 2Q6GA 4YLQH 3TNSA 2F43B 3MO6A 4Y7AA 1UJDA 2ZDMA 2XNIA 3UPEA 1EZXC 3GDSA 1EAXA 3NCVA 1SGCA 1P57B 3SBKA 4AX9H 1K1OA 3ZZ8A 1C2LA 4OS6A 4JOEA 1E0FD 2HE2A 1MU6B 1TGTA 1DDJA 3SI3H 1DUEA 1QRWA 1C1TA 5EXMA 3BTQE 2FOHA 1OWEA 2MHOA 3GCOA 1GGDC 2KJPA 3A8BA 1C1QA 1IQLA 2TGAA 3F9FA 3KNXA 1A5IA 3PM3A 2F91A 1AIXH 1HPGA 4JYUH 1RXPA 1P06A 3SW2B 1QAUA 1O2TA 4Q7XA 4YOGA 3K6ZA 2ZHDA 2ZTXA 2QXJA 2RCEA 3OAAD 2ZCHP 2R0LA 2FS9A 5C0TA 3ZVGA 4NG9H 1WSSH 3K6YA 2OC0A 2GZ9A 1QAVB 3CH8A 1TQ3A 3E3TA 2W7SA 1HAHH 1TNIA 2G4TA 4CHAC 3DSGA 2PUQH 1ZSKA 3PV2A 4X2XA 1WYKA 1OWHA 1Z8RA 1N7FA 2BY7X 1YKTA 5DJ7A 1H8IH 2FI3E 1C5TA 1C5VA 3UR6A 1K1LA 4JYTA 3NFKA 1AQ7A 2BDYA 2Z9IA 1EJAA 4TYDA 2FTMA 3SGAE 3SUDA 1Y8TA 1QURH 2FXRA 1SLVB 1C2HA 1GHBF 5F8TA 1S6FA 1P3CA 1BUIA 5DKMA 5JB9S 1B7XB 1BMMH 2F4LA 2KCPA 1CBWC 2PHBA 1SQRA 4CBNA 1TPAE 4B73A 3ZYDA 3MTYA 5DP9A 1P9UA 1MUEB 2ANMH 3ZV9A 2YTWA 3VGCC 1CGIE 1GL1A 2A31A 4RKOB 4Q2NA 2AYWA 4Q3HA 3MU8A 1ANEA 1P0SH 3OX7U 5BPEA 2OQUA 3PRDA 1AFQC 2Q9VA 2SNWA 4Y0YE 2P3FH 3HKIB 2EQNA 1KWAA 2FLBH 5FBEA 3TGIE 3SU6A 3ZVFA 1FY4A 5EJ1A 1FV9A 1Q2WA 2QY0B 2ZU2A 2ZTYA 1GHVH 1W8BH 3MH4A 2YT7A 1O2YA 3MH5A 5E8EH 1HV7A 1FIWA 5DTHA 1HYLA 1ELGA 3VG8A 2R3YA 1GMHF 2G2LA 1GDUA 1DWDH 2OS6A 4MPAA 3DSOA 2QC2A 4MNXA 1GPZA 3WKMA 1V1TA 3BTTE 2Z3CA 2VVUA 2I04A 4X8SH 1U39A 1P2KA 3SOEA 3M5NA 4CRGA 1MZDA 2AWXA 4UE7H 3LJJA 4YOJA 2ZDNA 2OPGA 2QF4A 3PMBB 3RXCA 1VGCB 5K7RA 1SGIB 2ZCKP 2R3UA 1ANDA 2F9UA 2AMPA 3ZV8A 4D8NA 1C5SA 3E0NB 3BIVH 5TJXA 1P2NA 1XVOA 1V2TT 1RGQA 2LOBA 1SGTA 4R2ZA 1UTKA 1SHHB 2ZU3A 1DFPA 1QA0A 4VGCB 3T26A 4KTCA 2WSSD 3UUZA 1A46H 1ZYOA 2KX4A 4JZDH 2Z3EA 2NU2E 5L6NH 4CBOA 4O97A 2VWRA 5A0BA 1IQFA 3QZRA 3A89A 1PPGE 4NSYA 3KZDA 1EFRD 1UTNA 2PZDA 2BY6X 4DOQA 1OWKA 3RU4T 3TJVA 2KQFA 4JJ3A 1OSSA 4JMYA 1P2IA 2G81E 1P3EA 2Z9JA 2QIQA 3MH6A 2MX6A 3K65B 1BHXB 2O8UA 1X5RA 2KAIB 1SOZA 1WTGH 4IW4E 3A8CA 3UQVA 2OXSA 4RT0A 1XMNB 4JOGA 2JETB 1O3FA 2Z3DA 3KN2A 4Y0ZE 2ZI2H 4NMVA 3FANA 1JRSA 5L2YH 5EODA 3E6PH 1W9OA 1X7AC 1GBKA 1H1BA 4BTUB 3ID3A 2PP6A 2G5MB 1SGFG 2WV9A 1EJMA 5FX6A 1PYTD 2M3MA 2DMZA 2J98A 1M5ZA 1GBJA 4IN1A 2AIQA 1WHAA 2DB5A 4IC6A 4NMQA 3HPKA 1FX0B 4Z8JA 1N8OB 4DCDA 2EDZA 3F3BA 5TCCA 1GM1A 2FX6A 1HXFH 1XUKA 3KQCA 3QWCH 1IQMA 1ZGIA 2IWOA 2BXTH 2ZHEH 4EDJA 1L4DA 3A84A 3GCNA 3GCTF 5AFZH 5AF9H 1YPHE 1WAYB 1AE8H 2L6OA 2LELA 4ASHA 4MPXA 1RGWA 4P0CA 2QV1A 3F2GA 2B9LA 1C2KA 2HGTH 3B76A 4Y8YA 5B42A 1AO5A 5DN6D 1GQ5A 1RRKA 4AYVB 2R2MB 1GBCA 1HAVB 4J2YB 4AC9A 1BBRH 3BTWE 3D62A 2CS5A 4JOKA 3PWCA 4FU7A 4ZHMU 1FNIA 3CENA 3ZRTA 1KLIH 1C2IA 4TT3D 5LH8A 2O9QA 3Q3XA 2I0LA 4OS5A 3U8OH 1C5OH 1A7SA 3RXPA 2STAE 5E1YA 4E35A 1O35A 4ABGA 2ZDVH 3F9HA 4Y76A 1OZIA 1C5PA 1C5XB 1YLCA 2PKAB 3SV2H 3RXUA 1ZRKA 2FYQA 1Z1IA 4WMEA 1UFXA 2OBQA 1QL9A 3FKSD 2BXUH 4K5ZA 1HAYB 1MKXH 4IMZA 1IQEA 1NRPH 5HFEA 1CO7E 4AGJA 3A7XA 5EIYA 2W7UA 4B76A 1QJ7B 2TBSA 3VB4A 1ANBA 1OKXA 5EQSA 1ELBA 3S0NA 4JOHA 4JZEH 4KELA 1O3HA 2G00A 1QIXB 3PO1C 1DLKB 2H9TH 3ZZ6A 4DT7B 4FUIA 4AB9A 1OOKB 1WH1A 5DGJA 5AFYH 2C8WB 2OLGA 4RT1A 2AMQA 5F53A 4THNH 1XXFA 1RY4A 2GGVB 2OCSA 3SUZA 2QG1A 1EX3A 1W14U 1QL8A 1EXFA 1LVYA 5FB8C 3A80A 4Y11E 1UK3A 4XFQA 3VB6A 1VZQH 5GCHF 4K8BA 3UNQA 5E2OA 2FCFA 3E16B 1CA8B 2HOBA 4OEPA 3UREA 2BX3A 1BRCE 2KBSA 4E3BA 1TBRH 3TH2H 2K0QA 1W9EA 1K1MA 1TX8A 2QAAA 1K21H 1KXEA 4YM9A 1F5RA 1TABE 3P8NA 4AFZA 2VSPA 1FC7A 1F2SE 3GDUA 2Y5GA 2P93A 3HPMA 3JZ1B 1A1RA 1NU7B 1WF7A 2XXLA 3MO9A 1XUIA 3H7OA 1J9CH 2FX4A 5HMAA 4LZ4B 1TA6A 1BHXF 1GBDA 1J8AA 1LKAA 3UB0A 1GHAG 3ODFA 4OGYA 4FUFA 1Z7KA 3S69A 2KRGA 1F5KU 4IBLH 5EXLA 3C27B 2EEJA 4BTIB 2BDBA 8LPRA 4ZXXH 2DM8A 1V2QT 1J14A 2EGKA 2PSYA 3EE0B 3EDXB 5FPTA 1B0FA 2C4FH 2STBE 2O8MA 2FOAA 1P02A 3RXVA 1IAUA 5T1VA 3RXLA 1Y3XA 1O34A 2V0BA 1SPJA 3RXBA 1V2RT 1C1SA 2LNCA 4KGAA 2HPPH 5C5OA 1VITG 1OP2A 2AMDA 2Y81A 3S9CA 2NU4E 2OSGA 2VWOA 1DVAH 5F3XA 1O2JA 1YBWA 4BAKB 2RFKC 4KKDA 3E17A 2G52A 1SGDE 4A7IB 2GZ8A 3EA9A 5C67A 2PDZA 3M3TA 3TH4H 1SG8B 3BG4C 3RM2H 5EW2H 1KIGH 4MNWA 2ENOA 4Q7YA 2JINA 1YPHC 2VWNA 3RMMH 4CH8B 1HAOH 4NIWA 3BTDE 1QLCA 1S84A 4JZFH 1SQTA 2UUYA 2W26A 1P11E 3E90B 2W6ID 4I8KA 4P2AB 2NWNA 2AERH 3MNCA 1TMUH 2P8OB 1F0SA 1HRTH 3ATIA 1TP3A 1OS8A 1HNEE 4HG6A 1S81A 2QKVA 1SKYE 2BHGA 5T6GA 4NA7A 2F9BH 3A7ZA 3QO6A 4FU8A 3A83A 2H5CA 4J1YA 4X8UH 2UUKB 2YNAA 1T7CA 1ZOMA 3QLPH 3KYGA 2BLWA 4WJG2 1U37A 4BAMB 3VB5A 1QAVA 3RXOA 4GLYA 2WPHS 1A3EH 2OQ5A 1QTFA 1FY8E 4IC5A 4MG3A 3M35A 2FOEA 2H3LA 5DP3A 5E6PB 3SU1A 3RMLH 1IU2A 4Q6SA 1THSH 3RP2A 1TWXB 1GGDB 4UONA 3SNEA 3SFJA 4I8GA 1C2DA 5F6MA 1NBME 1O2UA 2CJIA 1DANH 1T32A 1IQHA 2AIPA 3A7TA 2VPHA 2X7ZA 1XUJA 1A61H 4JOPA 4BOHA 2P16A 2BLQA 4AFSA 1ZHRA 1GBIA 1LVOA 1O2MA 2YMSC 2I1NA 2FESH 1C5MD 4IGDA 1B5GH 3OY6U 1MKXK 3A86A 2L97A 3DT0H 3F6UH 3CS7A 2FOGA 1QRXA 1C1UH 2CK3D 3VB3A 1RTFB 5L30H 3QTVH 3GCHC 3M7UA 3IG6B 3IWMA 4E7NA 1L1GA 4G69A 1O2HA 2C8ZB 1IOEA 1NM6A 1ZHPA 2HWLB 2FS8A 1SHYA 1C5WB 1GCTC 5T6FA 4CHAB 2WYGA 5IL9A 3F68H 3UAIC 1YY3A 1ZRBA 4ISOA 2RDLA 1GI0A 2XWBI 4K69A 2KM0A 3E8LA 3BTFE 2EXGA 1CVWH 5C1YA 1O3MA 3WKLA 4GHTA 1TX6A 2C8YB 3QUMP 3SUGA 3W95A 1NROH 1GJ6A 2HNTF 1IHSH 1TOMH 4O03A 3SV6A 3P92A 5DPAA 3M5OA 3ZZ7A 3AAUA 3AVZA 5I46H 2M0VA 1H9LB 1VA8A 1CBWB 1HFDA 1GQ4A 1QJ6B 1PPBH 2ILNA 1J16A 2ZQ1A 4D9QA 3AW0A 3SNCA 5HXFA 2ZEBA 1EPTC 2OC7A 1R6JA 3MFJA 1WU1A 5D13A 1WIFA 3ESTA 5A8YA 3VGCB 4JZ1A 2SGAA 2AGEX 3LGYA 1LHEH 4DJZB 2YUBA 4FLNA 1GHBG 2G5VA 2SNVA 1YBOA 1AFQB 3PDVA 1D6RA 4U32A 2EHRA 4AB8A 1SSXA 4AGKA 2A5IA 2BD4A 3KQ5A 1V5QA 1RIWC 2BD2A 4E05H 4CRFA 1MMJN 5HFCA 1XVMA 3OEED 1DE7H 4DG4A 2JJ1D 2VB0A 1QJ1B 3KHVA 1U6QA 1E38B 1O2GH 1CE5A 1H9IE 1WCZA 1QGFA 1SR5C 2ZFTA 1DWEH 1ZHMA 4K78A 1PJPA 2ZWLH 1D6WA 1O36A 2PSXA 5KEDA 2VIDA 2G4UA 1CA0C 4XBBA 1G2MA 3RL7A 2UWPA 1S85A 2KAIA 1HJ8A 1DT2A 3F0PA 1ZPCA 1GBBA 2IPHA 2OTVA 2BOHB 1X5QA 1GMHG 1FY5A 1Y3WA 1DS2E 2HGAA 3K9XB 2BZ6H 4DVAU 4KTUA 3NPSA 1DSUA 5EYZA 2XTTB 1ZMJA 1THPB 3T62A 2P3TB 1NFYA 1IHJA 1W0ZU 3STJA 3KL6A 3H5CB 1D3QB 1VR1H 1O33A 3MHWU 4X6OA 1NFWA 3MI4A 1RTKA 4FVDA 2EEGA 3UR9A 3P6ZB 1AU8A 2KR7A 1HAPH 2Q3GA 1GJ8B 1OP8A 4Y71A 1XUFA 3GY4A 2WPMS 5C0UA 2KA9A 2A45B 1MBMA 1W12U 4NXRA 3JZ2B 1PPCE 3M36A 1TGSZ 4MDSA 1AGJA 1GMDG 5HM2A 4DIHH 3NKKA 3QGJA 1ORFA 2PW8H 1ZPZA 5F8ZA 1V2VT 3RC4A 2WL7A 4ACBA 2ZP0H 2BB4A 3PMJA 4WH8A 2NU3E 1QBVH 3SGQE 5HFBA 4WY3A 1L1JA 4JCNA 5LGOA 1T31A 3FFGA 3LNXA 1NY22 1UTOA 4NA8A 1YM0A 1HAVA 1QY6A 2J34A 2GMTC 2V35A 5E11A 1EB1H 2OD3B 4GVDA 4NXQA 2QXGA 3JXTA 1RTLA 2AH4X 1YLDA 3F9EA 2A4GA 1V6DA 4A6LA 3LH1A 1G32B 3PMHB 3GISB 4A92A 4AZ2B 2PKAA 2TPIZ 4XDEA 1BRUP 3SZNA 1N7EA 2XC0A 2WPLS 1AUJA 2GT8A 5EQRA 3WY8A 1W10U 2OMJA 8GCHF 1ZTJA 2W4FA 2PV9B 2AWWA 1O3DA 2C90B 4B2CA 2AEIH 2VIPA 3SU0A 1O2XA 4NWLA 1QR3E 1V3XA 1NF3C 2XBWA 4GHNA 1TPSA 2XBYA 4NIXA 3V0XA 4CRCA 2B5TB 4LXBH 2REYA 4KP0A 4JZIA 5JYIA 2PLXA 1MD8A 3GCTG 2ODQA 3E0PB 2D90A 2EJYA 3KQBA 3FO8D 4ISNA 2BD3A 1G3EA 5J4QA 3URDA 2A5AA 1W7GH 4FETA 4ZCNA 1C2JA 4NCYA 2IPQX 3M3SA 3MWIU 4X1PU 6GCHF 5HDYA 5E0GA 3KYFA 2C93B 2BQWB 1O0DH 3ATLA 1MABB 3ELAH 3O8BA 4IS5A 3UWIA 3E91A 1N6YA 4AFUA 1BITA 1SVPA 3HATH 1NN6A 1WXRA 1PQAA 3ID4A 3P8GA 1LCYA 2ZPQA 3SU2A 2LUIA 5DP7A 2CMYA 1IU0A 4AMHA 5J4SA 2J97A 2EY4C 2FODA 1ZUBA 1S5SA 3CBZA 1EATA 3DSPA 2ZQ2A 3C1KA 3RXMA 2THFB 4KFWA 3PO1B 1BQYA 1BFEA 5A8ZA 1AMHA 1ABIH 4WMFA 3GGEA 1C4Y2 1DSTA 2G55A 3RXFA 3DCLA 2XC5A 1S6LA 5DO4H 4DT4A 1SGRE 4H6SB 4RI0A 2FI5E 5EPYA 2ESTE 3DHKH 3RU4D 4F4OC 1O2LA 2PKTA 5L2ZH 1QHRB 3NGHA 1ANCA 1BTUA 5E0HA 3LONA 2C8XB 3Q3KA 2F5YA 3QGNB 4X2YA 3AK5A 4LK4A 2Z17A 1TNHA 3ZZ5A 3N7OA 2BYAX 3D23A 3M7QA 4FXGH 4Y8ZA 4CH2B 2A4OA 4O3TA 1W2KH 1BJVA 2GVFA 2VU8E 1E1RD 4E06H 1CU1A 5FCKA 4K1TA 5IYTA 1MBQA 3PLBA 1FZZA 4Y7BA 3TJOA 3ATKA 3SZEA 4NSVA 1C5UA 3A7VA 5GCHG 2VWLA 1UVPA 7KMEH 2PWXA 1HBTH 2QF5A 3T2NA 5JBCS 1MQ5A 1HGTH 1HUTH 3GY7A 2ZGCA 1V2PT 3Q3YA 3MO3A 1H4WA 1DITH 2V3OH 2CHAC 3A82A 2GDEH 2WPKS 3R69A 1OWDA 2ZFSA 2G51A 2YMSD 2M0UA 2FN5A 2KJKA 6LPRA 1CHOF 2F9NA 3UFAA 1ETSH 1K1NA 5F03A 5I25A 1DPOA 2KCYA 2AHME 1UEPA 3CS0A 2W3KA 1Y5UT 1WF8A 2ZFPH 3RXQA 1O2KA 4BTTB 3T28A 1DXPA 3Q77A 2D92A 2XW9A 4DGJA 1YC0A 2ZGJA 2CSJA 1PFXC 2JH5D 3RMNH 1UEWA 2RRMA 1UK2A 2BZAA 5HEDA 1L2EA 3RL8A 3U69H 5KECA 3P95A 1O3AA 5I7ZA 5JDUB 2Z6BD 2J4IA 3SORA 4ISIH 1FUJA 4ABEA 3RLYH 4Q4LA 3H7TA 5DK1A 1Q31A 1Y3YA 1DICA 2BD9A 1GI6A 3BG4B 4ISLA 4Q2QA 1G9IE 1BMFD 1TRYA 2ZFFH 3E1XB 1V2KT 1AB9C 3R0HA 3UWJH 3O46A 2F9PA 4WYTA 1H8DH 2FI4E 1F0UA 1SI5H 2GD4B 3BIUH 1A5GH 2KJDA 1OBYA 1V6BA 3QDZB 4IN2A 1AKSB 1F0TA 3UTUH 1O3PB 3GJ9A 3MU5A 1E36B 1L0ZA 5H3JA 1TNJA 5E21A 2FP7B 3BEUA 2FPZA 2QCYA 4ZKNU 2XC4A 3PYHA 1UM1A 3BPUA 1TPPA 1UCYE 1UTJA 2QN5T 4FUHA 2FMJA 3HVQC 1BTZA 5CHAC 3S9BA 3SUFA 1A5HA 1O3NA 4NIYA 1T2MA 1TMTH 1NS3A 2EAQA 1MTSA 1IQKA 5ESBA 4MPVA 4HOPB 3ZVCA 3FVFB 3V12A 3VPKA 3LGUA 5FL7D 4BXSA 1LQEA 3H09A 4WYUA 2LA8A 1MFLA 2C3SA 1AUTC 3MNBA 3HK6B 1K32A 2J38A 3W94A 2K20A 2K1ZA 3R68A 2TGDA 1O2PA 3HPTB 5EU8A 1P2QA 2F9OA 2GCTC 3DUXH 1TLDA 1LTOA 1O3IA 1H9HE 1P2OA 2Q1JA 1C1NA 2OC8A 2PKSC 1ZTKA 4B74A 3OTPA 4OS4A 2RDEA 3RMOH 1V62A 1XX9A 1C2FA 1AVXA 1ZOKA 2HRVA 1DX5M 4TY6A 3RU4E 3MNSA 3OY5U 1BTYA 2P94A 5EOKA 2YMSB 4Q6HA 2EDVA 2KOJA 1A4WH 2PTNA 3RXGA 1YP9A 5PTPA 2XYAA 3AAVA 2HPQH 2P95A 3S9AA 2GZVA 3G01A 1YPEH 4X1QU 1YWUA 1AE5A 3GCHB 4M7GA 4E34A 2CSSA 3NWUA 1AWHB 2ZTZA 2EV8A 1BCUH 2FE5A 1P9SA 4ABFA 5ABWA 1GCTB 1WFVA 3SI4H 3SV7A 3BEIB 2VJ1A 1FC9A 1C1PA 1ETRH 2D8WA 1GHWH 3W1EA 4ZHLU 2IWQA 2KCAA 4ZROA 1I92A 3SNDA 3ZZDA 2WPDD 3RXKA 4FU9A 1H8ED 3DD2H 4HI3A 4BAQB 2DE8A 4I31A 1LO6A 1BMLA 1P1EA 1ESTA 1DOJA 4Q2PA 2FM2A 4O06A 1JXPA 2Z9KA 2ZGHA 3RXIA 4UFGH 3WWFA 3ENSB 3MU1A 4MLFB 2WUCA 4GVUA 3RXJA 2NU0E 1ZZZA 2XRCA 1Q7XA 1GMCG 4INLA 3GSLA 2WPJS 2ZIQH 3LKWA 3B9FH 3I29A 1W0YH 1NBMD 4I8JA 3SO3A 2I6VA 3TMHA 2XOKD 2ZF0H 1U38A 3KGPA 4D76A 3TGJE 1Y59T 1IQGA 1X45A 2DC2A 2BMGB 2J92A 3GY3A 1AHTH 2B0FA 5CE1A 1MTNC 1EPTB 2Y5HA 1G36A 1GHXH 1O5BB 2BDCA 2RG3A 3K50A 3LPRA 4LOYH 1Z1JA 2BD5A 1LHCH 4JK5A 1Z8IB 1O3CA 1MU8B 1LDTT 4AOQA 1V5LA 1BZXE 1ELVA 3HKJB 2K1QA 2VGCC 1GBEA 3GYMA 4JL7A 3L3TA 1J15A 2BLVA 1YCPM 1RIWB 3SQHE 2ZZUH 2A2XH 3SJ8A 4K76A 2UUFB 3VQGA 2PFEA 1P09A 3UY9A 5EZ0A 5E0JA 1LHGH 1TIOA 2FDAA 2J2UA 2RCZA 2FLRH 2O2TA 2L4SA 3TK6A 3RXHA 2WINI 2KG2A 1TNLA 3SNBA 4R0IA 3GS9A 1CA0B 1Z8JB 1TX7A 2OINA 3CBYA 2J9NA 1S83A 1O5GH 1T8MA 2B7DH 1EOLA 4Z0KA 1SBWA 2Q6DA 5B6LA 3PROA 3KEEA 3HGNA 4LZ1H 2GDDA 1P12E 2BY9X 3T29A 3N7DA 5B6OA 1ETTH 4ABIA 1JIRA 1GI9B 2OP9A 4WF8A 3Q76A 4A5TS 2BD8A 3B23B 1O3OA 4B2BA 3SV9A 2HLCA 1O3LA 4A1XA 2QF0A 3MNXA 1GJ4H 3V13A 3QZQA 2BQ7B 2IWNA 2AGGX 4B6FA 1ZLRA 1F92A 1Z6EA 1C5QA 1BJUA 2FTLE 1O3JA 4UFDH 4TWWA 3BV9B 2Y5FA 2YT8A 3Q00A 2DAZA 3UQOA 1T8NA 1SB1H 3TU7H 2KPLA 1V2ST 2FIRH 2P59A 2SFAA 2J5UA 1FN8A 8KME2 3GYLB 3TH3H 4CRAA 1HCGA 2A5KA 4Z33A 1HIAB 1C4U2 1TGCA 4K1SA 5T6DA 1W0KD 1HB0B 4RKJB 1OP0A 2JXOA 1FPHH 1TYNA 2IN2A 4FVBA 1LPGB 1L6OA 3LNYA 2ANYA 4I8HA 1RZXA 2FWWA 4Q80A 3F2HA 2BD7A 1YPMH 5FPYA 4HGCA 2PA1A 1O5EH 1TQ7B 1MH0A 1GBLA 1Y5AT 3O8RA 1EKBB 1ZPBA 1CHGA 4MTBA 1BRBE 3LDXH 1GI7B 1S82A 2GV6A 1BTHH 1TGBA 3NCLA 1V2OT 2BM2A 2JOAA 2KCOA 4F48B 4K75A 4GCHF 1ID5H 3UOPA 4K6YA 1WI4A 4JORA 2M0ZA 1IQJA 3F1SB 2M5TA 2D26C 2FNEA 1CQQA 1XKAC 3GY6A 2M0TA 3K82A 1DWCH 3OE7D 1HDTH 1D3PB 5DP6A 3U9AH 3P70B 4ESTE 1TRMA 1MAXA 1JIMA 1WI2A 1KTSB 1QCPA 3N7EA 1EAIA 1FJSA 4F8KA 2EGOA 4NFFA 4B75A 1KXFA 1HJAC 3HGPA 2H9HA 1GG6C 4OGXA 2KV8A 1GI3A 4UFFH 1DM4B 8GCHG 2H9EH 4BAOB 2EA3A 4JJ0A 2WZQA 2CV3A 4GAWA 1FPCH 3CP7A 1WBGB 4X1NU 1YF4A 1MTUA 4NFEA 5JBAS 1GBTA 1TA2A 3OYPA 2UZCA 3VEQB 4MPWA 1A0JA 1O38A 2JKHA 2HALA 2IJD1 1K1IA 1ABJH 3ZIAD 3T25A 5LPEA 1TFXA 5DG6A 1FXYA 3RXSA 3NZIA 1NRSH 1VJ6A 4E7RG 1VJAU 4H42U 2Z9LA 1K28D 4WMDA 1UEQA 3L33A 3SJKA 2RA3A 6GCHG 1QNJA 4MPUA 3VQFA 3RC6A 1P05A 3NUMA 1MTWA 1RD3B 4X1RU 4X6MA 5EW1H 1U3BA 1PPHE 3SU5A 4O3UA 1MQ6A 2GJGA 2L4TA 4LMMA 2J95A 2GTBA 2AGIX 2EGNA 3ID2A 2CGAA 3PLPA 1BA8B 3PWBA 4AN7A 2HVXA 2F9VA 2AS9A 3MMGA 3ZZCA 2PUXB 3ZZAA 1KEFA 1C1OA 1KDQB 1HAIH 1BTPA 5BRRE 3ZVBA 1GJ7B 1GVZA 1SGEE 5FXLA 2F0AA 2UWLA 3BEFB 4ABAA 3A87A 4ASUD 5GLJA 1G3BA 3A8AA 2ZPLA 2R4HA 3F0OA 2YNBA 4RN6A 3P8FA 3CBXA 2KPKA 2Z94A 1A2CH 2LC7A 3F9GA 1GJ5H 1O2NA 1Z6JH 2KFWA 1XZ9A 1HAZB 4FUGA 2HNTC 1WG6A 3TIUA 5ESTE 3V7TA 4D7FA 2HLDD 3SU4A 2XBXA 3RUOA 2O8WA 8ESTE 1GJDB 1D9IA 4UEHH 1OPHB 4OEOA 1V2UT 1Q3OA 1M9UA 1C2GA 4MNVA 2V1WA 2BVSH 2ZHQH 3I1EA 4X6PA 1KSNA 1ESAA 4U30A 2GCHF 1BMNH 2CHAB 1O2OA 3RLWH 3KCGH 2D2DA 1ZSJA 1O2ZA 1AKSA 4FUEA 1ZJDA 1TMBH 1PQ8A 3O8DA 4FUDA 2A0QB 3BTKE 4YT7H 1YPLH 4YT6H 2VIOA 4GHQA 2JIZD 4ZMAH 1QL7A 5C17A 4K8YA 1ELAA 1H8HD 5A0AE 3FY5A 1LQDB 1WQVH 2ZNKH 4ZKOU 4Z6AH 1OYQA 4YXWD 1NRNH 3TVJB 1AWFH 4TSFD 3GDVA 3ZZ9A 2ANKH 4H6TA 1GDQA 3O8CA 5HF1A 3RC5A 1CHOG 1XXDA 5GXPA 4N6XA 2FOFA 1LPZB 1P1DA 2R9PA 5JBTA 4HOPA 2SGQE 1QB1A 5CMXH 1C1MA 1YPKH
chains in the Genus database with same CATH topology
3SN8A 4ZKRU 1TQ0B 1ZR0A 2VSVA 5FPSA 1AB9B 4TPIZ 2QGRA 1DY8A 1YYY1 3RXTA 1D5GA 2GX4A 5AHGH 3ID1A 2ZHFH 1C5ZB 1O37A 3VB7A 1N99A 1N6DA 1YGCH 4HZHA 3DIWA 4NMSA 5EPNA 1V2MT 3GY8A 1NU9A 2M10A 5DP4A 3M37A 1KY9A 2XCNA 5GDSH 1AVWA 1PQ5A 4CRBA 3RLEA 3KQDA 1MCVA 1YCPH 3K2UA 3ATWA 4YO9A 7GCHF 2PNTA 1GBHA 1O3BA 1XUGA 1Y3VA 1TP5A 3SJOA 2KOMA 1JMOH 5CHAB 1NTEA 1OWIA 4YTAA 1JOUB 1SC8U 3QN7A 3DJ3A 5GIBA 3I4WA 1Z86A 1ELFA 1THRH 1AFEH 1WFGA 1G37A 1EP5A 5FAHA 4DIIH 3BTME 4BNRA 2ZGXH 2VVCA 1AN1E 1KXAA 3QDOA 1MKWK 1TONA 3DJ1A 3LGVA 3M3VA 1X6DA 2CN0H 1A3BH 1FLEE 1GJ9B 1N6XA 1SMFE 2ZU4A 1FDPA 1D4PB 2GCTB 2XWAA 1QQ4A 2PGBB 2PKSB 1C5YB 2FO9A 2VH6A 1Q3PA 1GI1A 1MZAA 3U8TH 1E37B 4DW2U 1ZTLA 1BTXA 1T8LA 4YYXA 2BQ6B 2F83A 2H6MA 1XKBC 1O2WA 2EI7A 1ELDE 2GP9B 1IQIA 1B0EA 3SNAA 1C9PA 3LIWA 1EPTA 4JOJA 1XM1A 1CT4E 1FY1A 5K0HA 3DORA 4OS7A 1GBAA 1GL0E 4YDPA 3PLKA 4CR5A 6CHAC 2ANWA 3TNTA 4XE4A 1DY9A 4QT8C 3A85A 1EB2A 1GJCB 2GEFA 1ZMLA 1BOQA 1KYNA 3ODDA 3QK1A 1DXWA 1P03A 3QGLA 5H4IB 1Z71A 5FHTA 3KDKA 2QXHA 3FZDA 1EAWA 1UHBB 1W11U 3SU3A 1KLTA 4X8VH 2AINA 2FOBA 2WUBA 4SGAE 2V6NA 4YLUA 4AG2A 4ZXYH 5HJ1A 1NT1A 3I78A 1OBZA 2IOTA 2ZU1A 2JILA 2ODYB 2QA9E 1MTNB 4NMRA 4K2YA 1TAWA 1FC6A 1UJVA 1NC6A 1EZSC 2TGTA 4I7YH 1UVSH 3TGKE 1OBXA 3ZVDA 3M61U 4X1SU 1S0QA 1CGJE 1Y5BT 5T3HA 1BT7A 3DJAA 1BRAA 3EA8A 3S7HB 4NWKA 3TITA 2VGCB 3RXRA 4INHA 2EI8A 4NZLA 4ZH8A 1O2SA 1K1JA 4WVPE 1K2I1 1S0RA 3ZZBA 4L8NA 1UJ1A 1RJXB 1VB7A 1UJUA 1CSOE 2A7CA 1GVLA 1P2MA 1F7ZA 3PV4A 4FUJA 3ZVEA 1O5FH 1VJ9U 2VIQA 3BN9A 2DJTA 1SQAA 1N7TA 1JWTA 1EJNA 1UTPA 1UO6A 2KL1A 2Y6TA 1EAUA 1O2QA 2XBVA 6ESTA 1SQOA 1GVKB 3RDZA 3OSYA 2HE4A 4I33A 1YPJH 2FEQH 1GI4A 4AYYB 2DLSA 2F3CE 1HIAA 1T4VH 3QJMA 1C2MA 1QB9A 2ZDLA 2JREA 1CT0E 2I4SA 3QE1A 1N6EA 4K72A 2VIVA 3DFJA 2IJOB 1GCDA 5GJ4B 1N6FA 1HXEH 2FZZA 2PR3A 3ITIA 3KZEA 2ASUB 1GMDF 3LH3A 4SGBE 3LGTA 3U1JB 2VINA 1QFKH 1O39A 3UNSA 3U8RH 2D8IA 1K1PA 1UCYH 4Y6DA 2BVXH 4UU5A 4WWYA 3A88A 3A81A 3PS4A 1PPZA 1TB6H 2XCFA 3URCA 1YCPK 1QBOA 3EGKH 3B8JA 3T5FH 4WXIA 4K60A 3AW1A 2OUAA 1DWBH 2Z9GA 5ETXA 3U1IB 1SGPE 1MC7A 4YZUA 1EZUC 2BVRH 3GOVB 1ACBE 1SFIA 2G8TA 9LPRA