4Q2NA

Inadl pdz3 in complex with a phage-derived peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
93
Chain Sequence
SHMETYNVELVRKDGQSLGIRIVGYSGIYVKSIIPGSAAYHNGHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRGGGWFLDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords InaD-like protein
publication title A structural portrait of the PDZ domain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 93
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4q2nA00
1UFXA 4UU6A 1WJLA 1OBXA 2KOHA 2IWOA 5I7ZA 3O46A 4JL7A 3CBXA 3CYYA 2ZPMA 4E3BA 1OZIA 1WI2A 4FGMA 1I16A 4WYUA 4RI0A 2VWRA 2KYLA 3HPMA 4K75A 2JREA 4NMSA 1ZUBA 4JOHA 2DC2A 3GCNA 1VA8A 1Y8TA 2GZVA 1YBOA 2PKUA 4NNLA 3RL7A 3DIWA 1Y7NA 2L97A 2ZPLA 2PNTA 1WI4A 2DM8A 1U3BA 1B8QA 1SOTA 3ID4A 3HPKA 1RY4A 5HFCA 2KQFA 1QLCA 1Z87A 3VQFA 2DLSA 2LUIA 2I4SA 3QO6A 4P0CA 2AWUA 5G1DA 2KJPA 3L4FD 2DMZA 3TMHA 4K78A 2I0LA 3STJA 2K20A 3NFLA 4NNMA 2Z17A 4PQWA 2PA1A 2DJTA 2EV8A 5HF4A 2JIKA 2QKVA 3NFKA 3RL8A 1D5GA 2EEGA 1GQ4A 2H3MA 3ID3A 2DLUA 3GGEA 5HETA 3O5NA 1I92A 5FHTA 2KPLA 2I1NA 1V5QA 1X5QA 2KRGA 3RLEA 4AMHA 5F67A 5HFEA 4NMQA 4Q2QA 3NGHA 1N7FA 2O2TA 2Q3GA 1N7EA 5A2PA 1U39A 3CH8A 3I1EA 5E22A 3KHFA 3TSWA 3GCOA 2HE2A 3OTPA 4MPAA 5E21A 2K1ZA 1X6DA 2KAWA 2G2LA 2QBWA 3K50A 2LC6A 2VZ5A 1UM1A 1TP5A 5H3JA 3GDUA 5EZ0A 1UF1A 2M10A 2JXOA 2DAZA 2JOAA 4JOEA 3PDVA 2R4HA 3K82A 1UM7A 3R68A 3QDOA 4Q6HA 1W9QA 3DJ1A 1NTEA 2PZDA 2LOBA 1FC6A 5GNDA 1WHDA 3AXAA 3LNYA 2KA9A 3TSZA 2BYGA 3R69A 1UHPA 2KG2A 2LC7A 3ID2A 4R2ZA 1GM1A 1Z86A 4YYXA 2MHOA 5HEYA 3QIKA 1FC9A 3GSLA 2VSVA 2H2BA 2HE4A 4REYA 1V1TA 2JWEA 3WKLA 1RGWA 4KFVA 2KPKA 4K72A 5HFDA 2OSGA 2PKTA 2PDZA 3TSVA 2FN5A 4K6YA 1WF8A 1U38A 3EGHC 3K1RA 3PDZA 2QKTA 2YT8A 3GJ9A 2CS5A 1UJUA 2FCFA 2LA8A 4E34A 3DJ3A 2V1WA 2OQSA 3ID1A 2JILA 1X8SA 1X45A 3JXTA 1IU2A 1OBZA 1WHAA 4LMMA 1P1EA 1WF7A 2JINA 2KJKA 5G1EA 4NXRA 1OBYA 3SHUA 5HF1A 1NF3C 1UEWA 1WFVA 2QG1A 4UU5A 3BPUA 1LCYA 2KV8A 2YT7A 4GHNA 2L4SA 3CC0A 2OPGA 3QJNA 2M0VA 2D8IA 5F3XA 2EEHA 1XZ9A 2CSJA 2W7RA 2AWWA 3SOEA 1BE9A 4Z8JA 4OEPA 2QKUA 2AINA 5D13A 4JOGA 1FC7A 4P2AB 2DKRA 5JXBA 2ENOA 3KZEA 2EGOA 4K76A 2KOMA 2RRMA 5HFFA 4JOPA 2EJYA 1Q3OA 5HEBA 3ZRTA 5HEDA 1GQ5A 1UJDA 2AWXA 2IWQA 4NMOA 3DORA 1TQ3A 2KOJA 2IWNA 1BFEA 1VB7A 3VQGA 2EEJA 4Q6SA 1X5NA 3R0HA 2M3MA 3CBYA 1MC7A 3LNXA 2OS6A 2X7ZA 2R3YA 2D90A 2MX6A 1WH1A 2EDVA 2H3LA 2EXGA 4GVDA 5HDYA 2KJDA 3WKMA 2P3WA 1PDRA 1UJVA 4JOKA 3DJAA 2VSPA 3PS4A 1QAVA 4HOPA 3MH7A 2EDPA 1K32A 2KBSA 3PV5A 1RGRA 2EAQA 2EGKA 2M0TA 1TE0A 4JORA 2Q9VA 1WG6A 3I18A 1TP3A 4Q3HA 5FB8C 2YTWA 4Q2OA 1W9OA 1Q7XA 1WIFA 1RZXA 4XHVA 5E6PB 1N6DA 4Q2PA 2OGPA 2Z9IA 5B6LA 4Z33A 2HGAA 2EDZA 3GDVA 4OAJA 2FNEA 2I6VA 4YDPA 2EHRA 2EEIA 1V5LA 1FCFA 4N6XA 1UEPA 2W4FA 2DB5A 1QAVB 4HOPB 3FY5A 3PV2A 2G5MB 2IWPA 1V62A 5EYZA 1W9EA 3OU0A 3B76A 2CSSA 1N99A 4NMRA 5E11A 1T2MA 2OMJA 3QGLA 1VCWA 1MFGA 1N7TA 2REYA 4H11A 2WL7A 1IU0A 4NMTA 3CBZA 4F8KA 2UZCA 3KZDA 3SHWA 1X5RA 1Q3PA 3PV4A 4O06A 5HFBA 2I0IA 1UITA 2RCZA 1G9OA 5E1YA 4NMVA 2YUYA 1R6JA 1N6EA 2F5YA 1KWAA 1UEQA 4NMPA 1IHJA 3GDSA 1KEFA 1M5ZA 1VJ6A 2YUBA 3SFJA 1L6OA 2VPHA 2H2CA 3MH4A 1SOZA 4GVCA 2OCSA 4WYTA 4JOJA 4OEOA 3I4WA 2M0UA 1MFLA 4NXQA 4E35A 2EGNA 1N6FA 1VAEA 3SUZA 5GLJA 1UEZA 4G69A 4JOFA 1WFGA 4L8NA 2F0AA 2OZFA 1QAUA 1P1DA 2I04A 3QE1A 3HVQC 2FE5A 1V6BA 2VRFA 1ZOKA 3QJMA 4Q2NA 4EDJA 5HJ1A 4KFWA 3E17A 3MH6A 5DTHA 3EGGC 1KY9A 2D92A 1U37A 2KL1A 2E7KA 2M0ZA 4NXPA 2V90A 4IC6A 3CS0A 2L4TA 2QT5A
chains in the Genus database with same CATH superfamily
1UFXA 4UU6A 1WJLA 1OBXA 2KOHA 2IWOA 5I7ZA 3O46A 4JL7A 3CBXA 3CYYA 2ZPMA 4E3BA 1OZIA 1WI2A 4FGMA 1I16A 4WYUA 4RI0A 2VWRA 2KYLA 3HPMA 3KDGA 4K75A 2JREA 4NMSA 1ZUBA 4JOHA 5ILBA 2DC2A 3GCNA 1VA8A 1Y8TA 2GZVA 1YBOA 2PKUA 4NNLA 3RL7A 3DIWA 1Y7NA 2L97A 2ZPLA 2PNTA 1WI4A 2DM8A 1U3BA 1B8QA 1SOTA 3ID4A 3HPKA 1RY4A 5HFCA 2KQFA 1QLCA 1Z87A 3VQFA 2DLSA 2LUIA 2I4SA 3QO6A 4P0CA 2AWUA 5G1DA 2KJPA 3L4FD 2DMZA 3TMHA 4K78A 2I0LA 3STJA 2K20A 3NFLA 3KDKA 4NNMA 2Z17A 4PQWA 2PA1A 2DJTA 2EV8A 5HF4A 2JIKA 2QKVA 3NFKA 3RL8A 1D5GA 2EEGA 1GQ4A 2H3MA 3ID3A 2DLUA 3GGEA 5HETA 3O5NA 1I92A 5FHTA 2KPLA 2I1NA 1V5QA 1X5QA 2KRGA 3RLEA 4AMHA 5F67A 5HFEA 4NMQA 4Q2QA 3NGHA 1N7FA 2O2TA 2Q3GA 1N7EA 5A2PA 1U39A 3CH8A 3I1EA 5E22A 3KHFA 3TSWA 3GCOA 2HE2A 3OTPA 4MPAA 5E21A 2K1ZA 1X6DA 2KAWA 2G2LA 2QBWA 3K50A 2LC6A 2VZ5A 1UM1A 1TP5A 5H3JA 3GDUA 5EZ0A 1UF1A 2M10A 2JXOA 2DAZA 2JOAA 4JOEA 3PDVA 2R4HA 3K82A 1UM7A 3R68A 3QDOA 4Q6HA 1W9QA 3DJ1A 1NTEA 2PZDA 2LOBA 1FC6A 5GNDA 1WHDA 3AXAA 3LNYA 2KA9A 3TSZA 2BYGA 3R69A 1UHPA 2KG2A 2LC7A 3ID2A 4R2ZA 1GM1A 1Z86A 4YYXA 2MHOA 5HEYA 3QIKA 1FC9A 3GSLA 2VSVA 2H2BA 2HE4A 4REYA 1V1TA 2JWEA 3WKLA 1RGWA 4KFVA 2KPKA 4K72A 5HFDA 2OSGA 2PKTA 2PDZA 3TSVA 2FN5A 4K6YA 1WF8A 1U38A 3EGHC 3K1RA 3PDZA 2QKTA 2YT8A 3GJ9A 2CS5A 1UJUA 2FCFA 2LA8A 4E34A 3DJ3A 2V1WA 2OQSA 3ID1A 2JILA 1X8SA 1X45A 3JXTA 1IU2A 1OBZA 1WHAA 4LMMA 1P1EA 1WF7A 2JINA 2KJKA 5G1EA 2JSNA 4NXRA 1OBYA 3SHUA 5HF1A 1NF3C 1UEWA 1WFVA 2QG1A 4UU5A 3BPUA 1LCYA 2KV8A 2YT7A 4GHNA 2L4SA 3CC0A 2OPGA 3QJNA 2M0VA 2D8IA 5F3XA 2EEHA 1XZ9A 3GABA 2CSJA 2W7RA 2AWWA 3SOEA 1BE9A 4Z8JA 4OEPA 2QKUA 2AINA 5D13A 4JOGA 1FC7A 4P2AB 2DKRA 5JXBA 2ENOA 3KZEA 2EGOA 4K76A 2KOMA 2RRMA 5HFFA 4JOPA 2EJYA 1Q3OA 5HEBA 3ZRTA 5HEDA 1GQ5A 4JJ3A 1UJDA 2AWXA 2IWQA 4NMOA 3DORA 1TQ3A 2KOJA 2IWNA 3NCVA 1BFEA 1VB7A 3VQGA 2EEJA 4Q6SA 1X5NA 3R0HA 2M3MA 3CBYA 1MC7A 3LNXA 2OS6A 2X7ZA 4JJ0A 2R3YA 2D90A 2MX6A 1WH1A 2EDVA 2H3LA 2EXGA 4GVDA 5HDYA 2KJDA 3WKMA 2P3WA 1PDRA 1UJVA 4JOKA 4FLNA 3DJAA 2VSPA 3PS4A 1QAVA 4HOPA 3MH7A 2EDPA 1K32A 2KBSA 3PV5A 1RGRA 2EAQA 2EGKA 2M0TA 1TE0A 4JORA 2Q9VA 1WG6A 3I18A 1TP3A 4Q3HA 5FB8C 2YTWA 4Q2OA 1W9OA 1Q7XA 1WIFA 1RZXA 4XHVA 5E6PB 1N6DA 4Q2PA 2OGPA 2Z9IA 5B6LA 4Z33A 2HGAA 2EDZA 3GDVA 4OAJA 2FNEA 2I6VA 4YDPA 2EHRA 2EEIA 1V5LA 1FCFA 4N6XA 1UEPA 2W4FA 2DB5A 1QAVB 4HOPB 3FY5A 3PV2A 2G5MB 2IWPA 1V62A 5EYZA 1W9EA 3OU0A 3B76A 2CSSA 1N99A 4NMRA 5E11A 1T2MA 2OMJA 3QGLA 1VCWA 1MFGA 1N7TA 2REYA 4H11A 2WL7A 1IU0A 4NMTA 3CBZA 2GEFA 4F8KA 2UZCA 3KZDA 3SHWA 1X5RA 1Q3PA 3PV4A 1X9ZA 4O06A 5HFBA 2I0IA 1UITA 2RCZA 1G9OA 5E1YA 4NMVA 2YUYA 5B42A 1R6JA 1N6EA 2F5YA 1KWAA 1UEQA 4NMPA 1IHJA 3GDSA 1KEFA 1M5ZA 1VJ6A 2YUBA 3SFJA 1L6OA 2VPHA 2H2CA 3MH4A 1SOZA 4GVCA 2OCSA 4WYTA 4JOJA 4OEOA 3I4WA 2M0UA 1MFLA 4NXQA 4E35A 2EGNA 1N6FA 1VAEA 3SUZA 5GLJA 1UEZA 4G69A 4JOFA 1WFGA 4L8NA 2F0AA 2OZFA 1QAUA 1P1DA 2I04A 3QE1A 3HVQC 2FE5A 5IL9A 1V6BA 2VRFA 1ZOKA 3QJMA 4Q2NA 4EDJA 5HJ1A 4KFWA 3E17A 3MH6A 5DTHA 3EGGC 1KY9A 2D92A 1U37A 2KL1A 2E7KA 2M0ZA 4NXPA 2V90A 4IC6A 3CS0A 2L4TA 2QT5A
chains in the Genus database with same CATH topology
1UFXA 4UU6A 1WJLA 1OBXA 2KOHA 2IWOA 5I7ZA 3O46A 4JL7A 3CBXA 3CYYA 2ZPMA 4E3BA 1OZIA 1WI2A 4FGMA 1I16A 4WYUA 4RI0A 2VWRA 2KYLA 3HPMA 3KDGA 4K75A 2JREA 4NMSA 1ZUBA 4JOHA 5ILBA 2DC2A 3GCNA 1VA8A 1Y8TA 2GZVA 1YBOA 2PKUA 4NNLA 3RL7A 3DIWA 1Y7NA 2L97A 2ZPLA 2PNTA 1WI4A 2DM8A 1U3BA 1B8QA 1SOTA 3ID4A 3HPKA 1RY4A 5HFCA 2KQFA 1QLCA 1Z87A 3VQFA 2DLSA 2LUIA 2I4SA 3QO6A 4P0CA 2AWUA 5G1DA 2KJPA 3L4FD 2DMZA 3TMHA 4K78A 2I0LA 3STJA 2K20A 3NFLA 3KDKA 4NNMA 2Z17A 4PQWA 2PA1A 2DJTA 2EV8A 5HF4A 2JIKA 2QKVA 3NFKA 3RL8A 1D5GA 2EEGA 1GQ4A 2H3MA 3ID3A 2DLUA 3GGEA 5HETA 3O5NA 1I92A 5FHTA 2KPLA 2I1NA 1V5QA 1X5QA 2KRGA 3RLEA 4AMHA 5F67A 5HFEA 4NMQA 4Q2QA 3NGHA 1N7FA 2O2TA 2Q3GA 1N7EA 5A2PA 1U39A 3CH8A 3I1EA 5E22A 3KHFA 3TSWA 3GCOA 2HE2A 3OTPA 4MPAA 5E21A 2K1ZA 1X6DA 2KAWA 2G2LA 2QBWA 3K50A 2LC6A 2VZ5A 1UM1A 1TP5A 5H3JA 3GDUA 5EZ0A 1UF1A 2M10A 2JXOA 2DAZA 2JOAA 4JOEA 3PDVA 2R4HA 3K82A 1UM7A 3R68A 3QDOA 4Q6HA 1W9QA 3DJ1A 1NTEA 2PZDA 2LOBA 1FC6A 5GNDA 1WHDA 3AXAA 3LNYA 2KA9A 3TSZA 2BYGA 3R69A 1UHPA 2KG2A 2LC7A 3ID2A 4R2ZA 1GM1A 1Z86A 4YYXA 2MHOA 5HEYA 3QIKA 1FC9A 3GSLA 2VSVA 2H2BA 2HE4A 4REYA 1V1TA 2JWEA 3WKLA 1RGWA 4KFVA 2KPKA 4K72A 5HFDA 2OSGA 2PKTA 2PDZA 3TSVA 2FN5A 4K6YA 1WF8A 1U38A 3EGHC 3K1RA 3PDZA 2QKTA 2YT8A 3GJ9A 2CS5A 1UJUA 2FCFA 2LA8A 4E34A 3DJ3A 2V1WA 2OQSA 3ID1A 2JILA 1X8SA 1X45A 3JXTA 1IU2A 1OBZA 1WHAA 4LMMA 1P1EA 1WF7A 2JINA 2KJKA 5G1EA 2JSNA 4NXRA 1OBYA 3SHUA 5HF1A 1NF3C 1UEWA 1WFVA 2QG1A 4UU5A 3BPUA 1LCYA 2KV8A 2YT7A 4GHNA 2L4SA 3CC0A 2OPGA 3QJNA 2M0VA 2D8IA 5F3XA 2EEHA 1XZ9A 3GABA 2CSJA 2W7RA 2AWWA 3SOEA 1BE9A 4Z8JA 4OEPA 2QKUA 2AINA 5D13A 4JOGA 1FC7A 4P2AB 2DKRA 5JXBA 2ENOA 3KZEA 2EGOA 4K76A 2KOMA 2RRMA 5HFFA 4JOPA 2EJYA 1Q3OA 5HEBA 3ZRTA 5HEDA 1GQ5A 4JJ3A 1UJDA 2AWXA 2IWQA 4NMOA 3DORA 1TQ3A 2KOJA 2IWNA 3NCVA 1BFEA 1VB7A 3VQGA 2EEJA 4Q6SA 1X5NA 3R0HA 2M3MA 3CBYA 1MC7A 3LNXA 2OS6A 2X7ZA 4JJ0A 2R3YA 2D90A 2MX6A 1WH1A 2EDVA 2H3LA 2EXGA 4GVDA 5HDYA 2KJDA 3WKMA 2P3WA 1PDRA 1UJVA 4JOKA 4FLNA 3DJAA 2VSPA 3PS4A 1QAVA 4HOPA 3MH7A 2EDPA 1K32A 2KBSA 3PV5A 1RGRA 2EAQA 2EGKA 2M0TA 1TE0A 4JORA 2Q9VA 1WG6A 3I18A 1TP3A 4Q3HA 5FB8C 2YTWA 4Q2OA 1W9OA 1Q7XA 1WIFA 1RZXA 4XHVA 5E6PB 1N6DA 4Q2PA 2OGPA 2Z9IA 5B6LA 4Z33A 2HGAA 2EDZA 3GDVA 4OAJA 2FNEA 2I6VA 4YDPA 2EHRA 2EEIA 1V5LA 1FCFA 4N6XA 1UEPA 2W4FA 2DB5A 1QAVB 4HOPB 3FY5A 3PV2A 2G5MB 2IWPA 1V62A 5EYZA 1W9EA 3OU0A 3B76A 2CSSA 1N99A 4NMRA 5E11A 1T2MA 2OMJA 3QGLA 1VCWA 1MFGA 1N7TA 2REYA 4H11A 2WL7A 1IU0A 4NMTA 3CBZA 2GEFA 4F8KA 2UZCA 3KZDA 3SHWA 1X5RA 1Q3PA 3PV4A 1X9ZA 4O06A 5HFBA 2I0IA 1UITA 2RCZA 1G9OA 5E1YA 4NMVA 2YUYA 5B42A 1R6JA 1N6EA 2F5YA 1KWAA 1UEQA 4NMPA 1IHJA 3GDSA 1KEFA 1M5ZA 1VJ6A 2YUBA 3SFJA 1L6OA 2VPHA 2H2CA 3MH4A 1SOZA 4GVCA 2OCSA 4WYTA 4JOJA 4OEOA 3I4WA 2M0UA 1MFLA 4NXQA 4E35A 2EGNA 1N6FA 1VAEA 3SUZA 5GLJA 1UEZA 4G69A 4JOFA 1WFGA 4L8NA 2F0AA 2OZFA 1QAUA 1P1DA 2I04A 3QE1A 3HVQC 2FE5A 5IL9A 1V6BA 2VRFA 1ZOKA 3QJMA 4Q2NA 4EDJA 5HJ1A 4KFWA 3E17A 3MH6A 5DTHA 3EGGC 1KY9A 2D92A 1U37A 2KL1A 2E7KA 2M0ZA 4NXPA 2V90A 4IC6A 3CS0A 2L4TA 2QT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFX A;  4UU6 A;  1WJL A;  1OBX A;  2KOH A;  2IWO A;  5I7Z A;  3O46 A;  4JL7 A;  3CBX A;  3CYY A;  2ZPM A;  4E3B A;  1OZI A;  1WI2 A;  4FGM A;  1I16 A;  4WYU A;  4RI0 A;  2VWR A;  2KYL A;  3HPM A;  4K75 A;  2JRE A;  4NMS A;  1ZUB A;  4JOH A;  2DC2 A;  3GCN A;  1VA8 A;  1Y8T A;  2GZV A;  1YBO A;  2PKU A;  4NNL A;  3RL7 A;  3DIW A;  1Y7N A;  2L97 A;  2ZPL A;  2PNT A;  1WI4 A;  2DM8 A;  1U3B A;  1B8Q A;  1SOT A;  3ID4 A;  3HPK A;  1RY4 A;  5HFC A;  2KQF A;  1QLC A;  1Z87 A;  3VQF A;  2DLS A;  2LUI A;  2I4S A;  3QO6 A;  4P0C A;  2AWU A;  5G1D A;  2KJP A;  3L4F D;  2DMZ A;  3TMH A;  4K78 A;  2I0L A;  3STJ A;  2K20 A;  3NFL A;  4NNM A;  2Z17 A;  4PQW A;  2PA1 A;  2DJT A;  2EV8 A;  5HF4 A;  2JIK A;  2QKV A;  3NFK A;  3RL8 A;  1D5G A;  2EEG A;  1GQ4 A;  2H3M A;  3ID3 A;  2DLU A;  3GGE A;  5HET A;  3O5N A;  1I92 A;  5FHT A;  2KPL A;  2I1N A;  1V5Q A;  1X5Q A;  2KRG A;  3RLE A;  4AMH A;  5F67 A;  5HFE A;  4NMQ A;  4Q2Q A;  3NGH A;  1N7F A;  2O2T A;  2Q3G A;  1N7E A;  5A2P A;  1U39 A;  3CH8 A;  3I1E A;  5E22 A;  3KHF A;  3TSW A;  3GCO A;  2HE2 A;  3OTP A;  4MPA A;  5E21 A;  2K1Z A;  1X6D A;  2KAW A;  2G2L A;  2QBW A;  3K50 A;  2LC6 A;  2VZ5 A;  1UM1 A;  1TP5 A;  5H3J A;  3GDU A;  5EZ0 A;  1UF1 A;  2M10 A;  2JXO A;  2DAZ A;  2JOA A;  4JOE A;  3PDV A;  2R4H A;  3K82 A;  1UM7 A;  3R68 A;  3QDO A;  4Q6H A;  1W9Q A;  3DJ1 A;  1NTE A;  2PZD A;  2LOB A;  1FC6 A;  5GND A;  1WHD A;  3AXA A;  3LNY A;  2KA9 A;  3TSZ A;  2BYG A;  3R69 A;  1UHP A;  2KG2 A;  2LC7 A;  3ID2 A;  4R2Z A;  1GM1 A;  1Z86 A;  4YYX A;  2MHO A;  5HEY A;  3QIK A;  1FC9 A;  3GSL A;  2VSV A;  2H2B A;  2HE4 A;  4REY A;  1V1T A;  2JWE A;  3WKL A;  1RGW A;  4KFV A;  2KPK A;  4K72 A;  5HFD A;  2OSG A;  2PKT A;  2PDZ A;  3TSV A;  2FN5 A;  4K6Y A;  1WF8 A;  1U38 A;  3EGH C;  3K1R A;  3PDZ A;  2QKT A;  2YT8 A;  3GJ9 A;  2CS5 A;  1UJU A;  2FCF A;  2LA8 A;  4E34 A;  3DJ3 A;  2V1W A;  2OQS A;  3ID1 A;  2JIL A;  1X8S A;  1X45 A;  3JXT A;  1IU2 A;  1OBZ A;  1WHA A;  4LMM A;  1P1E A;  1WF7 A;  2JIN A;  2KJK A;  5G1E A;  4NXR A;  1OBY A;  3SHU A;  5HF1 A;  1NF3 C;  1UEW A;  1WFV A;  2QG1 A;  4UU5 A;  3BPU A;  1LCY A;  2KV8 A;  2YT7 A;  4GHN A;  2L4S A;  3CC0 A;  2OPG A;  3QJN A;  2M0V A;  2D8I A;  5F3X A;  2EEH A;  1XZ9 A;  2CSJ A;  2W7R A;  2AWW A;  3SOE A;  1BE9 A;  4Z8J A;  4OEP A;  2QKU A;  2AIN A;  5D13 A;  4JOG A;  1FC7 A;  4P2A B;  2DKR A;  5JXB A;  2ENO A;  3KZE A;  2EGO A;  4K76 A;  2KOM A;  2RRM A;  5HFF A;  4JOP A;  2EJY A;  1Q3O A;  5HEB A;  3ZRT A;  5HED A;  1GQ5 A;  1UJD A;  2AWX A;  2IWQ A;  4NMO A;  3DOR A;  1TQ3 A;  2KOJ A;  2IWN A;  1BFE A;  1VB7 A;  3VQG A;  2EEJ A;  4Q6S A;  1X5N A;  3R0H A;  2M3M A;  3CBY A;  1MC7 A;  3LNX A;  2OS6 A;  2X7Z A;  2R3Y A;  2D90 A;  2MX6 A;  1WH1 A;  2EDV A;  2H3L A;  2EXG A;  4GVD A;  5HDY A;  2KJD A;  3WKM A;  2P3W A;  1PDR A;  1UJV A;  4JOK A;  3DJA A;  2VSP A;  3PS4 A;  1QAV A;  4HOP A;  3MH7 A;  2EDP A;  1K32 A;  2KBS A;  3PV5 A;  1RGR A;  2EAQ A;  2EGK A;  2M0T A;  1TE0 A;  4JOR A;  2Q9V A;  1WG6 A;  3I18 A;  1TP3 A;  4Q3H A;  5FB8 C;  2YTW A;  4Q2O A;  1W9O A;  1Q7X A;  1WIF A;  1RZX A;  4XHV A;  5E6P B;  1N6D A;  4Q2P A;  2OGP A;  2Z9I A;  5B6L A;  4Z33 A;  2HGA A;  2EDZ A;  3GDV A;  4OAJ A;  2FNE A;  2I6V A;  4YDP A;  2EHR A;  2EEI A;  1V5L A;  1FCF A;  4N6X A;  1UEP A;  2W4F A;  2DB5 A;  1QAV B;  4HOP B;  3FY5 A;  3PV2 A;  2G5M B;  2IWP A;  1V62 A;  5EYZ A;  1W9E A;  3OU0 A;  3B76 A;  2CSS A;  1N99 A;  4NMR A;  5E11 A;  1T2M A;  2OMJ A;  3QGL A;  1VCW A;  1MFG A;  1N7T A;  2REY A;  4H11 A;  2WL7 A;  1IU0 A;  4NMT A;  3CBZ A;  4F8K A;  2UZC A;  3KZD A;  3SHW A;  1X5R A;  1Q3P A;  3PV4 A;  4O06 A;  5HFB A;  2I0I A;  1UIT A;  2RCZ A;  1G9O A;  5E1Y A;  4NMV A;  2YUY A;  1R6J A;  1N6E A;  2F5Y A;  1KWA A;  1UEQ A;  4NMP A;  1IHJ A;  3GDS A;  1KEF A;  1M5Z A;  1VJ6 A;  2YUB A;  3SFJ A;  1L6O A;  2VPH A;  2H2C A;  3MH4 A;  1SOZ A;  4GVC A;  2OCS A;  4WYT A;  4JOJ A;  4OEO A;  3I4W A;  2M0U A;  1MFL A;  4NXQ A;  4E35 A;  2EGN A;  1N6F A;  1VAE A;  3SUZ A;  5GLJ A;  1UEZ A;  4G69 A;  4JOF A;  1WFG A;  4L8N A;  2F0A A;  2OZF A;  1QAU A;  1P1D A;  2I04 A;  3QE1 A;  3HVQ C;  2FE5 A;  1V6B A;  2VRF A;  1ZOK A;  3QJM A;  4Q2N A;  4EDJ A;  5HJ1 A;  4KFW A;  3E17 A;  3MH6 A;  5DTH A;  3EGG C;  1KY9 A;  2D92 A;  1U37 A;  2KL1 A;  2E7K A;  2M0Z A;  4NXP A;  2V90 A;  4IC6 A;  3CS0 A;  2L4T A;  2QT5 A; 
#chains in the Genus database with same CATH topology
 1UFX A;  4UU6 A;  1WJL A;  1OBX A;  2KOH A;  2IWO A;  5I7Z A;  3O46 A;  4JL7 A;  3CBX A;  3CYY A;  2ZPM A;  4E3B A;  1OZI A;  1WI2 A;  4FGM A;  1I16 A;  4WYU A;  4RI0 A;  2VWR A;  2KYL A;  3HPM A;  3KDG A;  4K75 A;  2JRE A;  4NMS A;  1ZUB A;  4JOH A;  5ILB A;  2DC2 A;  3GCN A;  1VA8 A;  1Y8T A;  2GZV A;  1YBO A;  2PKU A;  4NNL A;  3RL7 A;  3DIW A;  1Y7N A;  2L97 A;  2ZPL A;  2PNT A;  1WI4 A;  2DM8 A;  1U3B A;  1B8Q A;  1SOT A;  3ID4 A;  3HPK A;  1RY4 A;  5HFC A;  2KQF A;  1QLC A;  1Z87 A;  3VQF A;  2DLS A;  2LUI A;  2I4S A;  3QO6 A;  4P0C A;  2AWU A;  5G1D A;  2KJP A;  3L4F D;  2DMZ A;  3TMH A;  4K78 A;  2I0L A;  3STJ A;  2K20 A;  3NFL A;  3KDK A;  4NNM A;  2Z17 A;  4PQW A;  2PA1 A;  2DJT A;  2EV8 A;  5HF4 A;  2JIK A;  2QKV A;  3NFK A;  3RL8 A;  1D5G A;  2EEG A;  1GQ4 A;  2H3M A;  3ID3 A;  2DLU A;  3GGE A;  5HET A;  3O5N A;  1I92 A;  5FHT A;  2KPL A;  2I1N A;  1V5Q A;  1X5Q A;  2KRG A;  3RLE A;  4AMH A;  5F67 A;  5HFE A;  4NMQ A;  4Q2Q A;  3NGH A;  1N7F A;  2O2T A;  2Q3G A;  1N7E A;  5A2P A;  1U39 A;  3CH8 A;  3I1E A;  5E22 A;  3KHF A;  3TSW A;  3GCO A;  2HE2 A;  3OTP A;  4MPA A;  5E21 A;  2K1Z A;  1X6D A;  2KAW A;  2G2L A;  2QBW A;  3K50 A;  2LC6 A;  2VZ5 A;  1UM1 A;  1TP5 A;  5H3J A;  3GDU A;  5EZ0 A;  1UF1 A;  2M10 A;  2JXO A;  2DAZ A;  2JOA A;  4JOE A;  3PDV A;  2R4H A;  3K82 A;  1UM7 A;  3R68 A;  3QDO A;  4Q6H A;  1W9Q A;  3DJ1 A;  1NTE A;  2PZD A;  2LOB A;  1FC6 A;  5GND A;  1WHD A;  3AXA A;  3LNY A;  2KA9 A;  3TSZ A;  2BYG A;  3R69 A;  1UHP A;  2KG2 A;  2LC7 A;  3ID2 A;  4R2Z A;  1GM1 A;  1Z86 A;  4YYX A;  2MHO A;  5HEY A;  3QIK A;  1FC9 A;  3GSL A;  2VSV A;  2H2B A;  2HE4 A;  4REY A;  1V1T A;  2JWE A;  3WKL A;  1RGW A;  4KFV A;  2KPK A;  4K72 A;  5HFD A;  2OSG A;  2PKT A;  2PDZ A;  3TSV A;  2FN5 A;  4K6Y A;  1WF8 A;  1U38 A;  3EGH C;  3K1R A;  3PDZ A;  2QKT A;  2YT8 A;  3GJ9 A;  2CS5 A;  1UJU A;  2FCF A;  2LA8 A;  4E34 A;  3DJ3 A;  2V1W A;  2OQS A;  3ID1 A;  2JIL A;  1X8S A;  1X45 A;  3JXT A;  1IU2 A;  1OBZ A;  1WHA A;  4LMM A;  1P1E A;  1WF7 A;  2JIN A;  2KJK A;  5G1E A;  2JSN A;  4NXR A;  1OBY A;  3SHU A;  5HF1 A;  1NF3 C;  1UEW A;  1WFV A;  2QG1 A;  4UU5 A;  3BPU A;  1LCY A;  2KV8 A;  2YT7 A;  4GHN A;  2L4S A;  3CC0 A;  2OPG A;  3QJN A;  2M0V A;  2D8I A;  5F3X A;  2EEH A;  1XZ9 A;  3GAB A;  2CSJ A;  2W7R A;  2AWW A;  3SOE A;  1BE9 A;  4Z8J A;  4OEP A;  2QKU A;  2AIN A;  5D13 A;  4JOG A;  1FC7 A;  4P2A B;  2DKR A;  5JXB A;  2ENO A;  3KZE A;  2EGO A;  4K76 A;  2KOM A;  2RRM A;  5HFF A;  4JOP A;  2EJY A;  1Q3O A;  5HEB A;  3ZRT A;  5HED A;  1GQ5 A;  4JJ3 A;  1UJD A;  2AWX A;  2IWQ A;  4NMO A;  3DOR A;  1TQ3 A;  2KOJ A;  2IWN A;  3NCV A;  1BFE A;  1VB7 A;  3VQG A;  2EEJ A;  4Q6S A;  1X5N A;  3R0H A;  2M3M A;  3CBY A;  1MC7 A;  3LNX A;  2OS6 A;  2X7Z A;  4JJ0 A;  2R3Y A;  2D90 A;  2MX6 A;  1WH1 A;  2EDV A;  2H3L A;  2EXG A;  4GVD A;  5HDY A;  2KJD A;  3WKM A;  2P3W A;  1PDR A;  1UJV A;  4JOK A;  4FLN A;  3DJA A;  2VSP A;  3PS4 A;  1QAV A;  4HOP A;  3MH7 A;  2EDP A;  1K32 A;  2KBS A;  3PV5 A;  1RGR A;  2EAQ A;  2EGK A;  2M0T A;  1TE0 A;  4JOR A;  2Q9V A;  1WG6 A;  3I18 A;  1TP3 A;  4Q3H A;  5FB8 C;  2YTW A;  4Q2O A;  1W9O A;  1Q7X A;  1WIF A;  1RZX A;  4XHV A;  5E6P B;  1N6D A;  4Q2P A;  2OGP A;  2Z9I A;  5B6L A;  4Z33 A;  2HGA A;  2EDZ A;  3GDV A;  4OAJ A;  2FNE A;  2I6V A;  4YDP A;  2EHR A;  2EEI A;  1V5L A;  1FCF A;  4N6X A;  1UEP A;  2W4F A;  2DB5 A;  1QAV B;  4HOP B;  3FY5 A;  3PV2 A;  2G5M B;  2IWP A;  1V62 A;  5EYZ A;  1W9E A;  3OU0 A;  3B76 A;  2CSS A;  1N99 A;  4NMR A;  5E11 A;  1T2M A;  2OMJ A;  3QGL A;  1VCW A;  1MFG A;  1N7T A;  2REY A;  4H11 A;  2WL7 A;  1IU0 A;  4NMT A;  3CBZ A;  2GEF A;  4F8K A;  2UZC A;  3KZD A;  3SHW A;  1X5R A;  1Q3P A;  3PV4 A;  1X9Z A;  4O06 A;  5HFB A;  2I0I A;  1UIT A;  2RCZ A;  1G9O A;  5E1Y A;  4NMV A;  2YUY A;  5B42 A;  1R6J A;  1N6E A;  2F5Y A;  1KWA A;  1UEQ A;  4NMP A;  1IHJ A;  3GDS A;  1KEF A;  1M5Z A;  1VJ6 A;  2YUB A;  3SFJ A;  1L6O A;  2VPH A;  2H2C A;  3MH4 A;  1SOZ A;  4GVC A;  2OCS A;  4WYT A;  4JOJ A;  4OEO A;  3I4W A;  2M0U A;  1MFL A;  4NXQ A;  4E35 A;  2EGN A;  1N6F A;  1VAE A;  3SUZ A;  5GLJ A;  1UEZ A;  4G69 A;  4JOF A;  1WFG A;  4L8N A;  2F0A A;  2OZF A;  1QAU A;  1P1D A;  2I04 A;  3QE1 A;  3HVQ C;  2FE5 A;  5IL9 A;  1V6B A;  2VRF A;  1ZOK A;  3QJM A;  4Q2N A;  4EDJ A;  5HJ1 A;  4KFW A;  3E17 A;  3MH6 A;  5DTH A;  3EGG C;  1KY9 A;  2D92 A;  1U37 A;  2KL1 A;  2E7K A;  2M0Z A;  4NXP A;  2V90 A;  4IC6 A;  3CS0 A;  2L4T A;  2QT5 A; 
#chains in the Genus database with same CATH homology
 1UFX A;  4UU6 A;  1WJL A;  1OBX A;  2KOH A;  2IWO A;  5I7Z A;  3O46 A;  4JL7 A;  3CBX A;  3CYY A;  2ZPM A;  4E3B A;  1OZI A;  1WI2 A;  4FGM A;  1I16 A;  4WYU A;  4RI0 A;  2VWR A;  2KYL A;  3HPM A;  3KDG A;  4K75 A;  2JRE A;  4NMS A;  1ZUB A;  4JOH A;  5ILB A;  2DC2 A;  3GCN A;  1VA8 A;  1Y8T A;  2GZV A;  1YBO A;  2PKU A;  4NNL A;  3RL7 A;  3DIW A;  1Y7N A;  2L97 A;  2ZPL A;  2PNT A;  1WI4 A;  2DM8 A;  1U3B A;  1B8Q A;  1SOT A;  3ID4 A;  3HPK A;  1RY4 A;  5HFC A;  2KQF A;  1QLC A;  1Z87 A;  3VQF A;  2DLS A;  2LUI A;  2I4S A;  3QO6 A;  4P0C A;  2AWU A;  5G1D A;  2KJP A;  3L4F D;  2DMZ A;  3TMH A;  4K78 A;  2I0L A;  3STJ A;  2K20 A;  3NFL A;  3KDK A;  4NNM A;  2Z17 A;  4PQW A;  2PA1 A;  2DJT A;  2EV8 A;  5HF4 A;  2JIK A;  2QKV A;  3NFK A;  3RL8 A;  1D5G A;  2EEG A;  1GQ4 A;  2H3M A;  3ID3 A;  2DLU A;  3GGE A;  5HET A;  3O5N A;  1I92 A;  5FHT A;  2KPL A;  2I1N A;  1V5Q A;  1X5Q A;  2KRG A;  3RLE A;  4AMH A;  5F67 A;  5HFE A;  4NMQ A;  4Q2Q A;  3NGH A;  1N7F A;  2O2T A;  2Q3G A;  1N7E A;  5A2P A;  1U39 A;  3CH8 A;  3I1E A;  5E22 A;  3KHF A;  3TSW A;  3GCO A;  2HE2 A;  3OTP A;  4MPA A;  5E21 A;  2K1Z A;  1X6D A;  2KAW A;  2G2L A;  2QBW A;  3K50 A;  2LC6 A;  2VZ5 A;  1UM1 A;  1TP5 A;  5H3J A;  3GDU A;  5EZ0 A;  1UF1 A;  2M10 A;  2JXO A;  2DAZ A;  2JOA A;  4JOE A;  3PDV A;  2R4H A;  3K82 A;  1UM7 A;  3R68 A;  3QDO A;  4Q6H A;  1W9Q A;  3DJ1 A;  1NTE A;  2PZD A;  2LOB A;  1FC6 A;  5GND A;  1WHD A;  3AXA A;  3LNY A;  2KA9 A;  3TSZ A;  2BYG A;  3R69 A;  1UHP A;  2KG2 A;  2LC7 A;  3ID2 A;  4R2Z A;  1GM1 A;  1Z86 A;  4YYX A;  2MHO A;  5HEY A;  3QIK A;  1FC9 A;  3GSL A;  2VSV A;  2H2B A;  2HE4 A;  4REY A;  1V1T A;  2JWE A;  3WKL A;  1RGW A;  4KFV A;  2KPK A;  4K72 A;  5HFD A;  2OSG A;  2PKT A;  2PDZ A;  3TSV A;  2FN5 A;  4K6Y A;  1WF8 A;  1U38 A;  3EGH C;  3K1R A;  3PDZ A;  2QKT A;  2YT8 A;  3GJ9 A;  2CS5 A;  1UJU A;  2FCF A;  2LA8 A;  4E34 A;  3DJ3 A;  2V1W A;  2OQS A;  3ID1 A;  2JIL A;  1X8S A;  1X45 A;  3JXT A;  1IU2 A;  1OBZ A;  1WHA A;  4LMM A;  1P1E A;  1WF7 A;  2JIN A;  2KJK A;  5G1E A;  2JSN A;  4NXR A;  1OBY A;  3SHU A;  5HF1 A;  1NF3 C;  1UEW A;  1WFV A;  2QG1 A;  4UU5 A;  3BPU A;  1LCY A;  2KV8 A;  2YT7 A;  4GHN A;  2L4S A;  3CC0 A;  2OPG A;  3QJN A;  2M0V A;  2D8I A;  5F3X A;  2EEH A;  1XZ9 A;  3GAB A;  2CSJ A;  2W7R A;  2AWW A;  3SOE A;  1BE9 A;  4Z8J A;  4OEP A;  2QKU A;  2AIN A;  5D13 A;  4JOG A;  1FC7 A;  4P2A B;  2DKR A;  5JXB A;  2ENO A;  3KZE A;  2EGO A;  4K76 A;  2KOM A;  2RRM A;  5HFF A;  4JOP A;  2EJY A;  1Q3O A;  5HEB A;  3ZRT A;  5HED A;  1GQ5 A;  4JJ3 A;  1UJD A;  2AWX A;  2IWQ A;  4NMO A;  3DOR A;  1TQ3 A;  2KOJ A;  2IWN A;  3NCV A;  1BFE A;  1VB7 A;  3VQG A;  2EEJ A;  4Q6S A;  1X5N A;  3R0H A;  2M3M A;  3CBY A;  1MC7 A;  3LNX A;  2OS6 A;  2X7Z A;  4JJ0 A;  2R3Y A;  2D90 A;  2MX6 A;  1WH1 A;  2EDV A;  2H3L A;  2EXG A;  4GVD A;  5HDY A;  2KJD A;  3WKM A;  2P3W A;  1PDR A;  1UJV A;  4JOK A;  4FLN A;  3DJA A;  2VSP A;  3PS4 A;  1QAV A;  4HOP A;  3MH7 A;  2EDP A;  1K32 A;  2KBS A;  3PV5 A;  1RGR A;  2EAQ A;  2EGK A;  2M0T A;  1TE0 A;  4JOR A;  2Q9V A;  1WG6 A;  3I18 A;  1TP3 A;  4Q3H A;  5FB8 C;  2YTW A;  4Q2O A;  1W9O A;  1Q7X A;  1WIF A;  1RZX A;  4XHV A;  5E6P B;  1N6D A;  4Q2P A;  2OGP A;  2Z9I A;  5B6L A;  4Z33 A;  2HGA A;  2EDZ A;  3GDV A;  4OAJ A;  2FNE A;  2I6V A;  4YDP A;  2EHR A;  2EEI A;  1V5L A;  1FCF A;  4N6X A;  1UEP A;  2W4F A;  2DB5 A;  1QAV B;  4HOP B;  3FY5 A;  3PV2 A;  2G5M B;  2IWP A;  1V62 A;  5EYZ A;  1W9E A;  3OU0 A;  3B76 A;  2CSS A;  1N99 A;  4NMR A;  5E11 A;  1T2M A;  2OMJ A;  3QGL A;  1VCW A;  1MFG A;  1N7T A;  2REY A;  4H11 A;  2WL7 A;  1IU0 A;  4NMT A;  3CBZ A;  2GEF A;  4F8K A;  2UZC A;  3KZD A;  3SHW A;  1X5R A;  1Q3P A;  3PV4 A;  1X9Z A;  4O06 A;  5HFB A;  2I0I A;  1UIT A;  2RCZ A;  1G9O A;  5E1Y A;  4NMV A;  2YUY A;  5B42 A;  1R6J A;  1N6E A;  2F5Y A;  1KWA A;  1UEQ A;  4NMP A;  1IHJ A;  3GDS A;  1KEF A;  1M5Z A;  1VJ6 A;  2YUB A;  3SFJ A;  1L6O A;  2VPH A;  2H2C A;  3MH4 A;  1SOZ A;  4GVC A;  2OCS A;  4WYT A;  4JOJ A;  4OEO A;  3I4W A;  2M0U A;  1MFL A;  4NXQ A;  4E35 A;  2EGN A;  1N6F A;  1VAE A;  3SUZ A;  5GLJ A;  1UEZ A;  4G69 A;  4JOF A;  1WFG A;  4L8N A;  2F0A A;  2OZF A;  1QAU A;  1P1D A;  2I04 A;  3QE1 A;  3HVQ C;  2FE5 A;  5IL9 A;  1V6B A;  2VRF A;  1ZOK A;  3QJM A;  4Q2N A;  4EDJ A;  5HJ1 A;  4KFW A;  3E17 A;  3MH6 A;  5DTH A;  3EGG C;  1KY9 A;  2D92 A;  1U37 A;  2KL1 A;  2E7K A;  2M0Z A;  4NXP A;  2V90 A;  4IC6 A;  3CS0 A;  2L4T A;  2QT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...