4NMVA

Cftr associated ligand (cal) pdz domain bound to peptide ical36(brb-k-1) (ansrwpts[4-bromobenzoic-acyl-k]i)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Chemically Modified Peptide Scaffolds Target the CFTR-Associated Ligand PDZ Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nmvA00
2LA8A 2HGAA 1UFXA 2IWQA 5HFFA 5JXBA 1WFGA 2D90A 1MC7A 1U37A 4NNMA 4E34A 2O2TA 2RRMA 3QJNA 4NXRA 1KY9A 1UF1A 4K78A 2BYGA 1WF7A 2VZ5A 3KZDA 3CYYA 2I6VA 1TE0A 2EEGA 2M3MA 2VPHA 5B6LA 2H2CA 4EDJA 3NGHA 5HF1A 2L4TA 1N6DA 3PS4A 3CS0A 1FCFA 2JREA 4KFVA 5HFCA 3PV2A 4Q6HA 4OEPA 2G2LA 1SOTA 1NF3C 2CS5A 3ZRTA 1QAVB 3LNXA 2YT7A 2ZPLA 3K1RA 1B8QA 3DJ1A 2YTWA 3I1EA 5HFEA 2EEIA 2OMJA 5E1YA 1UJDA 2I0LA 2KQFA 3DJAA 2AWUA 3SHUA 5HEYA 5G1EA 3SHWA 2LUIA 2OPGA 4Q2QA 4NMPA 1VAEA 2OGPA 3AXAA 4F8KA 3RL8A 2JINA 3GCNA 3PV5A 4P2AB 1V1TA 1UM7A 4HOPB 2RCZA 1NTEA 4MPAA 3GDUA 2HE4A 1QAVA 5F3XA 4Q3HA 1Y7NA 2WL7A 2Q9VA 4FGMA 2PKUA 4NNLA 3TSZA 1N7FA 2AWWA 4YYXA 2LC7A 1FC6A 1Y8TA 4L8NA 1W9OA 4AMHA 2R4HA 2X7ZA 3CH8A 4NMQA 3CBXA 2FN5A 2PKTA 2KA9A 2YUYA 2DJTA 1MFLA 1N7TA 4GHNA 4JORA 1X5NA 4GVDA 2KAWA 2D92A 4JOKA 3R69A 4HOPA 3WKLA 3BPUA 2UZCA 1X8SA 4K76A 1OZIA 5I7ZA 1RZXA 3NFLA 1V6BA 2OCSA 4JOEA 1U3BA 1IHJA 2PA1A 5GLJA 3I4WA 4R2ZA 3O5NA 5HFDA 2OS6A 4UU5A 1Z86A 2OSGA 4Q2OA 3GGEA 4NMOA 1R6JA 2DKRA 5E11A 2MHOA 4OAJA 2KL1A 3CC0A 5HDYA 1G9OA 5HETA 3GDSA 1WFVA 2EEJA 2KBSA 1P1DA 1D5GA 5FB8C 2I04A 1WJLA 1IU2A 2JIKA 5E6PB 3KHFA 2AINA 3B76A 1Q7XA 4JOJA 2FCFA 4E35A 1GQ4A 4JOGA 3PV4A 1TP5A 2DM8A 2LC6A 3VQFA 1XZ9A 1W9QA 2QT5A 1Q3OA 3TMHA 4XHVA 2KJKA 2EV8A 1FC9A 2PDZA 2L97A 2V90A 2Z9IA 1ZOKA 3QDOA 1Q3PA 1YBOA 2IWPA 3PDZA 4Q2PA 1N99A 3PDVA 1UEPA 2K1ZA 2F5YA 1UJUA 3MH4A 1WG6A 1SOZA 2CSSA 1WI2A 2YUBA 4NMTA 4Q2NA 2KOJA 1UJVA 1WI4A 3DIWA 4YDPA 2QKTA 1V62A 2EGKA 4Q6SA 5FHTA 3R68A 2JWEA 1PDRA 3LNYA 4K6YA 5A2PA 1RGWA 1OBYA 2VSVA 4O06A 2DLSA 1TQ3A 4KFWA 2LOBA 1BFEA 3VQGA 2FE5A 4P0CA 2OQSA 1X45A 4JOFA 3NFKA 2AWXA 2EDPA 3OU0A 4JOHA 3ID2A 2KPKA 1T2MA 2PNTA 4UU6A 2I1NA 1W9EA 2YT8A 4NXQA 2JOAA 2I4SA 1UM1A 4E3BA 3FY5A 4IC6A 2E7KA 2L4SA 1M5ZA 4K75A 3L4FD 3GCOA 2REYA 3QE1A 1I92A 4WYTA 3ID3A 1GM1A 2W4FA 1UEQA 4NMVA 4JL7A 1OBZA 1UEZA 2DAZA 4RI0A 3EGHC 1MFGA 2F0AA 2KV8A 1UEWA 2EEHA 2V1WA 2D8IA 3MH7A 1X5RA 4PQWA 1OBXA 1VA8A 3QO6A 3JXTA 2EDZA 2G5MB 4G69A 3RL7A 3ID4A 2M0TA 4H11A 2MX6A 4N6XA 3CBZA 2KYLA 3QJMA 1UITA 3WKMA 3HVQC 5F67A 2EAQA 2DB5A 5EZ0A 2EGOA 2ZPMA 2OZFA 1N7EA 1VB7A 1K32A 1RY4A 2KOHA 2M0VA 2HE2A 4OEOA 1WF8A 3GSLA 2EJYA 2VRFA 2H3LA 1WHDA 3QGLA 2JXOA 4NXPA 3MH6A 3KZEA 2M10A 4GVCA 4NMRA 1RGRA 2R3YA 3K50A 5EYZA 1V5LA 4JOPA 1ZUBA 2M0ZA 2QBWA 1KEFA 2H3MA 1U38A 3QIKA 2KPLA 1TP3A 1GQ5A 2KJPA 3I18A 5HEDA 1N6FA 1X5QA 4Z8JA 4WYUA 5HJ1A 1UHPA 2EXGA 2K20A 2KRGA 2QKUA 1V5QA 1Z87A 3TSVA 2DLUA 2DC2A 2M0UA 2QKVA 5GNDA 1QLCA 2EGNA 1N6EA 1WHAA 1VJ6A 2PZDA 2IWOA 2DMZA 2I0IA 5G1DA 5D13A 2CSJA 3EGGC 4K72A 2H2BA 1LCYA 3SOEA 1FC7A 1P1EA 2EHRA 3GJ9A 2VWRA 3O46A 1X6DA 1I16A 1QAUA 4LMMA 3STJA 3R0HA 4NMSA 2P3WA 1VCWA 1BE9A 3K82A 3HPMA 3DORA 3SFJA 1IU0A 3HPKA 2IWNA 5H3JA 2Q3GA 5E21A 2KOMA 3ID1A 3GDVA 5DTHA 2ENOA 1U39A 4Z33A 3RLEA 1WH1A 1WIFA 2GZVA 2W7RA 2VSPA 2FNEA 3DJ3A 2EDVA 5HEBA 2JILA 2KG2A 2QG1A 3SUZA 1KWAA 3OTPA 1L6OA 3E17A 2Z17A 5HF4A 5E22A 3CBYA 5HFBA 3TSWA 2KJDA 4REYA
chains in the Genus database with same CATH superfamily
2LA8A 2HGAA 1UFXA 2IWQA 5HFFA 5JXBA 1WFGA 2D90A 1MC7A 1U37A 4NNMA 4E34A 2O2TA 2RRMA 3QJNA 4NXRA 1KY9A 1UF1A 4K78A 2BYGA 4JJ0A 1WF7A 2VZ5A 3KZDA 3CYYA 2I6VA 1TE0A 2GEFA 2EEGA 2M3MA 2VPHA 5B6LA 2H2CA 4EDJA 3NGHA 5HF1A 2L4TA 1N6DA 3PS4A 3CS0A 1FCFA 2JREA 4KFVA 5HFCA 3PV2A 4Q6HA 4OEPA 2G2LA 1SOTA 1NF3C 2CS5A 3ZRTA 1QAVB 3LNXA 2YT7A 2ZPLA 3K1RA 1B8QA 3DJ1A 2YTWA 3I1EA 5HFEA 2EEIA 2OMJA 5B42A 5E1YA 1UJDA 2I0LA 2KQFA 3DJAA 2AWUA 3SHUA 5HEYA 5G1EA 3SHWA 2LUIA 2OPGA 4Q2QA 4NMPA 1VAEA 2OGPA 3AXAA 4F8KA 3RL8A 2JINA 3GCNA 3PV5A 4P2AB 1V1TA 1UM7A 4HOPB 2RCZA 1NTEA 4MPAA 3GDUA 2HE4A 1QAVA 5F3XA 4Q3HA 1Y7NA 2WL7A 2Q9VA 4FGMA 2PKUA 4NNLA 3TSZA 1N7FA 2AWWA 4YYXA 2LC7A 1FC6A 1Y8TA 4L8NA 1W9OA 4AMHA 2R4HA 2X7ZA 3CH8A 4NMQA 2JSNA 3CBXA 2FN5A 2PKTA 2KA9A 2YUYA 2DJTA 1MFLA 1N7TA 4GHNA 4JORA 1X5NA 4GVDA 2KAWA 2D92A 4JOKA 3R69A 4HOPA 3WKLA 3BPUA 2UZCA 3KDGA 1X8SA 4K76A 1OZIA 5I7ZA 1RZXA 3NFLA 1V6BA 2OCSA 4JOEA 1U3BA 1IHJA 2PA1A 5GLJA 3I4WA 4R2ZA 3O5NA 5HFDA 2OS6A 4UU5A 1Z86A 2OSGA 4Q2OA 3GGEA 4NMOA 1R6JA 2DKRA 5E11A 2MHOA 4OAJA 2KL1A 3CC0A 5HDYA 1G9OA 5HETA 3GDSA 1WFVA 2EEJA 2KBSA 1P1DA 1D5GA 5FB8C 2I04A 1WJLA 1IU2A 2JIKA 5E6PB 3KHFA 2AINA 3B76A 1Q7XA 4JOJA 2FCFA 4E35A 3KDKA 1GQ4A 4JOGA 3PV4A 1TP5A 2DM8A 2LC6A 3VQFA 1XZ9A 1W9QA 2QT5A 1Q3OA 3TMHA 4XHVA 2KJKA 2EV8A 1FC9A 2PDZA 2L97A 2V90A 2Z9IA 1ZOKA 3QDOA 1Q3PA 1YBOA 2IWPA 3PDZA 4Q2PA 1N99A 3PDVA 1UEPA 2K1ZA 2F5YA 1UJUA 3MH4A 1WG6A 1SOZA 2CSSA 1WI2A 2YUBA 4NMTA 4Q2NA 2KOJA 1UJVA 1WI4A 3DIWA 4YDPA 2QKTA 1V62A 2EGKA 4Q6SA 5FHTA 3R68A 2JWEA 1PDRA 3LNYA 4K6YA 5A2PA 1RGWA 1OBYA 2VSVA 4O06A 2DLSA 1TQ3A 4KFWA 2LOBA 1BFEA 3VQGA 2FE5A 4P0CA 2OQSA 1X45A 4JOFA 3NCVA 3NFKA 2AWXA 2EDPA 3OU0A 4JOHA 3ID2A 2KPKA 1T2MA 2PNTA 4UU6A 2I1NA 1W9EA 2YT8A 4NXQA 2JOAA 2I4SA 1UM1A 4E3BA 3FY5A 4IC6A 5ILBA 2E7KA 2L4SA 1M5ZA 4K75A 3L4FD 3GCOA 2REYA 3QE1A 1I92A 4WYTA 3ID3A 1GM1A 2W4FA 1UEQA 4NMVA 4JL7A 1OBZA 1UEZA 2DAZA 4RI0A 3EGHC 1MFGA 2F0AA 2KV8A 1UEWA 2EEHA 2V1WA 2D8IA 3MH7A 1X5RA 4PQWA 1OBXA 1VA8A 3QO6A 3JXTA 2EDZA 2G5MB 4G69A 3RL7A 3ID4A 2M0TA 4H11A 2MX6A 4N6XA 3CBZA 2KYLA 3QJMA 1UITA 3WKMA 3HVQC 5F67A 2EAQA 2DB5A 5EZ0A 2EGOA 2ZPMA 2OZFA 1N7EA 1VB7A 1K32A 1RY4A 2KOHA 2M0VA 2HE2A 4OEOA 1WF8A 3GSLA 2EJYA 2VRFA 2H3LA 1WHDA 3QGLA 2JXOA 4NXPA 3MH6A 3KZEA 4FLNA 2M10A 4GVCA 4NMRA 1RGRA 2R3YA 3K50A 5EYZA 1V5LA 4JOPA 1ZUBA 2M0ZA 2QBWA 1KEFA 2H3MA 1U38A 3QIKA 2KPLA 1TP3A 1GQ5A 2KJPA 3I18A 5HEDA 1N6FA 1X5QA 4Z8JA 4WYUA 5HJ1A 1UHPA 2EXGA 2K20A 2KRGA 2QKUA 1V5QA 1Z87A 3TSVA 2DLUA 5IL9A 2DC2A 4JJ3A 2M0UA 2QKVA 5GNDA 1QLCA 2EGNA 1N6EA 1WHAA 1VJ6A 2PZDA 2IWOA 2DMZA 2I0IA 5G1DA 5D13A 2CSJA 3EGGC 4K72A 2H2BA 1LCYA 3SOEA 1FC7A 1P1EA 2EHRA 3GJ9A 2VWRA 3O46A 1X6DA 1I16A 1QAUA 4LMMA 3STJA 3R0HA 4NMSA 2P3WA 1VCWA 1BE9A 3K82A 3HPMA 3DORA 3SFJA 1IU0A 3HPKA 2IWNA 5H3JA 2Q3GA 5E21A 2KOMA 3ID1A 3GDVA 5DTHA 2ENOA 1U39A 4Z33A 3RLEA 1WH1A 1WIFA 2GZVA 3GABA 1X9ZA 2W7RA 2VSPA 2FNEA 3DJ3A 2EDVA 5HEBA 2JILA 2KG2A 2QG1A 3SUZA 1KWAA 3OTPA 1L6OA 3E17A 2Z17A 5HF4A 5E22A 3CBYA 5HFBA 3TSWA 2KJDA 4REYA
chains in the Genus database with same CATH topology
2LA8A 2HGAA 1UFXA 2IWQA 5HFFA 5JXBA 1WFGA 2D90A 1MC7A 1U37A 4NNMA 4E34A 2O2TA 2RRMA 3QJNA 4NXRA 1KY9A 1UF1A 4K78A 2BYGA 4JJ0A 1WF7A 2VZ5A 3KZDA 3CYYA 2I6VA 1TE0A 2GEFA 2EEGA 2M3MA 2VPHA 5B6LA 2H2CA 4EDJA 3NGHA 5HF1A 2L4TA 1N6DA 3PS4A 3CS0A 1FCFA 2JREA 4KFVA 5HFCA 3PV2A 4Q6HA 4OEPA 2G2LA 1SOTA 1NF3C 2CS5A 3ZRTA 1QAVB 3LNXA 2YT7A 2ZPLA 3K1RA 1B8QA 3DJ1A 2YTWA 3I1EA 5HFEA 2EEIA 2OMJA 5B42A 5E1YA 1UJDA 2I0LA 2KQFA 3DJAA 2AWUA 3SHUA 5HEYA 5G1EA 3SHWA 2LUIA 2OPGA 4Q2QA 4NMPA 1VAEA 2OGPA 3AXAA 4F8KA 3RL8A 2JINA 3GCNA 3PV5A 4P2AB 1V1TA 1UM7A 4HOPB 2RCZA 1NTEA 4MPAA 3GDUA 2HE4A 1QAVA 5F3XA 4Q3HA 1Y7NA 2WL7A 2Q9VA 4FGMA 2PKUA 4NNLA 3TSZA 1N7FA 2AWWA 4YYXA 2LC7A 1FC6A 1Y8TA 4L8NA 1W9OA 4AMHA 2R4HA 2X7ZA 3CH8A 4NMQA 2JSNA 3CBXA 2FN5A 2PKTA 2KA9A 2YUYA 2DJTA 1MFLA 1N7TA 4GHNA 4JORA 1X5NA 4GVDA 2KAWA 2D92A 4JOKA 3R69A 4HOPA 3WKLA 3BPUA 2UZCA 3KDGA 1X8SA 4K76A 1OZIA 5I7ZA 1RZXA 3NFLA 1V6BA 2OCSA 4JOEA 1U3BA 1IHJA 2PA1A 5GLJA 3I4WA 4R2ZA 3O5NA 5HFDA 2OS6A 4UU5A 1Z86A 2OSGA 4Q2OA 3GGEA 4NMOA 1R6JA 2DKRA 5E11A 2MHOA 4OAJA 2KL1A 3CC0A 5HDYA 1G9OA 5HETA 3GDSA 1WFVA 2EEJA 2KBSA 1P1DA 1D5GA 5FB8C 2I04A 1WJLA 1IU2A 2JIKA 5E6PB 3KHFA 2AINA 3B76A 1Q7XA 4JOJA 2FCFA 4E35A 3KDKA 1GQ4A 4JOGA 3PV4A 1TP5A 2DM8A 2LC6A 3VQFA 1XZ9A 1W9QA 2QT5A 1Q3OA 3TMHA 4XHVA 2KJKA 2EV8A 1FC9A 2PDZA 2L97A 2V90A 2Z9IA 1ZOKA 3QDOA 1Q3PA 1YBOA 2IWPA 3PDZA 4Q2PA 1N99A 3PDVA 1UEPA 2K1ZA 2F5YA 1UJUA 3MH4A 1WG6A 1SOZA 2CSSA 1WI2A 2YUBA 4NMTA 4Q2NA 2KOJA 1UJVA 1WI4A 3DIWA 4YDPA 2QKTA 1V62A 2EGKA 4Q6SA 5FHTA 3R68A 2JWEA 1PDRA 3LNYA 4K6YA 5A2PA 1RGWA 1OBYA 2VSVA 4O06A 2DLSA 1TQ3A 4KFWA 2LOBA 1BFEA 3VQGA 2FE5A 4P0CA 2OQSA 1X45A 4JOFA 3NCVA 3NFKA 2AWXA 2EDPA 3OU0A 4JOHA 3ID2A 2KPKA 1T2MA 2PNTA 4UU6A 2I1NA 1W9EA 2YT8A 4NXQA 2JOAA 2I4SA 1UM1A 4E3BA 3FY5A 4IC6A 5ILBA 2E7KA 2L4SA 1M5ZA 4K75A 3L4FD 3GCOA 2REYA 3QE1A 1I92A 4WYTA 3ID3A 1GM1A 2W4FA 1UEQA 4NMVA 4JL7A 1OBZA 1UEZA 2DAZA 4RI0A 3EGHC 1MFGA 2F0AA 2KV8A 1UEWA 2EEHA 2V1WA 2D8IA 3MH7A 1X5RA 4PQWA 1OBXA 1VA8A 3QO6A 3JXTA 2EDZA 2G5MB 4G69A 3RL7A 3ID4A 2M0TA 4H11A 2MX6A 4N6XA 3CBZA 2KYLA 3QJMA 1UITA 3WKMA 3HVQC 5F67A 2EAQA 2DB5A 5EZ0A 2EGOA 2ZPMA 2OZFA 1N7EA 1VB7A 1K32A 1RY4A 2KOHA 2M0VA 2HE2A 4OEOA 1WF8A 3GSLA 2EJYA 2VRFA 2H3LA 1WHDA 3QGLA 2JXOA 4NXPA 3MH6A 3KZEA 4FLNA 2M10A 4GVCA 4NMRA 1RGRA 2R3YA 3K50A 5EYZA 1V5LA 4JOPA 1ZUBA 2M0ZA 2QBWA 1KEFA 2H3MA 1U38A 3QIKA 2KPLA 1TP3A 1GQ5A 2KJPA 3I18A 5HEDA 1N6FA 1X5QA 4Z8JA 4WYUA 5HJ1A 1UHPA 2EXGA 2K20A 2KRGA 2QKUA 1V5QA 1Z87A 3TSVA 2DLUA 5IL9A 2DC2A 4JJ3A 2M0UA 2QKVA 5GNDA 1QLCA 2EGNA 1N6EA 1WHAA 1VJ6A 2PZDA 2IWOA 2DMZA 2I0IA 5G1DA 5D13A 2CSJA 3EGGC 4K72A 2H2BA 1LCYA 3SOEA 1FC7A 1P1EA 2EHRA 3GJ9A 2VWRA 3O46A 1X6DA 1I16A 1QAUA 4LMMA 3STJA 3R0HA 4NMSA 2P3WA 1VCWA 1BE9A 3K82A 3HPMA 3DORA 3SFJA 1IU0A 3HPKA 2IWNA 5H3JA 2Q3GA 5E21A 2KOMA 3ID1A 3GDVA 5DTHA 2ENOA 1U39A 4Z33A 3RLEA 1WH1A 1WIFA 2GZVA 3GABA 1X9ZA 2W7RA 2VSPA 2FNEA 3DJ3A 2EDVA 5HEBA 2JILA 2KG2A 2QG1A 3SUZA 1KWAA 3OTPA 1L6OA 3E17A 2Z17A 5HF4A 5E22A 3CBYA 5HFBA 3TSWA 2KJDA 4REYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LA8 A;  2HGA A;  1UFX A;  2IWQ A;  5HFF A;  5JXB A;  1WFG A;  2D90 A;  1MC7 A;  1U37 A;  4NNM A;  4E34 A;  2O2T A;  2RRM A;  3QJN A;  4NXR A;  1KY9 A;  1UF1 A;  4K78 A;  2BYG A;  1WF7 A;  2VZ5 A;  3KZD A;  3CYY A;  2I6V A;  1TE0 A;  2EEG A;  2M3M A;  2VPH A;  5B6L A;  2H2C A;  4EDJ A;  3NGH A;  5HF1 A;  2L4T A;  1N6D A;  3PS4 A;  3CS0 A;  1FCF A;  2JRE A;  4KFV A;  5HFC A;  3PV2 A;  4Q6H A;  4OEP A;  2G2L A;  1SOT A;  1NF3 C;  2CS5 A;  3ZRT A;  1QAV B;  3LNX A;  2YT7 A;  2ZPL A;  3K1R A;  1B8Q A;  3DJ1 A;  2YTW A;  3I1E A;  5HFE A;  2EEI A;  2OMJ A;  5E1Y A;  1UJD A;  2I0L A;  2KQF A;  3DJA A;  2AWU A;  3SHU A;  5HEY A;  5G1E A;  3SHW A;  2LUI A;  2OPG A;  4Q2Q A;  4NMP A;  1VAE A;  2OGP A;  3AXA A;  4F8K A;  3RL8 A;  2JIN A;  3GCN A;  3PV5 A;  4P2A B;  1V1T A;  1UM7 A;  4HOP B;  2RCZ A;  1NTE A;  4MPA A;  3GDU A;  2HE4 A;  1QAV A;  5F3X A;  4Q3H A;  1Y7N A;  2WL7 A;  2Q9V A;  4FGM A;  2PKU A;  4NNL A;  3TSZ A;  1N7F A;  2AWW A;  4YYX A;  2LC7 A;  1FC6 A;  1Y8T A;  4L8N A;  1W9O A;  4AMH A;  2R4H A;  2X7Z A;  3CH8 A;  4NMQ A;  3CBX A;  2FN5 A;  2PKT A;  2KA9 A;  2YUY A;  2DJT A;  1MFL A;  1N7T A;  4GHN A;  4JOR A;  1X5N A;  4GVD A;  2KAW A;  2D92 A;  4JOK A;  3R69 A;  4HOP A;  3WKL A;  3BPU A;  2UZC A;  1X8S A;  4K76 A;  1OZI A;  5I7Z A;  1RZX A;  3NFL A;  1V6B A;  2OCS A;  4JOE A;  1U3B A;  1IHJ A;  2PA1 A;  5GLJ A;  3I4W A;  4R2Z A;  3O5N A;  5HFD A;  2OS6 A;  4UU5 A;  1Z86 A;  2OSG A;  4Q2O A;  3GGE A;  4NMO A;  1R6J A;  2DKR A;  5E11 A;  2MHO A;  4OAJ A;  2KL1 A;  3CC0 A;  5HDY A;  1G9O A;  5HET A;  3GDS A;  1WFV A;  2EEJ A;  2KBS A;  1P1D A;  1D5G A;  5FB8 C;  2I04 A;  1WJL A;  1IU2 A;  2JIK A;  5E6P B;  3KHF A;  2AIN A;  3B76 A;  1Q7X A;  4JOJ A;  2FCF A;  4E35 A;  1GQ4 A;  4JOG A;  3PV4 A;  1TP5 A;  2DM8 A;  2LC6 A;  3VQF A;  1XZ9 A;  1W9Q A;  2QT5 A;  1Q3O A;  3TMH A;  4XHV A;  2KJK A;  2EV8 A;  1FC9 A;  2PDZ A;  2L97 A;  2V90 A;  2Z9I A;  1ZOK A;  3QDO A;  1Q3P A;  1YBO A;  2IWP A;  3PDZ A;  4Q2P A;  1N99 A;  3PDV A;  1UEP A;  2K1Z A;  2F5Y A;  1UJU A;  3MH4 A;  1WG6 A;  1SOZ A;  2CSS A;  1WI2 A;  2YUB A;  4NMT A;  4Q2N A;  2KOJ A;  1UJV A;  1WI4 A;  3DIW A;  4YDP A;  2QKT A;  1V62 A;  2EGK A;  4Q6S A;  5FHT A;  3R68 A;  2JWE A;  1PDR A;  3LNY A;  4K6Y A;  5A2P A;  1RGW A;  1OBY A;  2VSV A;  4O06 A;  2DLS A;  1TQ3 A;  4KFW A;  2LOB A;  1BFE A;  3VQG A;  2FE5 A;  4P0C A;  2OQS A;  1X45 A;  4JOF A;  3NFK A;  2AWX A;  2EDP A;  3OU0 A;  4JOH A;  3ID2 A;  2KPK A;  1T2M A;  2PNT A;  4UU6 A;  2I1N A;  1W9E A;  2YT8 A;  4NXQ A;  2JOA A;  2I4S A;  1UM1 A;  4E3B A;  3FY5 A;  4IC6 A;  2E7K A;  2L4S A;  1M5Z A;  4K75 A;  3L4F D;  3GCO A;  2REY A;  3QE1 A;  1I92 A;  4WYT A;  3ID3 A;  1GM1 A;  2W4F A;  1UEQ A;  4NMV A;  4JL7 A;  1OBZ A;  1UEZ A;  2DAZ A;  4RI0 A;  3EGH C;  1MFG A;  2F0A A;  2KV8 A;  1UEW A;  2EEH A;  2V1W A;  2D8I A;  3MH7 A;  1X5R A;  4PQW A;  1OBX A;  1VA8 A;  3QO6 A;  3JXT A;  2EDZ A;  2G5M B;  4G69 A;  3RL7 A;  3ID4 A;  2M0T A;  4H11 A;  2MX6 A;  4N6X A;  3CBZ A;  2KYL A;  3QJM A;  1UIT A;  3WKM A;  3HVQ C;  5F67 A;  2EAQ A;  2DB5 A;  5EZ0 A;  2EGO A;  2ZPM A;  2OZF A;  1N7E A;  1VB7 A;  1K32 A;  1RY4 A;  2KOH A;  2M0V A;  2HE2 A;  4OEO A;  1WF8 A;  3GSL A;  2EJY A;  2VRF A;  2H3L A;  1WHD A;  3QGL A;  2JXO A;  4NXP A;  3MH6 A;  3KZE A;  2M10 A;  4GVC A;  4NMR A;  1RGR A;  2R3Y A;  3K50 A;  5EYZ A;  1V5L A;  4JOP A;  1ZUB A;  2M0Z A;  2QBW A;  1KEF A;  2H3M A;  1U38 A;  3QIK A;  2KPL A;  1TP3 A;  1GQ5 A;  2KJP A;  3I18 A;  5HED A;  1N6F A;  1X5Q A;  4Z8J A;  4WYU A;  5HJ1 A;  1UHP A;  2EXG A;  2K20 A;  2KRG A;  2QKU A;  1V5Q A;  1Z87 A;  3TSV A;  2DLU A;  2DC2 A;  2M0U A;  2QKV A;  5GND A;  1QLC A;  2EGN A;  1N6E A;  1WHA A;  1VJ6 A;  2PZD A;  2IWO A;  2DMZ A;  2I0I A;  5G1D A;  5D13 A;  2CSJ A;  3EGG C;  4K72 A;  2H2B A;  1LCY A;  3SOE A;  1FC7 A;  1P1E A;  2EHR A;  3GJ9 A;  2VWR A;  3O46 A;  1X6D A;  1I16 A;  1QAU A;  4LMM A;  3STJ A;  3R0H A;  4NMS A;  2P3W A;  1VCW A;  1BE9 A;  3K82 A;  3HPM A;  3DOR A;  3SFJ A;  1IU0 A;  3HPK A;  2IWN A;  5H3J A;  2Q3G A;  5E21 A;  2KOM A;  3ID1 A;  3GDV A;  5DTH A;  2ENO A;  1U39 A;  4Z33 A;  3RLE A;  1WH1 A;  1WIF A;  2GZV A;  2W7R A;  2VSP A;  2FNE A;  3DJ3 A;  2EDV A;  5HEB A;  2JIL A;  2KG2 A;  2QG1 A;  3SUZ A;  1KWA A;  3OTP A;  1L6O A;  3E17 A;  2Z17 A;  5HF4 A;  5E22 A;  3CBY A;  5HFB A;  3TSW A;  2KJD A;  4REY A; 
#chains in the Genus database with same CATH topology
 2LA8 A;  2HGA A;  1UFX A;  2IWQ A;  5HFF A;  5JXB A;  1WFG A;  2D90 A;  1MC7 A;  1U37 A;  4NNM A;  4E34 A;  2O2T A;  2RRM A;  3QJN A;  4NXR A;  1KY9 A;  1UF1 A;  4K78 A;  2BYG A;  4JJ0 A;  1WF7 A;  2VZ5 A;  3KZD A;  3CYY A;  2I6V A;  1TE0 A;  2GEF A;  2EEG A;  2M3M A;  2VPH A;  5B6L A;  2H2C A;  4EDJ A;  3NGH A;  5HF1 A;  2L4T A;  1N6D A;  3PS4 A;  3CS0 A;  1FCF A;  2JRE A;  4KFV A;  5HFC A;  3PV2 A;  4Q6H A;  4OEP A;  2G2L A;  1SOT A;  1NF3 C;  2CS5 A;  3ZRT A;  1QAV B;  3LNX A;  2YT7 A;  2ZPL A;  3K1R A;  1B8Q A;  3DJ1 A;  2YTW A;  3I1E A;  5HFE A;  2EEI A;  2OMJ A;  5B42 A;  5E1Y A;  1UJD A;  2I0L A;  2KQF A;  3DJA A;  2AWU A;  3SHU A;  5HEY A;  5G1E A;  3SHW A;  2LUI A;  2OPG A;  4Q2Q A;  4NMP A;  1VAE A;  2OGP A;  3AXA A;  4F8K A;  3RL8 A;  2JIN A;  3GCN A;  3PV5 A;  4P2A B;  1V1T A;  1UM7 A;  4HOP B;  2RCZ A;  1NTE A;  4MPA A;  3GDU A;  2HE4 A;  1QAV A;  5F3X A;  4Q3H A;  1Y7N A;  2WL7 A;  2Q9V A;  4FGM A;  2PKU A;  4NNL A;  3TSZ A;  1N7F A;  2AWW A;  4YYX A;  2LC7 A;  1FC6 A;  1Y8T A;  4L8N A;  1W9O A;  4AMH A;  2R4H A;  2X7Z A;  3CH8 A;  4NMQ A;  2JSN A;  3CBX A;  2FN5 A;  2PKT A;  2KA9 A;  2YUY A;  2DJT A;  1MFL A;  1N7T A;  4GHN A;  4JOR A;  1X5N A;  4GVD A;  2KAW A;  2D92 A;  4JOK A;  3R69 A;  4HOP A;  3WKL A;  3BPU A;  2UZC A;  3KDG A;  1X8S A;  4K76 A;  1OZI A;  5I7Z A;  1RZX A;  3NFL A;  1V6B A;  2OCS A;  4JOE A;  1U3B A;  1IHJ A;  2PA1 A;  5GLJ A;  3I4W A;  4R2Z A;  3O5N A;  5HFD A;  2OS6 A;  4UU5 A;  1Z86 A;  2OSG A;  4Q2O A;  3GGE A;  4NMO A;  1R6J A;  2DKR A;  5E11 A;  2MHO A;  4OAJ A;  2KL1 A;  3CC0 A;  5HDY A;  1G9O A;  5HET A;  3GDS A;  1WFV A;  2EEJ A;  2KBS A;  1P1D A;  1D5G A;  5FB8 C;  2I04 A;  1WJL A;  1IU2 A;  2JIK A;  5E6P B;  3KHF A;  2AIN A;  3B76 A;  1Q7X A;  4JOJ A;  2FCF A;  4E35 A;  3KDK A;  1GQ4 A;  4JOG A;  3PV4 A;  1TP5 A;  2DM8 A;  2LC6 A;  3VQF A;  1XZ9 A;  1W9Q A;  2QT5 A;  1Q3O A;  3TMH A;  4XHV A;  2KJK A;  2EV8 A;  1FC9 A;  2PDZ A;  2L97 A;  2V90 A;  2Z9I A;  1ZOK A;  3QDO A;  1Q3P A;  1YBO A;  2IWP A;  3PDZ A;  4Q2P A;  1N99 A;  3PDV A;  1UEP A;  2K1Z A;  2F5Y A;  1UJU A;  3MH4 A;  1WG6 A;  1SOZ A;  2CSS A;  1WI2 A;  2YUB A;  4NMT A;  4Q2N A;  2KOJ A;  1UJV A;  1WI4 A;  3DIW A;  4YDP A;  2QKT A;  1V62 A;  2EGK A;  4Q6S A;  5FHT A;  3R68 A;  2JWE A;  1PDR A;  3LNY A;  4K6Y A;  5A2P A;  1RGW A;  1OBY A;  2VSV A;  4O06 A;  2DLS A;  1TQ3 A;  4KFW A;  2LOB A;  1BFE A;  3VQG A;  2FE5 A;  4P0C A;  2OQS A;  1X45 A;  4JOF A;  3NCV A;  3NFK A;  2AWX A;  2EDP A;  3OU0 A;  4JOH A;  3ID2 A;  2KPK A;  1T2M A;  2PNT A;  4UU6 A;  2I1N A;  1W9E A;  2YT8 A;  4NXQ A;  2JOA A;  2I4S A;  1UM1 A;  4E3B A;  3FY5 A;  4IC6 A;  5ILB A;  2E7K A;  2L4S A;  1M5Z A;  4K75 A;  3L4F D;  3GCO A;  2REY A;  3QE1 A;  1I92 A;  4WYT A;  3ID3 A;  1GM1 A;  2W4F A;  1UEQ A;  4NMV A;  4JL7 A;  1OBZ A;  1UEZ A;  2DAZ A;  4RI0 A;  3EGH C;  1MFG A;  2F0A A;  2KV8 A;  1UEW A;  2EEH A;  2V1W A;  2D8I A;  3MH7 A;  1X5R A;  4PQW A;  1OBX A;  1VA8 A;  3QO6 A;  3JXT A;  2EDZ A;  2G5M B;  4G69 A;  3RL7 A;  3ID4 A;  2M0T A;  4H11 A;  2MX6 A;  4N6X A;  3CBZ A;  2KYL A;  3QJM A;  1UIT A;  3WKM A;  3HVQ C;  5F67 A;  2EAQ A;  2DB5 A;  5EZ0 A;  2EGO A;  2ZPM A;  2OZF A;  1N7E A;  1VB7 A;  1K32 A;  1RY4 A;  2KOH A;  2M0V A;  2HE2 A;  4OEO A;  1WF8 A;  3GSL A;  2EJY A;  2VRF A;  2H3L A;  1WHD A;  3QGL A;  2JXO A;  4NXP A;  3MH6 A;  3KZE A;  4FLN A;  2M10 A;  4GVC A;  4NMR A;  1RGR A;  2R3Y A;  3K50 A;  5EYZ A;  1V5L A;  4JOP A;  1ZUB A;  2M0Z A;  2QBW A;  1KEF A;  2H3M A;  1U38 A;  3QIK A;  2KPL A;  1TP3 A;  1GQ5 A;  2KJP A;  3I18 A;  5HED A;  1N6F A;  1X5Q A;  4Z8J A;  4WYU A;  5HJ1 A;  1UHP A;  2EXG A;  2K20 A;  2KRG A;  2QKU A;  1V5Q A;  1Z87 A;  3TSV A;  2DLU A;  5IL9 A;  2DC2 A;  4JJ3 A;  2M0U A;  2QKV A;  5GND A;  1QLC A;  2EGN A;  1N6E A;  1WHA A;  1VJ6 A;  2PZD A;  2IWO A;  2DMZ A;  2I0I A;  5G1D A;  5D13 A;  2CSJ A;  3EGG C;  4K72 A;  2H2B A;  1LCY A;  3SOE A;  1FC7 A;  1P1E A;  2EHR A;  3GJ9 A;  2VWR A;  3O46 A;  1X6D A;  1I16 A;  1QAU A;  4LMM A;  3STJ A;  3R0H A;  4NMS A;  2P3W A;  1VCW A;  1BE9 A;  3K82 A;  3HPM A;  3DOR A;  3SFJ A;  1IU0 A;  3HPK A;  2IWN A;  5H3J A;  2Q3G A;  5E21 A;  2KOM A;  3ID1 A;  3GDV A;  5DTH A;  2ENO A;  1U39 A;  4Z33 A;  3RLE A;  1WH1 A;  1WIF A;  2GZV A;  3GAB A;  1X9Z A;  2W7R A;  2VSP A;  2FNE A;  3DJ3 A;  2EDV A;  5HEB A;  2JIL A;  2KG2 A;  2QG1 A;  3SUZ A;  1KWA A;  3OTP A;  1L6O A;  3E17 A;  2Z17 A;  5HF4 A;  5E22 A;  3CBY A;  5HFB A;  3TSW A;  2KJD A;  4REY A; 
#chains in the Genus database with same CATH homology
 2LA8 A;  2HGA A;  1UFX A;  2IWQ A;  5HFF A;  5JXB A;  1WFG A;  2D90 A;  1MC7 A;  1U37 A;  4NNM A;  4E34 A;  2O2T A;  2RRM A;  3QJN A;  4NXR A;  1KY9 A;  1UF1 A;  4K78 A;  2BYG A;  4JJ0 A;  1WF7 A;  2VZ5 A;  3KZD A;  3CYY A;  2I6V A;  1TE0 A;  2GEF A;  2EEG A;  2M3M A;  2VPH A;  5B6L A;  2H2C A;  4EDJ A;  3NGH A;  5HF1 A;  2L4T A;  1N6D A;  3PS4 A;  3CS0 A;  1FCF A;  2JRE A;  4KFV A;  5HFC A;  3PV2 A;  4Q6H A;  4OEP A;  2G2L A;  1SOT A;  1NF3 C;  2CS5 A;  3ZRT A;  1QAV B;  3LNX A;  2YT7 A;  2ZPL A;  3K1R A;  1B8Q A;  3DJ1 A;  2YTW A;  3I1E A;  5HFE A;  2EEI A;  2OMJ A;  5B42 A;  5E1Y A;  1UJD A;  2I0L A;  2KQF A;  3DJA A;  2AWU A;  3SHU A;  5HEY A;  5G1E A;  3SHW A;  2LUI A;  2OPG A;  4Q2Q A;  4NMP A;  1VAE A;  2OGP A;  3AXA A;  4F8K A;  3RL8 A;  2JIN A;  3GCN A;  3PV5 A;  4P2A B;  1V1T A;  1UM7 A;  4HOP B;  2RCZ A;  1NTE A;  4MPA A;  3GDU A;  2HE4 A;  1QAV A;  5F3X A;  4Q3H A;  1Y7N A;  2WL7 A;  2Q9V A;  4FGM A;  2PKU A;  4NNL A;  3TSZ A;  1N7F A;  2AWW A;  4YYX A;  2LC7 A;  1FC6 A;  1Y8T A;  4L8N A;  1W9O A;  4AMH A;  2R4H A;  2X7Z A;  3CH8 A;  4NMQ A;  2JSN A;  3CBX A;  2FN5 A;  2PKT A;  2KA9 A;  2YUY A;  2DJT A;  1MFL A;  1N7T A;  4GHN A;  4JOR A;  1X5N A;  4GVD A;  2KAW A;  2D92 A;  4JOK A;  3R69 A;  4HOP A;  3WKL A;  3BPU A;  2UZC A;  3KDG A;  1X8S A;  4K76 A;  1OZI A;  5I7Z A;  1RZX A;  3NFL A;  1V6B A;  2OCS A;  4JOE A;  1U3B A;  1IHJ A;  2PA1 A;  5GLJ A;  3I4W A;  4R2Z A;  3O5N A;  5HFD A;  2OS6 A;  4UU5 A;  1Z86 A;  2OSG A;  4Q2O A;  3GGE A;  4NMO A;  1R6J A;  2DKR A;  5E11 A;  2MHO A;  4OAJ A;  2KL1 A;  3CC0 A;  5HDY A;  1G9O A;  5HET A;  3GDS A;  1WFV A;  2EEJ A;  2KBS A;  1P1D A;  1D5G A;  5FB8 C;  2I04 A;  1WJL A;  1IU2 A;  2JIK A;  5E6P B;  3KHF A;  2AIN A;  3B76 A;  1Q7X A;  4JOJ A;  2FCF A;  4E35 A;  3KDK A;  1GQ4 A;  4JOG A;  3PV4 A;  1TP5 A;  2DM8 A;  2LC6 A;  3VQF A;  1XZ9 A;  1W9Q A;  2QT5 A;  1Q3O A;  3TMH A;  4XHV A;  2KJK A;  2EV8 A;  1FC9 A;  2PDZ A;  2L97 A;  2V90 A;  2Z9I A;  1ZOK A;  3QDO A;  1Q3P A;  1YBO A;  2IWP A;  3PDZ A;  4Q2P A;  1N99 A;  3PDV A;  1UEP A;  2K1Z A;  2F5Y A;  1UJU A;  3MH4 A;  1WG6 A;  1SOZ A;  2CSS A;  1WI2 A;  2YUB A;  4NMT A;  4Q2N A;  2KOJ A;  1UJV A;  1WI4 A;  3DIW A;  4YDP A;  2QKT A;  1V62 A;  2EGK A;  4Q6S A;  5FHT A;  3R68 A;  2JWE A;  1PDR A;  3LNY A;  4K6Y A;  5A2P A;  1RGW A;  1OBY A;  2VSV A;  4O06 A;  2DLS A;  1TQ3 A;  4KFW A;  2LOB A;  1BFE A;  3VQG A;  2FE5 A;  4P0C A;  2OQS A;  1X45 A;  4JOF A;  3NCV A;  3NFK A;  2AWX A;  2EDP A;  3OU0 A;  4JOH A;  3ID2 A;  2KPK A;  1T2M A;  2PNT A;  4UU6 A;  2I1N A;  1W9E A;  2YT8 A;  4NXQ A;  2JOA A;  2I4S A;  1UM1 A;  4E3B A;  3FY5 A;  4IC6 A;  5ILB A;  2E7K A;  2L4S A;  1M5Z A;  4K75 A;  3L4F D;  3GCO A;  2REY A;  3QE1 A;  1I92 A;  4WYT A;  3ID3 A;  1GM1 A;  2W4F A;  1UEQ A;  4NMV A;  4JL7 A;  1OBZ A;  1UEZ A;  2DAZ A;  4RI0 A;  3EGH C;  1MFG A;  2F0A A;  2KV8 A;  1UEW A;  2EEH A;  2V1W A;  2D8I A;  3MH7 A;  1X5R A;  4PQW A;  1OBX A;  1VA8 A;  3QO6 A;  3JXT A;  2EDZ A;  2G5M B;  4G69 A;  3RL7 A;  3ID4 A;  2M0T A;  4H11 A;  2MX6 A;  4N6X A;  3CBZ A;  2KYL A;  3QJM A;  1UIT A;  3WKM A;  3HVQ C;  5F67 A;  2EAQ A;  2DB5 A;  5EZ0 A;  2EGO A;  2ZPM A;  2OZF A;  1N7E A;  1VB7 A;  1K32 A;  1RY4 A;  2KOH A;  2M0V A;  2HE2 A;  4OEO A;  1WF8 A;  3GSL A;  2EJY A;  2VRF A;  2H3L A;  1WHD A;  3QGL A;  2JXO A;  4NXP A;  3MH6 A;  3KZE A;  4FLN A;  2M10 A;  4GVC A;  4NMR A;  1RGR A;  2R3Y A;  3K50 A;  5EYZ A;  1V5L A;  4JOP A;  1ZUB A;  2M0Z A;  2QBW A;  1KEF A;  2H3M A;  1U38 A;  3QIK A;  2KPL A;  1TP3 A;  1GQ5 A;  2KJP A;  3I18 A;  5HED A;  1N6F A;  1X5Q A;  4Z8J A;  4WYU A;  5HJ1 A;  1UHP A;  2EXG A;  2K20 A;  2KRG A;  2QKU A;  1V5Q A;  1Z87 A;  3TSV A;  2DLU A;  5IL9 A;  2DC2 A;  4JJ3 A;  2M0U A;  2QKV A;  5GND A;  1QLC A;  2EGN A;  1N6E A;  1WHA A;  1VJ6 A;  2PZD A;  2IWO A;  2DMZ A;  2I0I A;  5G1D A;  5D13 A;  2CSJ A;  3EGG C;  4K72 A;  2H2B A;  1LCY A;  3SOE A;  1FC7 A;  1P1E A;  2EHR A;  3GJ9 A;  2VWR A;  3O46 A;  1X6D A;  1I16 A;  1QAU A;  4LMM A;  3STJ A;  3R0H A;  4NMS A;  2P3W A;  1VCW A;  1BE9 A;  3K82 A;  3HPM A;  3DOR A;  3SFJ A;  1IU0 A;  3HPK A;  2IWN A;  5H3J A;  2Q3G A;  5E21 A;  2KOM A;  3ID1 A;  3GDV A;  5DTH A;  2ENO A;  1U39 A;  4Z33 A;  3RLE A;  1WH1 A;  1WIF A;  2GZV A;  3GAB A;  1X9Z A;  2W7R A;  2VSP A;  2FNE A;  3DJ3 A;  2EDV A;  5HEB A;  2JIL A;  2KG2 A;  2QG1 A;  3SUZ A;  1KWA A;  3OTP A;  1L6O A;  3E17 A;  2Z17 A;  5HF4 A;  5E22 A;  3CBY A;  5HFB A;  3TSW A;  2KJD A;  4REY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...