1SOZA

Crystal structure of degs protease in complex with an activating peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
311
structure length
281
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 281
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sozA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA02
2VIOA 2DLSA 2W7RA 1CHOG 3JZ1B 4B2CA 1O32A 4MNWA 3RXLA 1J16A 1ZMLA 5PTPA 1O3JA 1RD3B 2GZVA 1NY22 1ZGVA 3D65E 2M0TA 2Z9IA 1P2MA 1H9IE 4RI0A 4M7GA 3BSQA 4A1TA 1SHYA 3A81A 3M36A 2AERH 1AZ8A 4AYVB 5GPIB 1P12E 1UHBB 2GCHF 1WCZA 3SJKA 1O0DH 1NRSH 1YCPM 2Y5GA 2ZPRA 2P8OB 2ZKSA 1TONA 3O8RA 1QGFA 1DFPA 5C2ZA 1ANBA 1HIAB 3A7YA 1SOZA 2BDAA 4YOJA 4KTUA 2KOJA 1AKSB 1V2ST 3H7OA 4JZ1A 3I4WA 2AGIX 1CHGA 3VB4A 4X8TH 1TGTA 4MPWA 2FZZA 4NWLA 3SOEA 2V90A 1C2KA 2JETC 2MHOA 1O2PA 1AO5A 3TJOA 1YP9A 1TBQH 1MAXA 2DMZA 2M0ZA 2R0KA 4U2WA 5IDKA 4UFEH 1AI8H 2AMDA 4DCDA 3UQVA 1F0RA 1SVPA 1YCPK 4WY3A 3ELAH 3HKIB 5E22A 2EEIA 1LKAA 1HAZB 3TIUA 5F8ZA 2FNEA 1GJ4H 2XBXA 2GCTC 2KV8A 2AIPA 2LPRA 1GI6A 1RGQA 1BHXB 4TPIZ 4LMMA 1CGJE 1BB0B 4TY7A 2VSVA 2R0LA 2G55A 4FUGA 1JBUH 2PGQB 1C2EA 1MZAA 4O06A 1RS0A 1X7AC 2CN0H 3LNXA 2FOBA 1S6HA 3FP6E 1JOUB 2ZPMA 1Q7XA 1C4U2 3GY6A 2UWOA 3P70B 1P06A 1O3AA 4A1XA 3RXVA 2GZ9A 3RXRA 4CHAC 3TNTA 1DWDH 1MCTA 2J38A 1WHDA 1HAXB 1QR3E 4E34A 3PROA 2ZC9H 1T8MA 4OEPA 4FVDA 3LC5A 1O2SA 1BITA 4OAJA 2BDCA 1H1BA 3CS7A 2ZCHP 1O3KA 1O31A 3STIA 1O3BA 1S0QA 3Q3KA 1BTPA 1CT4E 2VJ1A 1XXFA 2J34A 1GGDB 3LGYA 4JOGA 3O46A 3GDUA 1MTNB 1CA0C 5E6PB 1G3DA 3D62A 5EQQA 1ZRKA 7GCHF 5HF1A 3BEIB 3PB1E 2ZDKA 4KKDA 5FBIA 1AN1E 1P01A 3NUMA 2E7KA 2I0LA 5H4IB 1Y8TA 1C2GA 3KIDU 2M5TA 2FI3E 3GYMA 1O2QA 3M37A 3MO6A 2F9UA 1D3PB 1O38A 1HAGE 1TNHA 2OP9A 2OCSA 3SHAH 1MH0A 1ESBA 3H5CB 1P1DA 1K1LA 2KAIB 1G2MA 1JRSA 2K20A 3D23A 1UTLM 3KGPA 5HJ1A 1NT1A 3M3SA 2G8TA 2HGAA 5EW2H 3V7TA 3ESTA 3IG6B 1NU7B 2EHRA 1K1MA 2PGBB 2R2WU 1KXAA 4X1SU 1TPPA 3NXPA 4ISLA 1G2LA 3R0HA 1UK3A 1S5SA 2QAAA 3EAJA 1WTHD 1P9UA 3F9EA 1TNGA 1QRXA 4Y7BA 1HJAB 1HIAA 4FUDA 4IC6A 5GCHG 2FESH 2WPMS 4Y8XA 1O3GA 1AKSA 2XBVA 5C5OA 2RA0A 3TVJB 1C1VH 2YNAA 2G52A 1DY8A 5JPMH 2XWBI 2FS9A 2P8OC 3QZQA 5I46H 1N6FA 1GJ9B 1QQUA 2FM2A 2F9NA 1SGTA 2OINA 1W9EA 4NIVA 4GHNA 3UOPA 5DJ7A 2XBYA 5ESTE 1LPKB 2GT8A 1AVGH 4B75A 3VGCB 1QBOA 2KOHA 1Q3OA 5DP3A 1DOJA 3I18A 2GD4B 4OS1A 2ZQ2A 3KHVA 1LCYA 1BMMH 1QL7A 1Z8JB 2AWXA 3SU1A 1LTOA 2C8ZB 3UOUA 2ZPQA 5EOKA 2M3MA 5EZ0A 2V3HH 1QTFA 1UK4A 1N7TA 1P03A 1TOCB 4MNYA 4JOFA 1TPAE 2O8UA 2H3MA 3I77A 1Y59T 2SNVA 3Q77A 5LH8A 2IJOB 3ZZ8A 1IAUA 4TWWA 4JORA 4FXGH 2A7JA 4ABFA 4Z6AH 1IQFA 1NRRH 2PFEA 1VR1H 1C5WB 2BHGA 4Y76A 4O9VA 1EOJA 1NC6A 3STJA 3KQDA 3RXHA 4CRGA 1P2IA 2P59A 4GCHF 2PW8H 1SQAA 3FFGA 2V0BA 2ZDLA 1N6DA 5HEDA 1OOKB 2XC5A 1U6QA 3JZ2B 3KL6A 3RU4D 1HAPH 1XUKA 2ZU5A 2DE9A 1P2JA 4DG4A 4Q7YA 1PDRA 3QDOA 1ABIH 1O2KA 4UEHH 5ETXA 3AXAA 3ZVBA 2HPQH 2QF0A 3O8DA 3LU9B 4VGCB 4U32A 1PPHE 3LGUA 1MTNC 4INKA 3I78A 2AH4X 1GBTA 1ZLRA 1C1NA 2EAQA 3E91A 2BDHA 3KNXA 3S7HB 2EEKA 1WSSH 4A7IB 3EGHC 1P02A 1W11U 2TGDA 3LH3A 1G9OA 1TFXA 1OS8A 5K0HA 3W95A 5EPYA 2VNTA 2KAIA 3PO1C 4MVNA 3M5NA 5FCRA 2EDZA 4MPAA 1O3EA 3HK6B 5L30H 1S82A 3LNYA 1YPGH 4O97A 3AASA 2OGPA 2PKAA 3TSVA 1UEQA 5HYOA 2VVVA 1ELAA 2ILNA 4NA7A 4YYXA 3H7TA 4ISHH 1FLEE 2BLWA 1UVPA 3LT3A 1V2LT 1MD8A 2UUYA 1XMNB 4LZ1H 4I31A 4NMRA 5HFEA 1GHAG 5B6LA 1BRCE 3IITA 4DT7B 2A4OA 3DORA 1W14U 4A6LA 1HJAC 2AEIH 3LJJA 3ZZCA 1OWKA 3KQEA 3ITIA 1ELGA 2BLOA 2A7HA 1N1LA 1YBOA 5DP6A 3ID1A 4IC5A 1EAUA 3B9FH 3RXTA 3MNXA 4CH8B 2QYIA 4ZUHA 3TH4H 3Q3YA 3GY5A 2QXIA 1GG6B 2UUFB 1TRMA 1SGEE 3GISB 1UTQA 3NCLA 3QE1A 1W7GH 2Q1JA 2VIWA 1WU1A 3T28A 2FO9A 4A1VA 4MLFB 3E6PH 4NWKA 4X6OA 1A2CH 1O2YA 1E0FD 2UUJB 3ID2A 4KTSA 4Y11E 3UNRA 1J9CH 4FVBA 5DG6A 1SL3A 1MZDA 4Q2PA 2GMTB 1L1JA 1O2OA 3GOVB 1LQEA 3OY6U 4E3BA 1G9IE 4K6YA 4AFQA 4KTCA 3RXOA 1ZOKA 2ZU1A 2VU8E 1BTWA 3BG4C 1GDNA 4NZLA 4OS6A 4Y10E 1YKTA 5HFBA 1TPOA 1O30A 2BDGA 1GMDF 1QY6A 2GZ8A 1ELFA 1QAUA 3P6ZB 3SHWA 2XC0A 5C67A 1J8AA 1P05A 1IHJA 3L3TA 1KXBA 4JOPA 1MFGA 2V6NA 2KA9A 3BEUA 2G5VA 1OKXA 3M7TA 1Q3PA 3F6UH 1GVKB 2BZ6H 1Y3VA 1C1PA 1IHSH 1CQQA 2JH0D 2B0FA 4AGJA 4NMPA 5DP9A 3MH5A 1DDJA 2Y7ZA 4CRFA 1W13U 1GBLA 1LDTT 4J1YA 2FOMB 3U8OH 3FZZA 1ELTA 1A0JA 3QWCH 4K78A 2ZHFH 2GP9B 3ZZ5A 5C1UA 1TGBA 1LHDH 1RZXA 1Y5UT 1V6DA 1GJAB 2QN5T 1YPHC 2ZHDA 4GVUA 4VGCC 3BTFE 5FHTA 2C4FH 1AFQB 3SUGA 1O3PB 2F83A 2BVXH 3GDSA 2FYQA 3SJOA 4NXPA 1W9OA 1C1MA 3PS4A 2QKVA 4ZXYH 4J2YB 2Y6TA 3M5MA 3RXFA 4ZMAH 3QLPH 3SV8A 1T4UH 1ANCA 1IQMA 3NK8A 3S7KB 1L1GA 1GDQA 1UVOA 2PNTA 2V1WA 2H5CA 2H6MA 2OD3B 1DE7H 3TMHA 2OQ5A 2A45B 2A4GA 3O5NA 1THRH 4Q80A 4MPXA 4H42U 2BD3A 2UWPA 2PUQH 1YYY1 2J95A 1PYTC 1WAYB 1LHFH 1MQ5A 1WHAA 1EQ9A 1LHEH 3QTVH 1TQ7B 2ZNKH 2PZDA 1VB7A 1HCGA 1SGFG 1NFWA 1DLEA 2BTCE 3P92A 2TGAA 1ANEA 2WPLS 3BTEE 2VWRA 2FLBH 2D92A 3GCTG 2BDBA 1C1RA 2WL7A 3E3TA 4R0IA 1VITG 4NGAH 1EASA 5LPFA 1AWHB 2L4TA 5E2PA 2YT8A 2DE8A 2Q6GA 3BIVH 1UF1A 2EDVA 3TSWA 1NFXA 3K9XB 3PLKA 3SUDA 4YTAA 3WY8A 1GL1A 1A1RA 4TPYA 4EDJA 3URDA 3BN9A 5SGAE 1CSOE 1HLTH 4WVPE 3RL8A 4K3JA 2W7UA 1ZZZA 1GMCF 1N6YA 2WPKS 3UPEA 1DWCH 1KSNA 2VWMA 1FC9A 4MNXA 4OS7A 4ABGA 2QXGA 1GG6C 2JETB 2OC8A 4FUBA 1IQGA 2ASUB 3ATIA 4AN7A 2DC2A 1S6FA 4WXIA 4BOHA 4K2YA 3K65B 1X5QA 3SBKA 2ODPA 3E16B 5JB8S 2PV9B 4AB8A 2FOFA 1C5PA 5L2ZH 2SGPE 2K1ZA 3A7ZA 2R2MB 2BYAX 2JH5D 1O3HA 1TRNA 1OWDA 3QGJA 2GCTB 4BANB 3TJUA 4UU5A 3VEQB 3RXCA 3MU0A 2VVCA 3UR6A 5HFFA 5C3NA 1RFNA 2SGEE 3SNBA 4D9QA 3ATMA 4NCYA 5HDYA 2PR3A 1U39A 2PLXA 1LKBA 4IW4E 5A2PA 1NS3A 3MH7A 4X2VA 1RIWB 4X1NU 4KFVA 1P11E 3ZVDA 3P95A 1SLWB 1NRNH 3O8BA 1QA7A 5HEBA 3SFJA 1IQJA 2A4RA 4YT7H 3URCA 1LHCH 3HGNA 4O3TA 4ZKSU 3UUZA 1ZTKA 2BYGA 2RCZA 3SU6A 1HXFH 2ANWA 1DITH 5T6GA 2MX6A 4FGMA 5HFCA 1FONA 2CXVA 5J4QA 4AG2A 2ZDVH 2LUIA 4H6TA 1NESE 3PYHA 1QA0A 1O39A 1Q31A 1FCFA 3S9BA 2HGTH 1XM1A 5BPEA 3DIWA 4I8JA 2AWUA 4LK4A 3ZVCA 1F92A 1GJBB 3VB5A 1BQYA 1AFQC 3MTYA 1CU1A 3SU0A 1KXFA 1SB1H 4X0WU 4JOKA 1GBCA 4NSVA 1RJXB 2D8IA 2QT5A 1AUJA 2B7DH 2Y81A 1X5NA 5EXLA 2IWPA 4K8YA 4K8BA 4IN1A 1PQ8A 5FXLA 3UR9A 4YDPA 2AS9A 3RMOH 4CR5A 1FI8A 3OSYA 2XW9A 2DUCA 2BX3A 1A0HB 1TNIA 4ABAA 4ZHMU 1P0SH 1NU9A 3SJ8A 1C2FA 3T27A 3TSZA 2ZWLH 2EJYA 3HATH 2DKRA 1C1OA 2VWNA 2GV7A 4Q2OA 1RXPA 2ZDAH 1ZYOA 1TAWA 1UEPA 4F8KA 2FTLE 1AQ7A 4INLA 2G4UA 1ANDA 1MBQA 2P3UB 3TITA 3BTME 3TLOA 5ABWA 4PQWA 3GGEA 1TGCA 5FX6A 2PWXA 1WG6A 2BVSH 2OBQA 2VIDA 2GCHG 1P2OA 1EOLA 3NPSA 3A86A 4H4FA 3EYDA 5EQRA 5E0JA 3A8CA 2L97A 4K75A 3HPTB 4JMYA 4B71A 4D76A 2G51A 2P93A 1VA8A 4DJZB 1LPZB 2W3IA 4DVAU 3PDVA 3U1JB 1F5LA 1NF3C 2IWNA 3V0XA 1V5QA 1AMHA 1V2KT 1ELVA 1TX6A 1AUTC 4INHA 2ZIQH 4I8HA 3ODFA 1W2KH 4Y6DA 5FPSA 1F0UA 4GUXA 2BB4A 4OGXA 2H9TH 4R8TB 3SV6A 3ZVAA 1GI3A 4JOJA 5C1YA 3UNQA 1C5XB 3QK1A 4ZKNU 1OP0A 2V3OH 3BTQE 3U1IB 4Y7AA 1EJAA 1DSTA 1C9PA 4Y8YA 2I0IA 1P04A 3RP2A 3IWMA 4AMHA 1EZSC 2ANYA 2FOAA 2KPLA 1VCPA 2W5EA 2ZQ1A 3QUMP 3NKKA 1NRQH 2O8LA 3LDXH 1DXWA 3NGHA 3PLBA 4NIXA 2Y82A 3SI4H 4WH8A 2H2ZA 4WYUA 1IQEA 1WH1A 1DLKB 4YT6H 3RUOA 2BOHB 4JZFH 3MNBA 4UU6A 2M10A 1UMAH 3M5OA 1BCUH 1L1NA 4YESB 4BTUB 4K72A 1GHBG 1RIWC 4RKOB 1BMAA 1GHVH 1V2TT 1OXGA 5EXNA 1UCYH 3S0NA 1BTZA 1TBZH 3EGGC 2FOGA 4P2AB 2P3FH 4PROA 3SU2A 8GCHF 1ZMJA 4ESTE 3E8LA 3SW2B 1T4VH 5TJXA 1HB0B 1LVYA 3A80A 2C3SA 1C5QA 1Z86A 1C5VA 2TGPZ 2SGAA 3KQBA 4BAMB 2XWAA 3CS0A 1MQ6A 4REYA 5GJ4B 1EAXA 3ENSB 3RXAA 3PDZA 3EQ0H 1SHHB 1O3LA 5E11A 3UNSA 4AORA 1BRUP 2QIQA 1TOMH 2ESTE 1AB9C 1E38B 3RU4T 2CJIA 7GCHG 3KCGH 3RXKA 1ZOMA 2ZEBA 2FTMA 1W12U 4BAOB 4GHTA 1DM4B 2XRCA 2VGCC 3GDVA 1XKAC 5JBBS 1YPEH 1MBMA 3PO1B 1M5ZA 2Q3GA 1ID5H 5DP5A 1F5RA 1P1EA 7LPRA 4TY6A 2KPKA 2AMPA 3FVFB 1WYKA 3BTGE 1UK2A 2CS5A 1G3CA 4DURA 1O3CA 4JZIA 1QRWA 4Z0KA 1E36B 1VJ6A 3GCHC 5JXBA 2LOBA 1W3CA 2A5IA 2FS8A 1W0ZU 2H9HA 1GJ7B 1SFIA 4WMFA 3MU5A 1C2IA 1Y3WA 3P8FA 5FPTA 2O2TA 1IQLA 2KG2A 1V2VT 4NMSA 2A31A 5JB9S 1UTOA 5L2YH 3AW1A 1O3NA 2G00A 2PKAB 3PMHB 1MTVA 5ESBA 1E35B 2HALA 1DANH 3RXIA 2F5YA 1MTSA 1JIRA 2XCFA 3UREA 1QHRB 3EGKH 1FJSA 5CMXH 1YLCA 1OYQA 1PPZA 2DB5A 3ZZDA 3A85A 1QIXB 1GI2A 1LVOA 3BPUA 1W7XH 1WQVH 3DD2H 1UM1A 4THNH 1O5CB 1UTJA 2NU1E 2H3LA 1QFKH 1O2HA 1K21H 1UCYK 4ABHA 4JK6A 5A0AE 1TE0A 2A1DB 2Z9GA 3RU4E 3ZZBA 6GCHF 1NO9H 2SFAA 2Y5FA 3GCNA 5L6NH 1TQ3A 3GYLB 1SLUB 3MO9A 1Y3UA 1BDAA 1EZUC 1WI4A 1O2TA 1GMHF 1K1PA 3MMGA 1G30B 2Z3CA 3DJ1A 5E8EH 1DX5M 1O2UA 2ZPLA 4ZKRU 2CF9H 1VJ9U 3RXMA 1Y5BT 1YPLH 1INCA 2BY7X 2Z9KA 1VCWA 3ATWA 1Z1IA 2Z6BD 1XKBC 5HF4A 1O34A 1P9SA 1C5NH 5FAHA 2J4IA 3BG4B 3SJIA 1AD8H 4Q6HA 3GSLA 3S9AA 1G37A 4YOIA 2EEJA 1N7EA 5GDSH 2PSXA 3ATLA 1BTHH 2ZO3H 2DJTA 1IQKA 4KFWA 1C5YB 2IN2A 2QV1A 3M3TA 1UCYE 4WMEA 1O33A 4ISIH 2J9NA 1NPMA 2DAZA 4A5TS 3RXPA 1AWFH 1H9LB 4XHVA 4E05H 2EGOA 3RLEA 3CYYA 1TYNA 1FY3A 4X6NA 1SGRE 2EXGA 4FUIA 1EP6A 2DLUA 4GCHG 3NFKA 4QT8C 4UE7H 2SGQE 1C1WH 4CR9A 2HVXA 3HPMA 4NA8A 2G5MB 3B76A 1AE5A 3TJNA 2QGRA 9ESTA 1V2UT 1IHTH 1V2JT 1HGTH 2OZFA 1GBDA 1TP5A 1WTGH 4BTIB 3SQHE 1W8BH 2YOLA 2Z9LA 1FC7A 1ZSJA 3L6PA 3SNCA 1V2OT 1K1OA 5C5NA 2OMJA 3PM3A 1V2QT 2FE5A 5H3JA 3U9AH 4IGDA 1FY4A 1GJ6A 1AY6H 3MU1A 2YUBA 3ZYDA 2ALVA 1GBFA 2D90A 4AZ2B 1GBKA 2C8XB 4Q6SA 2Q6DA 3MU4A 1FNIA 1HRTH 1UVUH 3PWBA 1QJ1B 4IS5A 3PTNA 1RTFB 1UEWA 3HVQC 2QXHA 4BAKB 3L4FD 1P2NA 1G3BA 1TALA 1D6RA 1SGIB 4GLYA 3UFAA 2RCEA 1P3EA 1EB2A 1QAVB 1UVSH 6ESTA 5FPYA 1C5LH 3AVZA 1GJDB 5F8TA 2P3WA 1P8VC 5DGJA 3VQGA 2RG3A 3FP7E 1TB6H 2BD8A 3QZRA 4X1PU 3FZDA 1GBJA 3L33A 4K1SA 3K6ZA 1YF4A 2KJKA 3OYPA 1L4ZA 1HXEH 1RRKA 1TNLA 1NTPA 2VINA 4Q7ZA 3T26A 4Y71A 3WKMA 2K1QA 1C5SA 3G01A 2FMJA 1DWEH 3QGLA 3SI3H 1ELDE 3NZIA 3RMMH 3CBYA 4K5ZA 5T6FA 1L6OA 2JH6D 4CRBA 4X2XA 2AGGX 2X7ZA 3LPRA 5E0GA 2C8YB 4HZHA 1Y5AT 3T2NA 1RGRA 1ZSLA 3ZZ6A 3ID4A 4BTTB 1FMGA 1ZTJA 3TPIZ 1Z1JA 1GJ5H 1GWAA 1IQHA 1RY4A 1V6BA 2W4FA 1J15A 4CBOA 1KXCA 1B5GH 1HAIH 3PV4A 1GI4A 1K22H 1NFUA 3LGVA 1C2DA 3BG8A 3M7QA 1WI2A 2O8TA 3SUZA 1WQSA 3Q3XA 4E06H 1RTKA 2C8WB 4OS4A 5B6OA 1GMDG 1V2MT 3OX7U 2VWOA 3SHCH 2BLVA 1KTTB 2HNTC 1TGNA 2BXUH 2HNTE 3ODDA 3ZV8A 2GVFA 4WXVA 2PKUA 2Z3DA 1BRBE 1KDQB 2OC0A 4JZEH 5DKMA 2J2UA 5AVDA 3C27B 4YZUA 1SOTA 1FAKH 3GY4A 4Y79A 1TIOA 4CH2B 3GY3A 1GI5A 1Z7KA 4BXWA 4XFQA 2NU2E 5BRRE 1FQ3A 1OPHB 1EATA 1O2WA 4JK5A 4OGYA 2VWLA 3R0FA 5AFYH 2WINI 1V2WT 1BIOA 4ZH8A 2EI7A 2JXOA 4G69A 1D6WA 1MMJN 1EAIA 2BLQA 3VXFH 1P2QA 4NXRA 1VCQA 4GPGA 4ABEA 4X6PA 1PPEE 2NU0E 3TGIE 1IQIA 2ZHWH 1TABE 4NFEA 3U8TH 1Q3XA 1BMNH 1T7CA 3FY5A 4Q2QA 1V1TA 1N8OB 2ANMH 1GHWH 1LMWB 5A0CA 2CSJA 3BTWE 4MDSA 4XOJA 2EA3A 4X8VH 1A0LA 1TWXB 1UTKA 2ZECA 5A2MH 1O2LA 2ZU3A 3V13A 3SN8A 2BY9X 5G4BA 1QAVA 2REYA 1DSUA 1O2GH 1N6XA 4CBNA 1D3DB 1MKXH 1A46H 3LKWA 3SUEA 1O3MA 2BD2A 2BQ6B 3E0PB 2HE4A 1W10U 4RSPA 1WIFA 4WYTA 2PKSB 1FDPA 3F1SB 1BA8B 3ZZAA 6CHAB 3UY9A 2PUXB 1K32A 1C4Y2 1T31A 4ABDA 1AVWA 1O3FA 2BOKA 1RGWA 1ZRBA 1X6DA 3GICB 3RL7A 1GBMA 5EYZA 3V3MA 2BY6X 5A8XA 1S85A 1DS2E 1GCDA 1SMFE 2VZ5A 2FIRH 2ZCLP 3LH1A 3PMBB 4B73A 5LPRA 1BZXE 2VPHA 1O5EH 5DPAA 1ZJDA 1K28D 1HPGA 5EGMA 3VFEA 4NNMA 2KYLA 5I25A 2LC6A 4H11A 2HE2A 2R4HA 1ELEE 1EPTA 1GJCB 2XXLA 3AW0A 1TRYA 1ESTA 2F9PA 1P57B 2ZA5A 2QF3A 3KQCA 4AG1A 2Z9JA 5A0BA 1GMCG 2ZDNA 1SSXA 1C2HA 1S81A 4AFZA 1WFVA 1EPTC 5A8ZA 1DUAA 2EEGA 3MH6A 2UZCA 1B8QA 1BBRH 2WUCA 1F0TA 3TU7H 7KMEH 1KWAA 1J14A 1KYNA 1U38A 1C2LA 5IYTA 2QXJA 2A5AA 4Z33A 1PQ7A 1ZPBA 1ETSH 4Z8JA 3QTOH 1A4WH 4I33A 4WH6A 5F6MA 1C2JA 3EE0B 3E90B 2HOBA 3A7TA 1PPBH 1OBYA 4JYVH 1GJ8B 4Q2KA 2C90B 1FPHH 2Y7XA 1GCTB 1SGNE 3RC5A 5F3XA 4RKJB 4UDWH 1WBGB 1C5UA 1GQ4A 4OS5A 1KDQA 2A2XH 1YBWA 1KXDA 2PKTA 3V12A 4OEOA 3LJOA 4AB9A 1T8NA 1GBAA 2VH6A 1KEFA 3T25A 3QGNB 2FOCA 2NU4E 1WFGA 1ACBE 1OYTH 1MC7A 4K1TA 1A5IA 4KELA 1MKXK 4X1QU 1YLDA 1BUIA 3A89A 3EA8A 3BEFB 1O2NA 2BZAA 1YC0A 8LPRA 1YPJH 2ZTXA 1PYTD 1RTLA 1HAHH 3UWIA 5E1YA 5D13A 1FAXA 1S0RA 5HFDA 1H4WA 1TPSA 3MHWU 3RXBA 2VH0A 1UO6A 1B0FA 1UTMA 2TIOA 1TX7A 1OP2A 9LPRA 1THPB 3MNCA 1G3EA 3UIRA 4TWYA 1HJ8A 2SGDE 4ZAEA 1TA6A 5JBAS 1KIGH 4D8NA 1N7FA 1D4PB 1AB9B 4DGJA 1O5FH 1E34B 1SBWA 1IU2A 2ODQA 3QN7A 1CGIE 3M5LA 1IOEA 2I04A 2PHBA 2I4SA 4X8SH 1YGCH 4ISNA 4IBLH 2VGCB 3GY8A 1N8OC 2FOHA 2VIQA 1C5OH 1M9UA 1C1QA 1OWHA 1SGPE 1A7SA 2LC7A 2STBE 5TCCA 3TK5A 3P8GA 3PWCA 1BBRK 3FAOA 1BOQA 1QL9A 1ORFA 3GCHB 1WJLA 5G1EA 1T32A 3OTPA 1FPCH 2VRFA 2UWLA 1FY5A 2TPIZ 2BD9A 3SU4A 1K1NA 2PKSC 2VSPA 4A92A 2Q6FA 1WOFA 6CHAC 1F2SE 4BAQB 1H9HE 3E0NB 3ZVGA 2OQSA 3EDXB 3O8CA 2PSYA 5FB8C 1CHOF 3CBXA 1ZGIA 2M0VA 4I7YH 1VITH 2Z7FE 5EPNA 1MAYA 2FX4A 3Q00A 3KN2A 3QJNA 5TCAA 2YT7A 5HM9A 2EDPA 3PV2A 3N7OA 2EV8A 1X5RA 3K6YA 2IOTA 1QCPA 4FUFA 2QKUA 3GCOA 1V2RT 2OLGA 1ZPZA 1BBRE 4ZKOU 1TMTH 1B0EA 4CRCA 1HV7A 1CO7E 1D3QB 4KP0A 4MTBA 4X2WA 4L8NA 1CGHA 1KXEA 2GX4A 3QIKA 2FX6A 2HWLB 5A8YA 1ARBA 3LOXA 2XYAA 1S84A 1FY8E 1WF8A 3SV2H 3T62A 1EAWA 1XUFA 1SC8U 3LGWA 2KQFA 2YUYA 1E37B 1L0ZA 4AFSA 3VPKA 1JRTA 3RXJA 5GIBA 1DT2A 2H9EH 2H5DA 1V5LA 2GKVE 2AMQA 2GDDA 2JINA 2BD4A 3BTHE 5GLJA 5DTHA 2THFB 4ABJA 3M61U 4CRDA 1QL8A 4LXBH 4U01A 3R68A 1GCTC 1KLIH 3F9FA 5AHGH 4I8GA 1UJVA 3A84A 3A7WA 8KME2 3ZZ7A 2GTBA 2BXTH 1UJUA 3WKLA 1AFEH 2YNBA 1ABJH 5HM2A 1XUGA 4BXSA 3S69A 3UQOA 1Z8IB 2QCYA 2Z94A 4NMQA 2A5KA 3SQEE 1GDUA 1HAYB 1AHTH 2FEQH 4DY7B 2XNIA 2FI5E 1NFYA 4WF8A 1UEZA 1LVMA 3KEEA 1C5TA 4XBCA 5HMAA 1GHXH 2OXSA 5JBCS 4JL7A 4BNRA 2EI8A 4B2AA 2O8MA 4N6XA 1ESAA 4IMZA 1Y3YA 8GCHG 3BF6H 2OQUA 2STAE 5E2OA 5C20A 4K1EA 2R3YA 1UVTH 1ZHRA 2BM2A 2IWOA 2I6VA 1BRAA 4B1TA 1O2RA 3A8DA 5FX5A 4AX9H 1FIZA 2ZFQH 2HNTF 2AIQA 1GHBF 4I8LA 4ZHAA 1V3XA 1TX8A 2H2CA 2ZFRH 1QRZA 1FY1A 2QC2A 2GT7A 5FCKA 4GSOA 2ZTYA 5G1DA 3A7XA 4AGKA 2Z17A 5LPEA 4P0CA 1LPGB 1GBEA 2BX4A 2FP7B 1XUIA 1ZHPA 3CP7A 2FN5A 3GJ9A 2TRMA 1Z8RA 3B8JA 1SG8B 1SLVB 4Y0ZE 2ZG0H 2BY8X 4NXQA 2CV3A 3BTTE 2JILA 1KTSB 2AINA 1WV7H 2HLCA 5F03A 3HPKA 2D1JA 4GHQA 3BTKE 5EW1H 3CC0A 4NSYA 2VB0A 3QJMA 1SGFA 1XVOA 1PPFE 2WV5A 1T8LA 1BE9A 3ZRTA 5DO4H 1MU6B 1O5AB 2V35A 4Q7XA 2F91A 4HOPB 3TGKE 2A4QA 3EA7A 1JWTA 4D9RA 5AFZH 3MOCA 5DP7A 5GWZA 3ZZ4A 4YOGA 2DM8A 1TQ0B 1GI0A 3CENA 5CE1A 1EXFA 5CHAB 2Q9VA 1B7XB 4I32A 4CRAA 2KJDA 1P3CA 3EA9A 3RLYH 1EKBB 1QB9A 1QNJA 2WPIS 3P17H 1H8IH 1AGJA 1BMLA 3MNSA 3GY7A 2AYWA 1EZXC 4ZROA 2C93B 2ZFPH 2FWWA 4UFDH 4XBBA 3K1RA 1HYLA 2CHAB 1UHPA 1HJ9A 4WJG2 3ZZ3A 3TH2H 3PLPA 3OTJE 4JZDH 2F0AA 1O36A 1PQ5A 1UHBA 1A61H 1HFDA 4ISOA 1UITA 1DUEA 3DHKH 3UTUH 3Q76A 4JOEA 3NFLA 2JKHA 1JXPA 1PPCE 2BD7A 1GVZA 1W9QA 2B5TB 3QO6A 2SGFE 1FZZA 1X8SA 6GCHG 5GCHF 1UJDA 1GBIA 2D26C 1OWIA 4R2ZA 4WMDA 3SNEA 1O3IA 3KF2A 3AAUA 4NIYA 3TK6A 2A32A 2ALPA 1HAOH 1GMHG 4D7GA 2F9VA 2CMYA 1MFLA 1D5GA 1UJ1A 2ZHQH 2EC9H 2WPJS 1Q2WA 2UUKB 2RA3A 3ID3A 1JIMA 1LQDB 1T8OA 2QBWA 1A5GH 4Y0YE 2BDYA 3RC4A 4NZQA 1BJVA 1QJ7B 2KAWA 1OWJA 1SGYE 3K2UA 1C5MD 3E17A 2BMGB 3R69A 3UWJH 5LGOA 3RMLH 2IPHA 3TGJE 2CF8H 1CA8B 1F0SA 1THSH 4MPVA 1Z6EA 1OWEA 2ZFTA 1V2NT 2Y80A 3I29A 1FC6A 1C5RA 3BTDE 4X6MA 1BFEA 1GHYH 2OCVB 1KLJH 3P8OA 4K60A 1CBWB 2RDLA 4FUEA 1S83A 2AGEX 1FIWA 1ELBA 1F7ZA 4TYDA 2ZGJA 3SU3A 3VB7A 1L2EA 1SQTA 4DOQA 2IWQA 1GBHA 2OBOA 1P10A 1HUTH 3FP8E 3VXEH 2QG1A 2ZF0H 1VZQH 3DUXH 2PTNA 3TJVA 7ESTE 1C1UH 3KZEA 5F8XA 5EODA 3ZVEA 1EZQA 2BQWB 1XX9A 2XC4A 1TMUH 3ZYEA 3MH4A 2Z3EA 2ZU4A 1VGCB 3KZDA 1XUHA 5GXPA 1D3TB 2PA1A 1U3BA 2WUBA 3QX5H 4UD9H 1U37A 1A3EH 4FUJA 3HK3B 4DIIH 4GVDA 2KRGA 3SV9A 1GI8B 1TGSZ 2ZGHA 3SZNA 2Y5HA 2WYGA 2KBSA 2OSGA 4HOPA 1SR5C 2ZGBH 4IN2A 1EP5A 1V62A 3ZVFA 2EGKA 2O8WA 2FDAA 8ESTE 1DXPA 1QURH 3NWUA 2OTVA 1K1IA 3LGIA 1GGDC 2ZFSA 4JCNA 6LPRA 2G5NA 1O37A 3DA9B 3DFLA 1WUNH 4ABIA 4B76A 1ZMNA 1FV9A 1N6EA 1YPKH 1Z71A 2O9QA 1DY9A 2J94A 1ZTLA 1ETRH 2ZGCA 1HDTH 1QBNA 1C1SA 1BTXA 1GBBA 1F5KU 3A87A 1PPGE 4K76A 1TP3A 3I1EA 2P3TB 1YPMH 5I7ZA 2FYRA 2QY0B 3MYWA 4XDEA 2BD5A 3C1KA 5CHAC 1EJMA 5DP8A 2NU3E 1NN6A 4FU7A 4HGCA 2LNCA 3TH3H 4MQAA 4ABBA 1TNKA 4NIWA 4F49A 4CREA 1ZUBA 3SORA 1FXYA 2ODYB 2CHAC 1ELCA 1PQAA 1O3OA 1QB6A 3HKJB 1IU0A 1Y3XA 4FU8A 4HTCH 5DP4A 5JBTA 2M0UA 3VQFA 3RLWH 1GHAF 1OP8A 4HI3A 1X45A 2R3UA 1A5HA 1LVBA 2FXRA 3TK9A 4HFPB 1ZHMA 3U8RH 2XBWA 1EPTB 1UFXA 3M35A 3U98H 3D49H 4ZHLU 3RM0H 1VJAU 3PMJA 1UTNA 1XVMA 1H8DH 1GL0E 1QBVH 2JWEA 2A7CA 1SQOA 3LONA 3K50A 1SLXB 1Y7NA 1MD7A 4XSKU 2RRMA 1NM6A 2GZ7A 5JDUB 2BDIA 3B23B 1SFQB 4K69A 1SGCA 4GVCA 2P94A 2FCFA 3PV5A 1PFXC 3VGCC 2I1NA 1O2VA 1CVWH 5F67A 1ZPCA 1DWBH 3SHUA 1MUEB 2I6QA 1HNEE 2ZPSA 2OS6A 1EJNA 1CT0E 2R9PA 2H2BA 2D8WA 2HPPH 1R6JA 2J92A 2ZZUH 4U30A 2CGAA 1D9IA 2KOMA 4X8UH 4B74A 5EXMA 3A88A 4NMVA 1CBWC 2GGVB 2EGNA 2ZTZA 2GDEH 3SGBE 1MU8B 1P09A 4BAHB 4RN6A 3MI4A 1O3DA 1TBRH 1ZSKA 3SNAA 2NWNA 1C2MA 5HXFA 3SO3A 1A3BH 2JIKA 2ENOA 3QDZB 1HAVB 1MCVA 4YM9A 3VB6A 2YTWA 1CE5A 1C1TA 3A8BA 3FANA 3BIUH 4NNLA 1OZIA 4UFFH 3SU5A 5FBEA 4DW2U 3DJAA 4ASHA 5HETA 2GV6A 1UM7A 1QB1A 1VGCC 2ANKH 3W94A 1Z87A 1BTUA 5AF9H 2ZI2H 1GVLA 4YLUA 3DFJA 1ARCA 2PTCE 1W0YH 3RM2H 3MO3A 4JOHA 3MWIU 3S9CA 1SPJA 2G81E 2ZP0H 4IMQA 4KGAA 1K2I1 3T5FH 3RXSA 1CT2E 3JXTA 1YPHE 2B9LA 2KL1A 1O2XA 2TGTA 2B8OH 3A8AA 4NMOA 4AOQA 3LGTA 1O5BB 2F3CE 1XZ9A 2EI6A 2D2DA 3T29A 1O5GH 1NTEA 2QA9E 2VVUA 2CSSA 2FOEA 4I8KA 5HEYA 1MKWH 3SJ9A 4JYTA 1LHGH 1SGDE 2G4TA 4FUHA 3VB3A 3HGPA 5C1XA 3LIWA 1L4DA 3K82A 3OU0A 2BY5X 1MTUA 3RXUA 1O2JA 5E0HA 1KLTA 2OC1A 2OUAA 1AZZA 5JYIA 1QQ4A 3AAVA 2ZDMA 5J4SA 1K9OE 4FU9A 2TBSA 3RDZA 4NFFA 1I16A 2W26A 1HBTH 2A0QB 1OX1A 1PJPA 3TNSA 1BT7A 1TMBH 1Z6JH 1J17T 2VIPA 4O3UA 1UTPA 1QLCA 1OSSA 3GCTF 4FUCA 2OPGA 1VITF 2JREA 1XUJA 1C4V2 3U69H 1XXDA 1TA2A 2KJPA 4AYYB 2ZFFH 1AVXA 1ETTH 3A82A 1LO6A 2BQ7B 1MTWA 4NMTA 4NG9H 1DPOA 2W7SA 2QKTA 1N99A 3RXQA 3E1XB 1OBXA 5DK1A 3KHFA 1O5DH 1SGQE 3F9GA 3MFJA 1P2KA 1V2PT 5K7RA 4Y8ZA 4LOYH 3DJ3A 1O2IA 1ZR0A 5GNDA 1AE8H 1EUFA 2A2QH 1FN8A 4GAWA 1OBZA 5T3HA 3SNDA 1TNJA 1EB1H 2ZHEH 1DVAH 2L4SA 4LZ4B 4Q3HA 3RXGA 4UONA 2SNWA 3SOSA 2G2LA 1JMOH 3ZZ9A 5A09A 2ZU2A 1DICA 3P8NA 4MPUA 5EG4A 2F9BH 3BV9B 2I6SA 4WWYA 2GMTC 3SGQE 1NRPH 3M3VA 4XE4A 1NROH 1G32B 1GHZA 1HAVA 2XTTB 2W3KA 1YM0A 2F9OA 3MU8A 1NZQH 4UFGH 1MKWK 3OY5U 2BVRH 3PMAB 4X2YA 3RMNH 2WV4A 2PDZA 2JOAA 1IQNA 4YLQH 3R3GB 2FPZA 4Q2NA 3SV7A 3GY2A 2WPHS 4D7FA 2P95A 4YO9A 2EEHA 3M7UA 2XCNA 4O03A 3LC3A 4CHAB 3A7VA 3F68H 1O2ZA 5HGGA 1GQ5A 2H1UA 2FODA 4X1RU 4SGAE 1G36A 1QJ6B 3ATKA 1GM1A 1FN6A 5EU8A 4NA9H 1BHXF 4SGBE 2ZCKP 1AIXH 3RXEA 1GI1A 1T2MA 2AFQB 1ZJKA 1TLDA 2LA8A 1BTYA 1C9TA 3PTBA 4E7NA 4B2BA 1VAEA 3CBZA 4XBDA 4MNVA 1Z8GA 4H6SB 1CA0B 3A83A 4OS2A 3SUFA 4ZXXH 4MG3A 1GPZA 4E35A 1EX3A 4E7RG 2AWWA 1YCPH 1C5ZB 2HRVA 1FUJA 3SGAE 3CH8A 5E21A 1GI7B 1AU8A 5T6DA 4F4OC 1BJUA 2OC7A 2ZGXH 3RC6A 2FLRH 2P16A 1O2MA 5EQSA 3F9HA 2WYJA 2FI4E 1SI5H 1GI9B 2VIVA 4AFUA 3ZV9A 4DIHH 1K1JA 1I92A 3RXDA 1O35A 4JYUH 1WF7A 2ULLA 3DT0H 1KY9A
chains in the Genus database with same CATH superfamily
2VIOA 2DLSA 2W7RA 1CHOG 3JZ1B 4B2CA 1O32A 4MNWA 3RXLA 4FETA 1J16A 1ZMLA 5PTPA 1O3JA 1RD3B 2GZVA 1NY22 1ZGVA 3D65E 2M0TA 2Z9IA 1P2MA 1H9IE 4RI0A 4M7GA 3BSQA 4A1TA 1SHYA 3A81A 3M36A 2AERH 1AZ8A 4AYVB 5GPIB 1P12E 1UHBB 2GCHF 1WCZA 3SJKA 3OFND 4TSFD 1O0DH 1NRSH 1YCPM 2Y5GA 2QF4A 2ZPRA 2P8OB 2ZKSA 1TONA 3O8RA 1QGFA 1DFPA 5C2ZA 1ANBA 1HIAB 3A7YA 1SOZA 2BDAA 4YOJA 4KTUA 2KOJA 1AKSB 1V2ST 4I86A 3H7OA 4JZ1A 1YLNA 3I4WA 2AGIX 1CHGA 3VB4A 4X8TH 1TGTA 4MPWA 2FZZA 4NWLA 3SOEA 2V90A 1C2KA 2JETC 2MHOA 1O2PA 1AO5A 3TJOA 1YP9A 1TBQH 1MAXA 2DMZA 2M0ZA 2R0KA 4U2WA 5IDKA 4UFEH 1AI8H 2AMDA 4DCDA 3UQVA 1F0RA 1SVPA 1YCPK 4WY3A 3ELAH 3HKIB 5E22A 2EEIA 1LKAA 1MABB 1HAZB 3TIUA 5F8ZA 2FNEA 1GJ4H 2XBXA 2GCTC 2KV8A 2AIPA 2LPRA 1GI6A 1RGQA 1BHXB 4TPIZ 4LMMA 1CGJE 1BB0B 4TY7A 2VSVA 2R0LA 2G55A 4FUGA 1JBUH 2PGQB 1C2EA 5FL7D 1MZAA 4O06A 1RS0A 1X7AC 2CN0H 3LNXA 2FOBA 1S6HA 3FP6E 5KECA 1JOUB 2ZPMA 1Q7XA 1C4U2 3GY6A 2UWOA 3P70B 1P06A 1O3AA 4A1XA 3RXVA 2GZ9A 3RXRA 4CHAC 3TNTA 1DWDH 1MCTA 2J38A 1WHDA 1HAXB 1QR3E 4E34A 3PROA 2ZC9H 1T8MA 4OEPA 4FVDA 3LC5A 1O2SA 1BITA 3OAAD 4OAJA 2BDCA 1H1BA 3CS7A 2ZCHP 1O3KA 1O31A 3STIA 1O3BA 1S0QA 3Q3KA 1BTPA 1CT4E 2VJ1A 1XXFA 2J34A 1GGDB 3LGYA 4JOGA 3O46A 3GDUA 1MTNB 1CA0C 5E6PB 1G3DA 3D62A 5EQQA 1ZRKA 7GCHF 5HF1A 3BEIB 3PB1E 2ZDKA 4KKDA 5FBIA 1AN1E 1P01A 3NUMA 2E7KA 2W6ID 2I0LA 5H4IB 1Y8TA 1C2GA 3KIDU 2M5TA 2FI3E 3GYMA 1O2QA 3M37A 3MO6A 2F9UA 1D3PB 1O38A 3DSGA 1HAGE 1TNHA 2OP9A 2OCSA 3SHAH 1MH0A 1ESBA 3H5CB 1P1DA 1K1LA 2KAIB 1G2MA 1JRSA 2K20A 3D23A 1UTLM 3KGPA 5HJ1A 1NT1A 3M3SA 2G8TA 2HGAA 5EW2H 3V7TA 3ESTA 3IG6B 1NU7B 2EHRA 1K1MA 2PGBB 2R2WU 1KXAA 4X1SU 1TPPA 3NXPA 4ISLA 1G2LA 3R0HA 1UK3A 1S5SA 2QAAA 3EAJA 1WTHD 1P9UA 3F9EA 1TNGA 4HG6A 1QRXA 4Y7BA 1HJAB 1HIAA 4FUDA 4IC6A 5GCHG 2FESH 2WPMS 4Y8XA 1O3GA 1AKSA 2XBVA 5C5OA 2RA0A 3TVJB 1C1VH 2YNAA 2G52A 1DY8A 5JPMH 2XWBI 2FS9A 2P8OC 3QZQA 5I46H 1N6FA 1GJ9B 1QQUA 2FM2A 2F9NA 1SGTA 5IK2D 2OINA 1W9EA 4NIVA 4ACBA 4GHNA 3UOPA 5DJ7A 2XBYA 5ESTE 3DSPA 1E1RD 5C0UA 1LPKB 2GT8A 1AVGH 4B75A 3VGCB 1QBOA 2KOHA 1Q3OA 5DP3A 1DOJA 3I18A 2GD4B 4OS1A 2ZQ2A 3KHVA 1LCYA 1BMMH 1QL7A 1Z8JB 5T1VA 2AWXA 3U28C 3SU1A 1LTOA 2C8ZB 3UOUA 2ZPQA 5EOKA 2M3MA 5EZ0A 2V3HH 1QTFA 1UK4A 2EQNA 1N7TA 1P03A 1TOCB 4MNYA 4JOFA 1TPAE 2O8UA 2H3MA 3I77A 1Y59T 2SNVA 3Q77A 5LH8A 2IJOB 3ZZ8A 1IAUA 4TWWA 4JORA 4FXGH 2A7JA 4ABFA 4Z6AH 1IQFA 1NRRH 2PFEA 1VR1H 1C5WB 2BHGA 4Y76A 4O9VA 1EOJA 1NC6A 3STJA 3KQDA 3RXHA 4CRGA 1P2IA 2P59A 1EFRD 4GCHF 2PW8H 1SQAA 3FFGA 2V0BA 2ZDLA 1N6DA 5HEDA 1OOKB 2XC5A 1U6QA 2J5UA 3JZ2B 3KL6A 3RU4D 1HAPH 1XUKA 2ZU5A 2DE9A 1P2JA 4DG4A 4Q7YA 1PDRA 3QDOA 3OEED 1ABIH 1O2KA 4UEHH 5C17A 5C94A 5ETXA 3AXAA 3ZVBA 2HPQH 2QF0A 3O8DA 3LU9B 4VGCB 4U32A 1PPHE 3LGUA 1MTNC 4INKA 3I78A 2AH4X 1GBTA 1ZLRA 1C1NA 2EAQA 3E91A 2BDHA 3KNXA 3S7HB 2EEKA 1WSSH 4A7IB 3EGHC 1P02A 5C0TA 1W11U 2TGDA 3LH3A 3SZEA 1G9OA 3F2FA 1TFXA 1OS8A 3VG8A 5K0HA 3W95A 5EPYA 2VNTA 2KAIA 3PO1C 4MVNA 3M5NA 5FCRA 2EDZA 4MPAA 1O3EA 3HK6B 5L30H 1S82A 3LNYA 1YPGH 4O97A 3AASA 2OGPA 2PKAA 3TSVA 4ASUD 1UEQA 4FOUC 2VVVA 2WZQA 1ELAA 5HYOA 2ILNA 4AC9A 4NA7A 4YYXA 3H7TA 4ISHH 1FLEE 2BLWA 3CNRA 1UVPA 3LT3A 1V2LT 1MD8A 2UUYA 1X9ZA 1XMNB 4LZ1H 4I31A 4NMRA 5HFEA 1GHAG 5B6LA 1BRCE 3IITA 4DT7B 2A4OA 3DORA 1W14U 4A6LA 1HJAC 2AEIH 3LJJA 3ZZCA 1OWKA 3KQEA 3F2HA 3ITIA 1ELGA 2BLOA 2A7HA 1N1LA 1YBOA 2GJGA 5DP6A 2J97A 1WDIA 3ID1A 4IC5A 1EAUA 3B9FH 3RXTA 3MNXA 4CH8B 2QYIA 4ZUHA 3TH4H 3Q3YA 3GY5A 2QXIA 1GG6B 2UUFB 1TRMA 1SGEE 3GISB 1UTQA 3NCLA 3QE1A 1W7GH 2Q1JA 2VIWA 1WU1A 3T28A 2FO9A 4A1VA 4MLFB 3E6PH 4NWKA 4X6OA 1A2CH 1O2YA 1E0FD 2UUJB 3ID2A 4KTSA 4Y11E 3UNRA 1J9CH 4FVBA 5DG6A 1SL3A 1MZDA 4Q2PA 2GMTB 4P02A 1L1JA 1O2OA 3GOVB 1LQEA 3OY6U 4E3BA 1G9IE 4K6YA 3UB0A 4AFQA 4KTCA 3RXOA 1ZOKA 2ZU1A 2VU8E 1BTWA 3BG4C 1GDNA 4NZLA 4OS6A 4Y10E 1YKTA 5HFBA 1TPOA 1O30A 5CDFE 2BDGA 1GMDF 1QY6A 2GZ8A 1ELFA 1QAUA 3P6ZB 3SHWA 2XC0A 5C67A 1J8AA 3NCVA 1P05A 1IHJA 3L3TA 1KXBA 4JOPA 1MFGA 2V6NA 2KA9A 3BEUA 2G5VA 1OKXA 3M7TA 1Q3PA 3F6UH 1GVKB 2BZ6H 1Y3VA 1C1PA 1IHSH 1CQQA 2JH0D 2B0FA 4AGJA 4NMPA 2J98A 3MH5A 5DP9A 1DDJA 2Y7ZA 4CRFA 1W13U 1GBLA 1LDTT 4J1YA 2FOMB 3KQ5A 3U8OH 3FZZA 1ELTA 1A0JA 3QWCH 4K78A 2ZHFH 2GP9B 3ZZ5A 5C1UA 1TGBA 1LHDH 1RZXA 1Y5UT 1V6DA 1GJAB 2L74A 2QN5T 1YPHC 2ZHDA 4GVUA 4VGCC 3BTFE 5FHTA 2C4FH 1AFQB 3SUGA 1O3PB 2F83A 2BVXH 3GDSA 2FYQA 3SJOA 4NXPA 1W9OA 1C1MA 3PS4A 2QKVA 4ZXYH 3N7DA 4J2YB 2Y6TA 3M5MA 3RXFA 4ZMAH 2YMSB 3SV8A 3QLPH 1T4UH 1ANCA 1IQMA 3NK8A 3S7KB 1L1GA 1GDQA 1UVOA 2PNTA 2V1WA 2H5CA 2H6MA 2OD3B 1DE7H 3TMHA 2OQ5A 3MQKC 2A45B 2A4GA 3O5NA 1THRH 4Q80A 4MPXA 4H42U 2BD3A 2UWPA 2PUQH 1YYY1 2J95A 1PYTC 1WAYB 1LHFH 1MQ5A 1WHAA 1EQ9A 1LHEH 3QTVH 1TQ7B 2ZNKH 2PZDA 5HKKD 1VB7A 1HCGA 1SGFG 1NFWA 1DLEA 2BTCE 3P92A 2TGAA 1ANEA 2WPLS 3BTEE 2VWRA 2FLBH 2D92A 3GCTG 2BDBA 1C1RA 2WL7A 3E3TA 4R0IA 1VITG 4NGAH 1EASA 5LPFA 1AWHB 2L4TA 5E2PA 2YT8A 2KCPA 2DE8A 2Q6GA 3BIVH 1UF1A 2EDVA 3TSWA 1NFXA 3K9XB 3PLKA 3SUDA 4YTAA 3WY8A 1GL1A 1A1RA 4TPYA 4EDJA 3URDA 3BN9A 5SGAE 1CSOE 1HLTH 4WVPE 3RL8A 4K3JA 2W7UA 1ZZZA 1GMCF 1N6YA 2WPKS 3UPEA 1DWCH 1KSNA 2VWMA 1FC9A 4MNXA 4OS7A 4ABGA 2QXGA 1GG6C 2JETB 2OC8A 4FUBA 1IQGA 2ASUB 3ATIA 4AN7A 2DC2A 1S6FA 4WXIA 4BOHA 2CK3D 4K2YA 3FN8A 3K65B 1X5QA 3SBKA 2ODPA 3E16B 5JB8S 1OHHD 2PV9B 4AB8A 2FOFA 1C5PA 5L2ZH 2SGPE 2K1ZA 3A7ZA 2R2MB 5HIZA 2BYAX 2JH5D 1O3HA 3FOAA 1TRNA 1OWDA 3QGJA 2GCTB 2L6OA 3PRBA 4BANB 3TJUA 4UU5A 3VEQB 3RXCA 1YY3A 2VVCA 3MU0A 5HFFA 3UR6A 1RFNA 5C3NA 2SGEE 2GEFA 3SNBA 4D9QA 3ATMA 4NCYA 5HDYA 2PR3A 1U39A 2PLXA 1LKBA 4IW4E 5A2PA 1NS3A 3MH7A 4X2VA 1RIWB 4X1NU 4KFVA 1P11E 3ZVDA 3P95A 5B42A 1SLWB 1NRNH 3O8BA 1QA7A 5HEBA 3SFJA 1IQJA 2A4RA 4YT7H 3URCA 1LHCH 3HGNA 4O3TA 4ZKSU 3UUZA 1ZTKA 2BYGA 2RCZA 1NBMD 3SU6A 1HXFH 2ANWA 1DITH 5T6GA 2MX6A 4FGMA 5HFCA 1FONA 2CXVA 5J4QA 4AG2A 2ZDVH 2LUIA 4H6TA 1NESE 3PYHA 1QA0A 1O39A 1Q31A 1FCFA 3S9BA 2HGTH 1XM1A 5BPEA 3DIWA 4I8JA 2AWUA 4LK4A 3ZVCA 1F92A 1GJBB 3VB5A 1BQYA 1AFQC 3MTYA 1CU1A 3SU0A 1KXFA 1SB1H 4X0WU 4JOKA 1GBCA 4NSVA 1RJXB 2D8IA 2QT5A 1AUJA 2B7DH 4ACAA 2Y81A 1X5NA 5EXLA 2IWPA 4K8YA 4K8BA 4IN1A 1PQ8A 5FXLA 3UR9A 4YDPA 2AS9A 3RMOH 5KEDA 2V3MA 4CR5A 1FI8A 3OSYA 2XW9A 2DUCA 2BX3A 1A0HB 1TNIA 4ABAA 4ZHMU 1P0SH 1NU9A 3SJ8A 1C2FA 3T27A 3TSZA 1KMHB 2ZWLH 2EJYA 3HATH 2DKRA 1C1OA 3SYJA 2VWNA 2GV7A 4Q2OA 1RXPA 2ZDAH 1ZYOA 1TAWA 1UEPA 4F8KA 3F0OA 2FTLE 1AQ7A 4INLA 2G4UA 1ANDA 1MBQA 2P3UB 3TITA 3BTME 3TLOA 5ABWA 4PQWA 3GGEA 1TGCA 5FX6A 2PWXA 1WG6A 2BVSH 2OBQA 2VIDA 2GCHG 1P2OA 1EOLA 3NPSA 3A86A 4H4FA 3EYDA 5EQRA 5E0JA 3A8CA 2L97A 4K75A 3HPTB 4JMYA 4B71A 4D76A 2QE7D 2G51A 2P93A 1VA8A 4DJZB 1LPZB 2W3IA 4DVAU 3PDVA 3U1JB 1F5LA 1NF3C 2IWNA 3V0XA 1V5QA 1AMHA 1V2KT 1ELVA 1TX6A 1AUTC 4INHA 2ZIQH 4I8HA 2KR7A 3ODFA 1W2KH 4Y6DA 5FPSA 1F0UA 4GUXA 2BB4A 2IPQX 2H9TH 4OGXA 4R8TB 3SV6A 3ZVAA 1GI3A 4JOJA 5C1YA 3UNQA 1C5XB 3QK1A 4ZKNU 1OP0A 2V3OH 3BTQE 3U1IB 4Y7AA 1EJAA 1DSTA 1C9PA 4Y8YA 2I0IA 1P04A 3RP2A 3IWMA 4AMHA 1EZSC 2ANYA 2FOAA 2KPLA 1VCPA 2W5EA 2ZQ1A 3QUMP 3NKKA 1NRQH 2O8LA 3LDXH 1DXWA 3NGHA 3PLBA 3DSOA 4NIXA 2Y82A 3SI4H 4WH8A 2H2ZA 4WYUA 1IQEA 1WH1A 1DLKB 4YT6H 3RUOA 2BOHB 4JZFH 3MNBA 4UU6A 2M10A 1UMAH 3M5OA 1BCUH 1L1NA 4YESB 4BTUB 4K72A 1GHBG 1RIWC 4RKOB 1BMAA 1GHVH 1FX0B 1V2TT 1OXGA 5EXNA 1UCYH 3S0NA 1BTZA 1TBZH 3EGGC 2FOGA 4P2AB 2P3FH 4PROA 3SU2A 8GCHF 1ZMJA 2AHME 4ESTE 3E8LA 3SW2B 1T4VH 5TJXA 1HB0B 1LVYA 3A80A 2C3SA 1C5QA 1Z86A 1C5VA 2TGPZ 2SGAA 3KQBA 4BAMB 2XWAA 3CS0A 1MQ6A 4REYA 5GJ4B 1EAXA 3ENSB 3RXAA 3PDZA 3EQ0H 3KYGA 1SHHB 3N99A 1O3LA 5E11A 3UNSA 4AORA 1BRUP 2QIQA 1TOMH 2ESTE 1AB9C 1E38B 3RU4T 2CJIA 7GCHG 3KCGH 3RXKA 1ZOMA 2KCOA 2ZEBA 2FTMA 1W12U 4BAOB 4GHTA 1DM4B 2XRCA 2VGCC 3GDVA 1XKAC 5JBBS 1YPEH 1MBMA 3KDGA 3PO1B 1M5ZA 2Q3GA 1ID5H 5DP5A 1F5RA 1P1EA 7LPRA 4TY6A 2KPKA 2AMPA 3FVFB 1WYKA 3BTGE 1UK2A 2CS5A 1G3CA 4DURA 1O3CA 4JZIA 1QRWA 4Z0KA 1E36B 1VJ6A 3GCHC 5JXBA 2LOBA 1W3CA 2A5IA 2FS8A 1W0ZU 2H9HA 5KGOA 1GJ7B 1SFIA 4WMFA 3MU5A 1C2IA 1Y3WA 3P8FA 5FPTA 2O2TA 1IQLA 2KG2A 1V2VT 4NMSA 2A31A 5JB9S 1UTOA 5L2YH 3AW1A 1O3NA 2G00A 2PKAB 3PMHB 1MTVA 5ESBA 1E35B 2HALA 1DANH 3RXIA 2F5YA 1MTSA 1JIRA 2XCFA 3UREA 1QHRB 3EGKH 1FJSA 5CMXH 1S6LA 1YLCA 1OYQA 1PPZA 2DB5A 3ZZDA 3A85A 1QIXB 1GI2A 1LVOA 3BPUA 1W7XH 1WQVH 3DD2H 1UM1A 4THNH 1O5CB 1UTJA 2NU1E 2H3LA 1QFKH 1O2HA 1K21H 1UCYK 4ABHA 4JK6A 5A0AE 1TE0A 2A1DB 2Z9GA 3RU4E 3ZZBA 6GCHF 1NO9H 2SFAA 2Y5FA 3GCNA 5L6NH 1TQ3A 3GYLB 1SLUB 3MO9A 1Y3UA 1BDAA 1EZUC 1WI4A 1O2TA 1GMHF 1K1PA 3MMGA 3WWFA 1G30B 2Z3CA 3DJ1A 5E8EH 1DX5M 1O2UA 2ZPLA 4ZKRU 2CF9H 1VJ9U 3RXMA 1Y5BT 1YPLH 1INCA 2BY7X 4YXWD 2Z9KA 1VCWA 3ATWA 1Z1IA 2Z6BD 1XKBC 5HF4A 1O34A 1P9SA 1C5NH 5FAHA 2J4IA 3BG4B 3SJIA 1AD8H 4Q6HA 3GSLA 3S9AA 1G37A 4YOIA 2EEJA 1N7EA 5GDSH 2PSXA 3ATLA 1BTHH 2ZO3H 2DJTA 1COWD 1IQKA 4KFWA 1C5YB 2IN2A 2QV1A 3M3TA 1UCYE 4WMEA 1O33A 4ISIH 2J9NA 1NPMA 2DAZA 4A5TS 3RXPA 1AWFH 1H9LB 4XHVA 4E05H 2EGOA 3RLEA 3CYYA 1TYNA 1FY3A 4X6NA 1SGRE 2EXGA 4FUIA 1EP6A 2DLUA 4GCHG 3NFKA 4QT8C 4UE7H 1WXRA 2SGQE 1C1WH 2WSSD 4CR9A 2HVXA 3HPMA 4NA8A 2G5MB 3B76A 1AE5A 3TJNA 2QGRA 9ESTA 1V2UT 1IHTH 1V2JT 2J98B 1HGTH 2OZFA 1GBDA 1TP5A 1WTGH 4BTIB 4F48B 2K8IA 3SQHE 1W8BH 2YOLA 2Z9LA 1FC7A 1ZSJA 3L6PA 3SNCA 1V2OT 1K1OA 5C5NA 2OMJA 3PM3A 1V2QT 3WWBA 2FE5A 5H3JA 4DT4A 3U9AH 4IGDA 4TT3D 1FY4A 1GJ6A 1AY6H 3MU1A 2YUBA 3ZYDA 2ALVA 1GBFA 2D90A 4AZ2B 1GBKA 2C8XB 4Q6SA 2LP6A 2Q6DA 3MU4A 1FNIA 1HRTH 1UVUH 4Q4LA 3PWBA 1QJ1B 4IS5A 3PTNA 1RTFB 1UEWA 3HVQC 2QXHA 4BAKB 3L4FD 1P2NA 1G3BA 1TALA 1D6RA 1SGIB 4GLYA 3UFAA 2RCEA 1P3EA 1EB2A 1QAVB 1UVSH 6ESTA 5FPYA 1C5LH 3AVZA 1GJDB 5F8TA 2P3WA 1P8VC 5DGJA 3VQGA 2RG3A 3FP7E 3W1EA 1TB6H 2BD8A 3QZRA 4X1PU 3FZDA 1GBJA 3L33A 4K1SA 3K6ZA 1YF4A 2KJKA 3GS9A 3OYPA 1L4ZA 1HXEH 1RRKA 1TNLA 1NTPA 2VINA 4Q7ZA 3T26A 4Y71A 3WKMA 2K1QA 1C5SA 3DCLA 3G01A 2FMJA 1DWEH 3QGLA 3SI3H 1ELDE 3NZIA 3RMMH 3CBYA 4K5ZA 5T6FA 1L6OA 2JH6D 4CRBA 4X2XA 2AGGX 2X7ZA 3LPRA 5E0GA 2C8YB 4HZHA 1Y5AT 5HIYA 3T2NA 1RGRA 1ZSLA 3ZZ6A 3ID4A 4BTTB 1FMGA 1ZTJA 3TPIZ 1Z1JA 1GJ5H 1GWAA 1IQHA 1RY4A 1V6BA 2W4FA 1J15A 3F0PA 2OK5A 4CBOA 1KXCA 1B5GH 1HAIH 3PV4A 1GI4A 1K22H 1NFUA 3LGVA 1C2DA 3BG8A 3M7QA 1WI2A 2O8TA 3SUZA 1WQSA 3Q3XA 4E06H 1RTKA 2C8WB 4OS4A 5B6OA 1GMDG 1V2MT 3OX7U 2VWOA 3SHCH 2BLVA 1KTTB 2HNTC 1TGNA 2BXUH 2HNTE 3ODDA 3ZV8A 2GVFA 4WXVA 2PKUA 2Z3DA 1BRBE 1KDQB 2OC0A 4JZEH 5DKMA 2J2UA 5AVDA 3C27B 2LELA 4YZUA 1SOTA 1FAKH 3GY4A 4Y79A 1TIOA 4CH2B 3GY3A 2KZ4A 1GI5A 1Z7KA 4BXWA 4XFQA 2NU2E 5BRRE 1FQ3A 1OPHB 1EATA 1O2WA 4JK5A 4OGYA 2VWLA 3R0FA 5AFYH 2WINI 1V2WT 1BIOA 4ZH8A 2EI7A 2JXOA 4G69A 1D6WA 1MMJN 1EAIA 2BLQA 3VXFH 1P2QA 4NXRA 1VCQA 4GPGA 4ABEA 4X6PA 1PPEE 2NU0E 2PP6A 3TGIE 1IQIA 1W0KD 2W6JD 2ZHWH 1TABE 4NFEA 3U8TH 1Q3XA 1BMNH 1T7CA 3FY5A 4Q2QA 1V1TA 1N8OB 2ANMH 1GHWH 1LMWB 5A0CA 2CSJA 3BTWE 4MDSA 4XOJA 2EA3A 4X8VH 1A0LA 1TWXB 1UTKA 2ZECA 5A2MH 1O2LA 2ZU3A 3V13A 3SN8A 2BY9X 5G4BA 1QAVA 2REYA 1DSUA 1O2GH 1N6XA 4CBNA 1D3DB 1MKXH 1A46H 3LKWA 3SUEA 1O3MA 2BD2A 2BQ6B 3E0PB 2HE4A 1VKYA 1W10U 4RSPA 1WIFA 4WYTA 2PKSB 1FDPA 3F1SB 1BA8B 3ZZAA 6CHAB 2RFKC 3UY9A 2PUXB 1K32A 1C4Y2 1T31A 4ABDA 1AVWA 1O3FA 4M9FA 2BOKA 1RGWA 1ZRBA 1X6DA 3GICB 3RL7A 1GBMA 5EYZA 3V3MA 2BY6X 5A8XA 1S85A 1DS2E 1GCDA 1SMFE 2VZ5A 2FIRH 2ZCLP 3LH1A 3PMBB 4B73A 5LPRA 1BZXE 2F4LA 2VPHA 1O5EH 3FKSD 5DPAA 1ZJDA 1K28D 1HPGA 5EGMA 3VFEA 4NNMA 2KYLA 5I25A 2LC6A 4H11A 2HE2A 2R4HA 1ELEE 1EPTA 1GJCB 2XXLA 5EIYA 3AW0A 1TRYA 1ESTA 1NBME 2F9PA 1P57B 2ZA5A 2QF3A 3KQCA 2HLDD 4AG1A 2Z9JA 5A0BA 1GMCG 2ZDNA 1SSXA 1C2HA 1S81A 4AFZA 1WFVA 1EPTC 5A8ZA 1DUAA 2EEGA 3MH6A 2UZCA 1B8QA 1BBRH 2WUCA 1F0TA 3TU7H 7KMEH 1KWAA 1J14A 1KYNA 1U38A 1C2LA 5IYTA 2QXJA 2A5AA 4Z33A 1PQ7A 1ZPBA 1ETSH 4Z8JA 3QTOH 1A4WH 4I33A 4WH6A 5F6MA 1C2JA 3EE0B 3E90B 2HOBA 3A7TA 1PPBH 1OBYA 4JYVH 1GJ8B 4Q2KA 2C90B 1FPHH 2Y7XA 1GCTB 1SGNE 3RC5A 5F3XA 4RKJB 4UDWH 1WBGB 1C5UA 1GQ4A 4OS5A 1KDQA 2A2XH 1YBWA 1KXDA 2PKTA 3V12A 4OEOA 3LJOA 4AB9A 1T8NA 1GBAA 2VH6A 1KEFA 3NRLA 3QGNB 3T25A 2FOCA 2JIZD 2NU4E 4XRNA 1WFGA 1ACBE 1UW7A 4Z1MD 4RT0A 1OYTH 1MC7A 4K1TA 1A5IA 4KELA 1MKXK 4X1QU 1YLDA 1BUIA 3A89A 3EA8A 3BEFB 1O2NA 2BZAA 1YC0A 8LPRA 1YPJH 1SKYE 2ZTXA 1PYTD 1RTLA 1HAHH 3UWIA 4F55A 5E1YA 5D13A 1FAXA 1S0RA 5HFDA 1H4WA 1TPSA 3MHWU 3RXBA 2VH0A 1UO6A 3F2GA 1B0FA 1UTMA 2TIOA 1TX7A 1OP2A 9LPRA 1THPB 3MNCA 1G3EA 3UIRA 4TWYA 1HJ8A 2SGDE 2JDID 4ZAEA 1TA6A 5JBAS 1KIGH 4FLNA 4D8NA 1N7FA 1D4PB 1AB9B 4DGJA 1O5FH 1E34B 1W0JD 1SBWA 1IU2A 2ODQA 3QN7A 1CGIE 3M5LA 1IOEA 2I04A 2PHBA 2I4SA 4X8SH 1YGCH 4ISNA 4IBLH 2VGCB 3GY8A 1N8OC 2FOHA 2VIQA 1C5OH 1M9UA 1C1QA 1OWHA 1SGPE 1A7SA 2LC7A 2STBE 5TCCA 3TK5A 3P8GA 3PWCA 1BBRK 3FAOA 1BOQA 1QL9A 1ORFA 3GCHB 1WJLA 3KYFA 5G1EA 1T32A 3N7EA 3OTPA 1FPCH 2VRFA 2UWLA 1FY5A 1BMFD 2TPIZ 2BD9A 3SU4A 1K1NA 2PKSC 2VSPA 4A92A 2Q6FA 1WOFA 6CHAC 1F2SE 4BAQB 1H9HE 3E0NB 3ZVGA 5EJ1A 2OQSA 3EDXB 3O8CA 2PSYA 5FB8C 1CHOF 3CBXA 1ZGIA 2M0VA 3GABA 4I7YH 1VITH 2Z7FE 5EPNA 1MAYA 2FX4A 3Q00A 3KN2A 3QJNA 5TCAA 2YT7A 5HM9A 2EDPA 3PV2A 3N7OA 2EV8A 1X5RA 3K6YA 1K0HA 2IOTA 1QCPA 4FUFA 2QKUA 3GCOA 1V2RT 2OLGA 2KCYA 1ZPZA 1BBRE 3OEHD 4ZKOU 1TMTH 1B0EA 4CRCA 1HV7A 1CO7E 1D3QB 4KP0A 4MTBA 4X2WA 4L8NA 2QF5A 1CGHA 1KXEA 2GX4A 3QIKA 2FX6A 2HWLB 1YWUA 5A8YA 1ARBA 3LOXA 2XYAA 1S84A 1FY8E 1WF8A 3SV2H 3T62A 1EAWA 1XUFA 1SC8U 3LGWA 2KQFA 2YUYA 1E37B 1L0ZA 4AFSA 3VPKA 1JRTA 3RXJA 5GIBA 1DT2A 2H9EH 2H5DA 1V5LA 2GKVE 2AMQA 2GDDA 2JINA 5IL9A 2BD4A 3BTHE 5GLJA 5DTHA 2THFB 4ABJA 3M61U 4CRDA 1QL8A 4LXBH 4U01A 3R68A 1GCTC 1KLIH 3F9FA 5AHGH 4I8GA 1UJVA 2HVYB 3A84A 2YMSD 3A7WA 8KME2 3ZZ7A 2GTBA 2BXTH 1UJUA 3WKLA 1AFEH 2YNBA 1ABJH 5HM2A 1XUGA 4BXSA 3S69A 3UQOA 1Z8IB 2QCYA 2Z94A 4NMQA 2A5KA 3SQEE 1GDUA 1HAYB 1AHTH 2FEQH 4DY7B 2XNIA 2FI5E 1NFYA 4WF8A 4ZCNA 1UEZA 1LVMA 3KEEA 1C5TA 4XBCA 5HMAA 1GHXH 2OXSA 5JBCS 4JL7A 4BNRA 2EI8A 4B2AA 2O8MA 4N6XA 1ESAA 4IMZA 1Y3YA 8GCHG 3BF6H 2OQUA 2STAE 5E2OA 5C20A 4K1EA 2R3YA 1UVTH 1ZHRA 2BM2A 2IWOA 2I6VA 1BRAA 4B1TA 1O2RA 3A8DA 5FX5A 4AX9H 1FIZA 2ZFQH 2HNTF 2AIQA 1GHBF 4I8LA 4ZHAA 1V3XA 1TX8A 2H2CA 2ZFRH 1QRZA 1FY1A 2QC2A 2GT7A 5FCKA 4GSOA 2ZTYA 1E1QD 5G1DA 3A7XA 4AGKA 2Z17A 5LPEA 4P0CA 1LPGB 1GBEA 2BX4A 2FP7B 1XUIA 1ZHPA 1SQRA 3CP7A 2FN5A 3GJ9A 2TRMA 1Z8RA 3B8JA 1SG8B 1SLVB 4Y0ZE 2ZG0H 2BY8X 2M2AA 4NXQA 2CV3A 3BTTE 2JILA 1KTSB 2AINA 1WV7H 2HLCA 5F03A 3HPKA 2D1JA 4GHQA 3BTKE 5EW1H 3CC0A 4NSYA 2VB0A 3QJMA 1SGFA 1XVOA 1PPFE 2WV5A 1T8LA 1BE9A 3ZRTA 5DO4H 1MU6B 1O5AB 2V35A 4Q7XA 2F91A 4HOPB 3TGKE 2A4QA 3EA7A 1JWTA 4D9RA 5AFZH 3MOCA 5DP7A 5GWZA 3ZZ4A 4YOGA 2DM8A 1TQ0B 1GI0A 3CENA 5CE1A 1EXFA 5CHAB 2Q9VA 1B7XB 4I32A 4CRAA 2KJDA 1P3CA 3EA9A 3RLYH 1EKBB 1QB9A 1QNJA 2WPIS 3P17H 1H8IH 1AGJA 1BMLA 3MNSA 3GY7A 2AYWA 1EZXC 4ZROA 2C93B 2ZFPH 2FWWA 4UFDH 4XBBA 3K1RA 1HYLA 2CHAB 1UHPA 1HJ9A 4WJG2 3ZZ3A 3TH2H 3PLPA 3OTJE 4JZDH 2F0AA 1O36A 1PQ5A 1UHBA 1A61H 1HFDA 4ISOA 2JJ2D 1UITA 1DUEA 3WW7A 3DHKH 3UTUH 3Q76A 4JOEA 3NFLA 2JKHA 1JXPA 1PPCE 2KM0A 2BD7A 1GVZA 1W9QA 2B5TB 3QO6A 2SGFE 1FZZA 1X8SA 6GCHG 5GCHF 1UJDA 1GBIA 2IJD1 2D26C 1OWIA 4R2ZA 4WMDA 3SNEA 2VBCA 1O3IA 3KF2A 3AAUA 4NIYA 3TK6A 2A32A 2ALPA 1HAOH 1GMHG 4D7GA 2F9VA 2CMYA 1MFLA 1D5GA 1UJ1A 2ZHQH 2EC9H 2WPJS 1Q2WA 2UUKB 2RA3A 3ID3A 1JIMA 1LQDB 1T8OA 2QBWA 1A5GH 4Y0YE 2BDYA 1E79D 5DSFA 3RC4A 4NZQA 3ZIAD 1BJVA 1QJ7B 2KAWA 1OWJA 1SGYE 3K2UA 1C5MD 3E17A 2BMGB 3R69A 3UWJH 5LGOA 3RMLH 2IPHA 3TGJE 2WHXA 2CF8H 1CA8B 1F0SA 1THSH 4MPVA 1Z6EA 1OWEA 2ZFTA 1V2NT 2Y80A 3I29A 1FC6A 1C5RA 3BTDE 4X6MA 1BFEA 1GHYH 2OCVB 1KLJH 3P8OA 4K60A 1CBWB 2RDLA 4FUEA 1S83A 2AGEX 1FIWA 1ELBA 1F7ZA 4TYDA 2ZGJA 4Q63A 3SU3A 3VB7A 1L2EA 1SQTA 4DOQA 2IWQA 1GBHA 2OBOA 1P10A 1HUTH 3FP8E 3VXEH 2QG1A 2ZF0H 1VZQH 3DUXH 2PTNA 3TJVA 7ESTE 1C1UH 3KZEA 5F8XA 5EODA 3ZVEA 1EZQA 2BQWB 1XX9A 2XC4A 1TMUH 3ZYEA 3MH4A 2Z3EA 2ZU4A 1VGCB 3KZDA 1XUHA 5GXPA 1D3TB 2PA1A 1U3BA 2WUBA 3QX5H 4UD9H 1U37A 1A3EH 4FUJA 3HK3B 4DIIH 4GVDA 2KRGA 2KCAA 3SV9A 1GI8B 1TGSZ 2ZGHA 3SZNA 2Y5HA 2WYGA 2KBSA 2OSGA 4HOPA 1SR5C 2ZGBH 4IN2A 1EP5A 1V62A 3ZVFA 2EGKA 2O8WA 2FDAA 8ESTE 1DXPA 1QURH 3NWUA 2OTVA 1K1IA 3LGIA 1GGDC 2ZFSA 4JCNA 6LPRA 2G5NA 4JJ0A 1O37A 3DA9B 3DFLA 1WUNH 4ABIA 4B76A 1ZMNA 1FV9A 1N6EA 1YPKH 1Z71A 2O9QA 1DY9A 2J94A 1ZTLA 1ETRH 2ZGCA 1HDTH 1QBNA 1C1SA 1BTXA 1GBBA 1F5KU 3A87A 1PPGE 3PRDA 4K76A 1TP3A 3I1EA 2P3TB 1YPMH 5I7ZA 2FYRA 2QY0B 3MYWA 4XDEA 2BD5A 3C1KA 5CHAC 1EJMA 5DP8A 2NU3E 1NN6A 3KDKA 4FU7A 4HGCA 2LNCA 3TH3H 4MQAA 4ABBA 1TNKA 4NIWA 4XD7D 4F49A 4CREA 1ZUBA 3SORA 1FXYA 4B6FA 2ODYB 2CHAC 1ELCA 3F3BA 1PQAA 1O3OA 1QB6A 3HKJB 1IU0A 1Y3XA 4FU8A 4HTCH 5DP4A 5EJLA 5JBTA 2M0UA 3VQFA 3RLWH 1GHAF 1OP8A 4HI3A 3H09A 1X45A 2R3UA 1A5HA 1LVBA 2FXRA 3TK9A 4HFPB 1ZHMA 3U8RH 2XBWA 1EPTB 1UFXA 3M35A 3U98H 3D49H 4ZHLU 3RM0H 1VJAU 3PMJA 1UTNA 1XVMA 1H8DH 1GL0E 1QBVH 2JWEA 2A7CA 1SQOA 3LONA 3K50A 1SLXB 1Y7NA 1MD7A 4XSKU 2RRMA 1NM6A 2GZ7A 5JDUB 2EY4C 2BDIA 1H8HD 3B23B 1SFQB 4K69A 1SGCA 5EJZA 4GVCA 2P94A 2FCFA 3PV5A 1PFXC 3UAIC 3VGCC 2I1NA 1O2VA 1CVWH 5F67A 1ZPCA 1DWBH 3SHUA 1MUEB 2I6QA 1HNEE 2ZPSA 2OS6A 1EJNA 1CT0E 2R9PA 2H2BA 2D8WA 2HPPH 1R6JA 2J92A 2ZZUH 4U30A 2CGAA 1D9IA 2KOMA 4X8UH 4B74A 5EXMA 3A88A 4NMVA 1CBWC 2GGVB 2EGNA 2ZTZA 2GDEH 2WV9A 1MU8B 3SGBE 1P09A 4BAHB 4RN6A 3MI4A 1O3DA 1TBRH 1ZSKA 3SNAA 2NWNA 1C2MA 5HXFA 3SO3A 1A3BH 2JIKA 2ENOA 3QDZB 1HAVB 1MCVA 4YM9A 3VB6A 3AK5A 2YTWA 3FO8D 1CE5A 1C1TA 3A8BA 3FANA 3BIUH 4NNLA 1OZIA 4UFFH 3SU5A 5FBEA 4DW2U 3DJAA 4ASHA 5HETA 2GV6A 1UM7A 1QB1A 1VGCC 2ANKH 3W94A 1Z87A 1BTUA 5AF9H 2ZI2H 1GVLA 4YLUA 3DFJA 1ARCA 2PTCE 1W0YH 3RM2H 3MO3A 4JOHA 3MWIU 3S9CA 5CHBA 1SPJA 2G81E 2ZP0H 4IMQA 4KGAA 1K2I1 3T5FH 3RXSA 1CT2E 3JXTA 1YPHE 2B9LA 2KL1A 1O2XA 2TGTA 2B8OH 3A8AA 4NMOA 4AOQA 3LGTA 1O5BB 2F3CE 1XZ9A 2EI6A 2D2DA 3T29A 1O5GH 1NTEA 2QA9E 2VVUA 2CSSA 5F53A 2FOEA 4I8KA 5HEYA 1MKWH 3SJ9A 4JYTA 1LHGH 1SGDE 2G4TA 4FUHA 3VB3A 3HGPA 5C1XA 3LIWA 1L4DA 4OM9A 3K82A 3OU0A 2BY5X 1MTUA 3RXUA 1O2JA 5E0HA 1KLTA 2OC1A 2OUAA 1AZZA 5JYIA 1QQ4A 3AAVA 2ZDMA 5J4SA 1K9OE 4FU9A 2TBSA 3RDZA 4NFFA 1I16A 2W26A 1HBTH 2A0QB 1OX1A 1PJPA 3TNSA 2JJ1D 1BT7A 1TMBH 1Z6JH 1J17T 2VIPA 4O3UA 1UTPA 1QLCA 1OSSA 3GCTF 4FUCA 2OPGA 1VITF 2JREA 1XUJA 1C4V2 3U69H 1XXDA 1TA2A 2KJPA 4AYYB 2ZFFH 1AVXA 2WPDD 1ETTH 3A82A 1LO6A 2BQ7B 1MTWA 4NMTA 4NG9H 1DPOA 2W7SA 2JSNA 2QKTA 2XOKD 1N99A 3RXQA 3E1XB 1OBXA 5DK1A 3KHFA 1O5DH 4JJ3A 1SGQE 3F9GA 1P2KA 1V2PT 3MFJA 5K7RA 4Y8ZA 4LOYH 3DJ3A 1O2IA 1ZR0A 5GNDA 1AE8H 1EUFA 2A2QH 1FN8A 4GAWA 1OBZA 2KFWA 5T3HA 3SNDA 1TNJA 1EB1H 2ZHEH 2K0QA 1DVAH 2L4SA 4LZ4B 4Q3HA 3RXGA 4UONA 2SNWA 3SOSA 2RDEA 2G2LA 1JMOH 3ZZ9A 5A09A 2ZU2A 1DICA 3P8NA 4MPUA 5EG4A 2F9BH 2F43B 3BV9B 2I6SA 4WWYA 2GMTC 3SGQE 1NRPH 3M3VA 4XE4A 1NROH 1G32B 1GHZA 1HAVA 2XTTB 2W3KA 1YM0A 2F9OA 3MU8A 1NZQH 4UFGH 1MKWK 3OY5U 2BVRH 3PMAB 4X2YA 3RMNH 2WV4A 2PDZA 2JOAA 1IQNA 4YLQH 3R3GB 2FPZA 4Q2NA 3SV7A 4B6EA 3GY2A 2WPHS 4D7FA 2P95A 4YO9A 2EEHA 3M7UA 2XCNA 2XNDD 4O03A 3LC3A 4CHAB 3A7VA 3F68H 1O2ZA 5HGGA 1GQ5A 1QZ8A 3EE7A 2H1UA 2FODA 4X1RU 4SGAE 1G36A 1QJ6B 3ATKA 3OE7D 1GM1A 2V7QD 1FN6A 5EU8A 4NA9H 1BHXF 4SGBE 2ZCKP 1AIXH 3RXEA 5DN6D 1GI1A 1T2MA 2AFQB 1ZJKA 1H8ED 2LA8A 1BTYA 1TLDA 4RT1A 1C9TA 3PTBA 4E7NA 4B2BA 1VAEA 3CBZA 4XBDA 4MNVA 1Z8GA 4H6SB 1CA0B 3A83A 4OS2A 3SUFA 4ZXXH 4MG3A 1GPZA 4E35A 1EX3A 4E7RG 2AWWA 1YCPH 1C5ZB 2HRVA 1FUJA 3SGAE 3CH8A 5E21A 1GI7B 1AU8A 5T6DA 4F4OC 1BJUA 2OC7A 2ZGXH 3RC6A 2FLRH 2P16A 2YMSC 4P00A 1O2MA 5EQSA 3F9HA 2WYJA 2FI4E 1SI5H 1GI9B 2VIVA 4AFUA 5ILBA 3ZV9A 4DIHH 1K1JA 1I92A 3RXDA 1O35A 4JYUH 1WF7A 2ULLA 2KX4A 3DT0H 1KY9A
chains in the Genus database with same CATH topology
2VIOA 2DLSA 2W7RA 1CHOG 3JZ1B 4B2CA 1O32A 4MNWA 3RXLA 1J16A 1ZMLA 5PTPA 1O3JA 1RD3B 2GZVA 1NY22 1ZGVA 3D65E 2M0TA 2Z9IA 1P2MA 1H9IE 4RI0A 4M7GA 3BSQA 4A1TA 1SHYA 3A81A 3M36A 2AERH 1AZ8A 4AYVB 5GPIB 1P12E 1UHBB 2GCHF 1WCZA 3SJKA 1O0DH 1NRSH 1YCPM 2Y5GA 2ZPRA 2P8OB 2ZKSA 1TONA 3O8RA 1QGFA 1DFPA 5C2ZA 1ANBA 1HIAB 3A7YA 1SOZA 2BDAA 4YOJA 4KTUA 2KOJA 1AKSB 1V2ST 3H7OA 4JZ1A 3I4WA 2AGIX 1CHGA 3VB4A 4X8TH 1TGTA 4MPWA 2FZZA 4NWLA 3SOEA 2V90A 1C2KA 2JETC 2MHOA 1O2PA 1AO5A 3TJOA 1YP9A 1TBQH 1MAXA 2DMZA 2M0ZA 2R0KA 4U2WA 5IDKA 4UFEH 1AI8H 2AMDA 4DCDA 3UQVA 1F0RA 1SVPA 1YCPK 4WY3A 3ELAH 3HKIB 5E22A 2EEIA 1LKAA 1HAZB 3TIUA 5F8ZA 2FNEA 1GJ4H 2XBXA 2GCTC 2KV8A 2AIPA 2LPRA 1GI6A 1RGQA 1BHXB 4TPIZ 4LMMA 1CGJE 1BB0B 4TY7A 2VSVA 2R0LA 2G55A 4FUGA 1JBUH 2PGQB 1C2EA 1MZAA 4O06A 1RS0A 1X7AC 2CN0H 3LNXA 2FOBA 1S6HA 3FP6E 1JOUB 2ZPMA 1Q7XA 1C4U2 3GY6A 2UWOA 3P70B 1P06A 1O3AA 4A1XA 3RXVA 2GZ9A 3RXRA 4CHAC 3TNTA 1DWDH 1MCTA 2J38A 1WHDA 1HAXB 1QR3E 4E34A 3PROA 2ZC9H 1T8MA 4OEPA 4FVDA 3LC5A 1O2SA 1BITA 4OAJA 2BDCA 1H1BA 3CS7A 2ZCHP 1O3KA 1O31A 3STIA 1O3BA 1S0QA 3Q3KA 1BTPA 1CT4E 2VJ1A 1XXFA 2J34A 1GGDB 3LGYA 4JOGA 3O46A 3GDUA 1MTNB 1CA0C 5E6PB 1G3DA 3D62A 5EQQA 1ZRKA 7GCHF 5HF1A 3BEIB 3PB1E 2ZDKA 4KKDA 5FBIA 1AN1E 1P01A 3NUMA 2E7KA 2I0LA 5H4IB 1Y8TA 1C2GA 3KIDU 2M5TA 2FI3E 3GYMA 1O2QA 3M37A 3MO6A 2F9UA 1D3PB 1O38A 1HAGE 1TNHA 2OP9A 2OCSA 3SHAH 1MH0A 1ESBA 3H5CB 1P1DA 1K1LA 2KAIB 1G2MA 1JRSA 2K20A 3D23A 1UTLM 3KGPA 5HJ1A 1NT1A 3M3SA 2G8TA 2HGAA 5EW2H 3V7TA 3ESTA 3IG6B 1NU7B 2EHRA 1K1MA 2PGBB 2R2WU 1KXAA 4X1SU 1TPPA 3NXPA 4ISLA 1G2LA 3R0HA 1UK3A 1S5SA 2QAAA 3EAJA 1WTHD 1P9UA 3F9EA 1TNGA 1QRXA 4Y7BA 1HJAB 1HIAA 4FUDA 4IC6A 5GCHG 2FESH 2WPMS 4Y8XA 1O3GA 1AKSA 2XBVA 5C5OA 2RA0A 3TVJB 1C1VH 2YNAA 2G52A 1DY8A 5JPMH 2XWBI 2FS9A 2P8OC 3QZQA 5I46H 1N6FA 1GJ9B 1QQUA 2FM2A 2F9NA 1SGTA 2OINA 1W9EA 4NIVA 4GHNA 3UOPA 5DJ7A 2XBYA 5ESTE 1LPKB 2GT8A 1AVGH 4B75A 3VGCB 1QBOA 2KOHA 1Q3OA 5DP3A 1DOJA 3I18A 2GD4B 4OS1A 2ZQ2A 3KHVA 1LCYA 1BMMH 1QL7A 1Z8JB 2AWXA 3SU1A 1LTOA 2C8ZB 3UOUA 2ZPQA 5EOKA 2M3MA 5EZ0A 2V3HH 1QTFA 1UK4A