1SOZA

Crystal structure of degs protease in complex with an activating peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
311
structure length
281
Chain Sequence
b'MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 281
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sozA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA02
5K7RA 1C5VA 5EODA 4DIHH 2K1QA 2GV6A 4WMFA 1IQGA 2FOBA 4Q6SA 2QXJA 1UVTH 2KJPA 3RU4D 3Q76A 3A7WA 1O5FH 3SUZA 4UFDH 5F03A 1YCPH 3OTPA 2XC4A 1DITH 2CF9H 1W0ZU 1GBDA 1VGCC 1N6FA 2VVCA 2BOHB 1NZQH 2CHAB 4X2YA 4UFGH 1GBHA 4UD9H 3R68A 4OEOA 1TLDA 3H7TA 4ABIA 1W7XH 3SNBA 1P03A 1RXPA 4JZEH 2TPIZ 3RL8A 2KBSA 1XVOA 1VA8A 5FHTA 1HRTH 4ZMAH 2OBOA 1NROH 4E34A 1TNGA 4I8KA 1CE5A 1OP8A 2ODQA 3E16B 3STIA 1N8OB 1ZR0A 1C5NH 4JK5A 3JXTA 1HDTH 1SGNE 1Y5BT 3TLOA 6CHAB 1OWHA 1SMFE 5LH8A 1AKSA 1VCPA 2Q6GA 1ZJDA 4B1TA 1DPOA 1QR3E 1QQ4A 1BTZA 4Q2PA 1F5KU 3MU1A 1WHAA 1HPGA 1TA6A 7KMEH 3KGPA 4CREA 1BMAA 2AWWA 2O8TA 1MCVA 2O8LA 3DFLA 3GICB 1G9OA 3QDOA 3HK6B 2FPZA 1ELEE 3A84A 1QJ6B 1TAWA 4NNLA 1LO6A 5FXLA 1VB7A 2STBE 3M7TA 1BQYA 2GV7A 1HAXB 3VXEH 1BFEA 1K28D 5EXNA 1T8OA 5AF9H 1RFNA 3O8DA 4NIXA 4B2CA 2FN5A 1DY9A 4AG2A 2EDZA 1SBWA 2GZ8A 3VGCC 4FUJA 5A0AE 5HGGA 2JKHA 1ZHMA 1T8NA 2HNTF 1Z8JB 4JL7A 5DK1A 1S6FA 1O35A 2XTTB 4OS7A 4AB9A 5E0GA 5C1XA 2P94A 1C9PA 1RIWB 1W9EA 4K72A 4IC6A 2BDBA 5HMAA 1E34B 1XKBC 3HATH 1LQEA 3KCGH 2R0KA 2EI8A 3QN7A 1PQ8A 3RLWH 5FX6A 4TY7A 1BMLA 3MNBA 1W13U 2XBYA 3HGNA 3M61U 1V2PT 2JH0D 2LUIA 3T2NA 3TVJB 1K1IA 1O2OA 2ZCKP 2OCVB 3GDSA 1HJ8A 2Z7FE 2OQSA 7GCHF 5HF4A 2A4GA 3SU1A 4HFPB 1D3QB 1KLIH 1Q2WA 5B6OA 2CMYA 2XWBI 5HEYA 1V2QT 3GJ9A 2K1ZA 2D1JA 1SL3A 1WYKA 1VZQH 1A4WH 4J2YB 1GI3A 2H9HA 2STAE 1B5GH 4BOHA 1X7AC 2BX3A 3S9AA 4A1TA 1YM0A 1HXFH 3U8OH 3TMHA 1QRWA 2Q9VA 1G36A 2V90A 1QY6A 3CP7A 3A7YA 3FFGA 3RXIA 2BD5A 4YLQH 1JIRA 4FVBA 1NN6A 3QTOH 5HEDA 1K22H 4Z8JA 3GCNA 1B0EA 1C2HA 2IWPA 3BG4C 2ZPMA 4K3JA 3Q3XA 1VCQA 2EV8A 4DURA 3MH7A 1GHWH 1P05A 4CRFA 4VGCB 1S0RA 2NU3E 1K1MA 1C5WB 4SGAE 2KOMA 1O2VA 3M3VA 3KNXA 2FNEA 4CR9A 4I31A 2KYLA 1Z8GA 3BG8A 1N1LA 4IGDA 3FVFB 5ABWA 2PHBA 2BM2A 2FZZA 1ZPBA 3ZZ4A 2CGAA 1DFPA 4Q2QA 2I4SA 4NMRA 4NMVA 8KME2 3VB3A 3HPKA 2ZHQH 4ZH8A 2KV8A 3UQOA 1TMBH 4JZDH 3H7OA 1IQHA 4I7YH 1AIXH 2O9QA 4Z6AH 2F9UA 5C5OA 4LZ1H 2FOEA 3UNRA 1N7FA 3FZZA 2IWOA 2WYJA 5AFZH 1ID5H 3PV5A 1SHYA 1BTHH 1F92A 3B8JA 3SU3A 4JYUH 2Z17A 2AMDA 1GPZA 3RU4T 4LMMA 1V3XA 2Z3DA 1QAUA 2Y7ZA 2FLRH 4RKJB 1O2IA 2A7CA 1GBFA 2SGFE 1UK3A 4OEPA 3V7TA 1PPEE 1U39A 1AQ7A 1CT4E 4NFEA 3P8NA 2ZNKH 3DT0H 3NFKA 2D26C 1F0UA 5A8XA 7GCHG 1P02A 5L2YH 2VIPA 1MZDA 1CT0E 1XUIA 3SV9A 4RSPA 3VEQB 2D90A 2C8ZB 2BZ6H 3F6UH 3UIRA 5EPYA 1GMHF 4YOGA 1P8VC 3GY5A 3ATWA 3FP6E 2W5EA 1P9UA 1DX5M 1O2WA 1A2CH 2ZU5A 1N6XA 3I1EA 4Y79A 3LONA 1Z8RA 1C4V2 2ZTYA 4K5ZA 4ZKOU 2G4TA 2FI3E 3RXAA 1DWEH 1ETSH 4WJG2 4X6PA 1MKWK 2KJDA 1V2UT 1QBOA 5HM2A 4A1VA 4Q6HA 3DIWA 3PMAB 1EPTA 3CBYA 2HNTE 1N6DA 3I29A 5DP7A 1JMOH 1GMCF 2JETB 4A7IB 4NA7A 1D5GA 4GCHF 3QGJA 4D7GA 1VITF 3LGTA 4REYA 2CSJA 2PV9B 2KJKA 3T26A 4IN2A 5EZ0A 4ABDA 1AY6H 2J38A 2R2WU 1P57B 1QGFA 5BPEA 1RTKA 1SFQB 2ZU3A 4QT8C 3URCA 2HE4A 1QA7A 4K1SA 2VVUA 3SFJA 1VJ6A 1AU8A 5JBAS 4K69A 4INHA 1AGJA 4YLUA 1ANDA 3PMBB 1X5QA 4MPVA 1AE8H 3NXPA 4I33A 2EJYA 1WBGB 5EQRA 1ZUBA 1TPAE 2CF8H 1GI8B 2H9EH 4L8NA 2AGIX 3ZZAA 1GJ6A 1UTMA 4B2BA 1TP5A 3ZZ6A 1AFQB 5SGAE 1UM7A 3M5LA 2ZIQH 4XBBA 4JZIA 2ULLA 4DJZB 1A46H 2DKRA 1XKAC 3IWMA 2I6VA 5GNDA 1P10A 3PO1B 1W2KH 1C5TA 4YZUA 5FPTA 1KXBA 2QIQA 1DWCH 1MCTA 3SHCH 3O8RA 1HAPH 2XCFA 4OS1A 2WL7A 1GBKA 3T5FH 2W3IA 3K82A 1K21H 2ZG0H 4K6YA 1C5OH 1GMHG 1DLEA 1H8DH 1O5GH 3KQBA 5K0HA 2BDIA 4Q2NA 2WINI 1AE5A 3P8FA 2M5TA 1TGTA 3MO6A 1L6OA 4P0CA 4FUGA 2BD9A 2XC0A 2ZGJA 3IG6B 2H2ZA 2P8OB 1GBAA 2C90B 1CHOG 1BCUH 1NS3A 2QBWA 1SGTA 3K9XB 2WPLS 3SQEE 3ATIA 4E06H 5EXMA 2QG1A 2BDHA 2M10A 3RXLA 1O3OA 3SOEA 1UVUH 1RGQA 2IOTA 1GMCG 4Y7BA 4GCHG 1LTOA 1VITG 2WPMS 3ZZ9A 1OWJA 3O46A 1C1WH 2CHAC 5JBTA 1AVGH 4WMDA 1AVWA 4X1QU 1TFXA 3QZRA 4DVAU 1Z6JH 3CS7A 2IWQA 3WY8A 1O3IA 4INLA 2YT8A 1A5GH 4DT7B 2KL1A 1LQDB 3L33A 3TK9A 2H6MA 3NWUA 3TK6A 4NSVA 2L97A 1T8MA 3LC3A 5F3XA 2KAIA 1QIXB 1FUJA 1YCPK 3KN2A 3S7KB 5DO4H 3RXDA 2REYA 1Y59T 3EDXB 1UVPA 5DTHA 1N8OC 1TX6A 1C5QA 3TGIE 1ZHRA 6CHAC 1HJAB 4BAMB 1QAVA 4DCDA 3B76A 2QC2A 1TMUH 1UO6A 3BN9A 1EAUA 4I8JA 2Q3GA 1O31A 3GYLB 1H9LB 3LPRA 5EU8A 5A0CA 2V1WA 2BLQA 3ZV9A 1H1BA 3KQEA 4BNRA 4FUHA 1IHSH 1O5AB 1JRSA 1QURH 2V0BA 2RCZA 3BTHE 3NUMA 3TJVA 5DPAA 1BOQA 3LH3A 1EPTB 4DGJA 4Y71A 1S0QA 3LH1A 2VU8E 5JB9S 4WYTA 1UTQA 1WFVA 2CXVA 4AORA 5E1YA 2C8YB 1D6RA 2ANYA 4ISNA 3RMLH 2ENOA 4JOGA 3I18A 3PROA 2YTWA 1GVLA 1YP9A 1Z6EA 3FP7E 3BTGE 4E7RG 2FIRH 4XSKU 1F5LA 1C1UH 1P9SA 2BY5X 3EYDA 1AFEH 3ZVEA 1PJPA 1UJUA 3SJOA 3ATMA 2G4UA 2PW8H 1C1TA 2HALA 2BQWB 2IPHA 3CYYA 1ZZZA 3NZIA 1RIWC 2JXOA 1TNIA 2FTLE 1HBTH 1TRNA 2DM8A 2VJ1A 4X1SU 3LNYA 1WTGH 3FP8E 2VH0A 3LJOA 1BMNH 1WQVH 3RXKA 1NC6A 2ZFTA 4KTCA 2AIQA 3BIUH 1MKWH 3LT3A 1THRH 2GZ9A 5EOKA 1W9OA 1C5ZB 3ID1A 2G00A 3GCHB 2BD4A 4F4OC 2FX6A 2J34A 2RDLA 1O2ZA 3GY3A 3HGPA 2UUJB 4CRAA 4JZ1A 5I7ZA 1C1OA 4OS4A 4LZ4B 1S81A 1XX9A 2RA3A 1ZPZA 4R0IA 1QRXA 1QQUA 1KXCA 4FU9A 1O3BA 3UFAA 3M35A 2OGPA 4DY7B 1P2IA 8LPRA 1T2MA 3UY9A 4B75A 2F0AA 3A83A 3A7ZA 1MMJN 1GBLA 4BTIB 3M5OA 1TABE 1DOJA 1XVMA 3DJ1A 2FOMB 1BRAA 4VGCC 2JH5D 1HAVA 2P59A 1GGDB 4WVPE 2YUBA 2I0IA 1F2SE 1IQEA 3SI3H 4AFQA 1AUTC 1TRMA 4DOQA 2EEIA 1P11E 1DUEA 2VIWA 3HPTB 1G3BA 1GCTB 2G5MB 3STJA 1CBWB 1ORFA 1AVXA 1FC6A 4XBDA 3TPIZ 4B73A 1A7SA 4YO9A 2AH4X 3A81A 5E0JA 1K2I1 2SGQE 2FS9A 1K1OA 1R6JA 1FIZA 2QXHA 2W7UA 2QN5T 2P16A 1U38A 2WUBA 2HPPH 1M9UA 3GY8A 2BVXH 3U9AH 3VB4A 5FCKA 1SQTA 1V6DA 2V3OH 3D49H 4KKDA 3I78A 4Y0YE 3S69A 5HEBA 1TB6H 1Y3UA 1TE0A 5C67A 1P12E 1THSH 2AIPA 2GGVB 1GI6A 3LGIA 1JWTA 2LOBA 2WPKS 5FBIA 3MU5A 4UONA 4AGKA 3P92A 3U1JB 3LIWA 3BTFE 1FMGA 1V62A 5FAHA 1OYQA 1D4PB 2RG3A 5AVDA 1ARBA 3HK3B 1C1PA 1BUIA 1O3AA 2C93B 3EGHC 4HI3A 1DT2A 2BHGA 4K1EA 3TNTA 3PLPA 3DORA 5A8YA 2UWLA 1WF7A 3T29A 5HDYA 2BQ6B 1GBBA 4X8SH 2AFQB 3D62A 1TMTH 1WH1A 1BBRE 2UWPA 4OS5A 5DP5A 3NCLA 3RMMH 1TRYA 4NMTA 3NKKA 1BB0B 4KTSA 3RLYH 4JOKA 2PTNA 2VINA 1ELDE 3ZVFA 1ZSJA 2HWLB 4NCYA 1PYTD 4ZKNU 4NNMA 2J2UA 1MU8B 2F9VA 3E8LA 1C5UA 1Q7XA 1QB6A 2O8UA 1GL1A 2JETC 1U3BA 3QIKA 2MHOA 1K9OE 2W4FA 3PM3A 3KQCA 1IQMA 4U32A 2AERH 2I04A 1MFLA 1CA8B 1EZSC 2L4TA 1Y3WA 1SSXA 2KQFA 2KPLA 2ILNA 2CS5A 3BF6H 3SU6A 2J95A 1RTFB 3DUXH 5T6GA 5HFEA 1AB9B 1SGIB 2EEGA 1L1GA 3TJUA 1EZXC 4H4FA 3PMHB 2R4HA 4YOJA 1XXDA 3SU5A 1LVMA 5EW2H 4WH6A 3PTNA 1YPLH 4TPIZ 3SGBE 4R8TB 3RXEA 2A4RA 4X6OA 5C5NA 1SLUB 1OS8A 1SOZA 1OP2A 2FMJA 2FOAA 2GX4A 4Q7YA 4JOPA 1SGDE 1KXAA 1NRPH 1Y5AT 5DP3A 1MTUA 4MPXA 1AFQC 3RXGA 3KZDA 1LPKB 2YNBA 3RM0H 1PQAA 1YC0A 3NPSA 3O5NA 2OQ5A 4UU6A 2TGTA 3PO1C 2VWNA 3QZQA 1H9HE 1LVBA 4ABBA 1H9IE 4ZHLU 2BD2A 1TBRH 1SFIA 2ZDLA 2C4FH 1HUTH 2FX4A 3OU0A 4KFWA 4ZXYH 1BHXB 1P3EA 5C2ZA 1PPZA 3SW2B 3QO6A 2VIVA 3PV2A 4JOEA 5F6MA 1EOJA 1V2NT 5T3HA 2RCEA 3RMNH 1KTSB 4JOFA 3M7UA 1LHGH 3FY5A 1IAUA 1C5LH 1XUFA 3AAUA 1N6YA 1SLVB 5DP8A 3U1IB 2GVFA 3MO3A 1WF8A 1UHBA 3SNDA 1CT2E 2BVSH 2ZC9H 1MH0A 5C1UA 1ARCA 2ALVA 3DJ3A 2P8OC 3SQHE 2ZQ1A 3T27A 3MYWA 1P2NA 4NXRA 1BRCE 1S85A 2ZFSA 3SUFA 2F9OA 4XDEA 4IN1A 2BYAX 1VCWA 2CSSA 4AG1A 2FOGA 4WYUA 3SBKA 3K1RA 3A87A 2P3WA 3PLKA 1P0SH 4Q7ZA 1EAWA 1Z1IA 2BLVA 3TH2H 2H2CA 1N6EA 1YCPM 1FAXA 4MVNA 4NXQA 5HFFA 2DC2A 1SLXB 1WI4A 3ZZDA 1LHCH 1VITH 2A2XH 4GPGA 4CRBA 1SPJA 1ACBE 1IQKA 1U6QA 4Y8ZA 3F9EA 4UU5A 5A09A 2FTMA 1C4U2 1C5YB 2BMGB 2ZKSA 3MMGA 1F0SA 2JH6D 1C2DA 1V2RT 1X45A 2V6NA 1PFXC 4BAOB 4YESB 5T6DA 4NMSA 3BTME 2V3HH 1FQ3A 3GISB 1AZ8A 4O3TA 1FPHH 5DP9A 1HIAA 1ZGIA 1HJAC 2PSXA 1GQ4A 2ZI2H 1Q3PA 3SUGA 1T4UH 4BTTB 1BDAA 1UVSH 2J92A 2OTVA 4HTCH 1Z7KA 2ZHFH 4ZHMU 5E6PB 4Q2KA 5A0BA 1CVWH 3SI4H 2YNAA 2ANKH 4O3UA 4AFSA 4YDPA 4FUFA 4ZXXH 1I16A 2UUKB 1UTOA 1G9IE 2BD7A 1SHHB 2HE2A 2ZDMA 4RKOB 1CGJE 1GI4A 1OBYA 2GT7A 2TIOA 2H1UA 4X2VA 4O9VA 1CU1A 1ZSLA 3OYPA 1C2IA 1W9QA 2GCTB 1QNJA 2X7ZA 3D23A 3OSYA 4ABGA 1S82A 9ESTA 4X1PU 4CHAB 1UEPA 4ASHA 5LPRA 4JCNA 3LGUA 3MFJA 3E0NB 4JK6A 1AI8H 3ZZ5A 1YKTA 2MX6A 1GBCA 2F9NA 4GAWA 2GKVE 1N7EA 2A2QH 3LDXH 2VZ5A 2XCNA 3TSVA 2OLGA 4CRDA 4Z33A 1V2OT 1TPSA 4I8GA 6LPRA 8ESTE 3A89A 2F91A 1CSOE 1P2OA 2ZU1A 3A8CA 4X1RU 4B71A 5HXFA 1MD8A 3ESTA 2QKUA 4KTUA 1HGTH 2C8XB 1KTTB 1FN6A 5AHGH 2FOCA 3RDZA 2DAZA 1NFYA 3L6PA 2H3LA 2ZHWH 2R0LA 2BYGA 1FN8A 2Y7XA 3V12A 1WUNH 1J14A 3QK1A 1SOTA 4MPUA 3CS0A 1ESBA 3RXQA 2ZFRH 3MU4A 3AAVA 4WY3A 4Y0ZE 1QRZA 1SGQE 2UUYA 2VGCB 3GCHC 1LHEH 1AKSB 1BTWA 1NU9A 1QTFA 4ABJA 1O3HA 2VSVA 2D8WA 1OP0A 2GCHF 1EXFA 1SGYE 1XUKA 1PPFE 4GSOA 3P17H 2FO9A 3PLBA 1C1NA 1LPZB 5TCAA 1EASA 3TH3H 5JPMH 1BITA 2ZFQH 1TQ7B 2B8OH 3RP2A 1Z86A 3AXAA 1LDTT 1QJ1B 5E8EH 3SJIA 4NMPA 3S7HB 1G32B 1ZMNA 3CH8A 2FP7B 2PSYA 5EXLA 5HFBA 2WYGA 3EA8A 1TNKA 1PYTC 5ETXA 3LGWA 1UCYE 1BZXE 5FCRA 4O03A 1NFWA 3NFLA 2G52A 1GGDC 3E91A 4OGXA 4KFVA 1ZYOA 4K76A 7ESTE 1L0ZA 1MTSA 2R2MB 1J8AA 1HB0B 1GCTC 1GHYH 2G81E 2H3MA 1RTLA 1CO7E 1Q3XA 1SGFG 1PPGE 1QB1A 1O2RA 3RXHA 3D65E 4K8BA 3CC0A 1EKBB 1GDNA 1BBRH 1TGSZ 4Y8XA 3TSZA 1TX8A 1O3NA 5F8TA 1AD8H 3BTTE 4WF8A 4DIIH 2ZHDA 2B7DH 3SJKA 1DXWA 2OMJA 5B6LA 3LU9B 2WV5A 3P6ZB 3OTJE 1SLWB 2ZQ2A 1A1RA 1HAZB 1JRTA 1ELGA 3ODFA 1SGPE 2R9PA 5ESBA 1O3MA 2EDVA 2G51A 3ATKA 3VQGA 1NRQH 1GJCB 2J9NA 2Z9JA 4FGMA 1HIAB 2PKSB 3K6YA 3M5NA 1BTUA 3I4WA 3DA9B 3MHWU 1YPMH 1IHJA 1DS2E 3A82A 5AFYH 1EZUC 1ZRKA 1K1JA 1UCYK 5L30H 5JB8S 1JXPA 1NT1A 1IOEA 1ZTLA 2Z9IA 1O3LA 1TGNA 2GCHG 1G37A 3VPKA 1O3JA 1IQIA 3QGNB 4TWWA 2ZPLA 4YTAA 5JYIA 3S9CA 1B8QA 2QV1A 3SORA 2M0VA 1OWEA 5J4SA 2Z6BD 1TNJA 1ELVA 3CENA 4NG9H 4GUXA 2FE5A 4AFZA 1SGCA 1GVZA 1UITA 1XMNB 4UEHH 2HGTH 1HFDA 4Q7XA 1FI8A 3SUEA 1GG6B 1KDQA 3C1KA 4O06A 1LVYA 4X8TH 1O2UA 1O2TA 3VB5A 1A0HB 3UPEA 1TONA 2QAAA 1V2LT 1EB1H 1FXYA 3ZVBA 1AN1E 2TGDA 2VVVA 1ABIH 3SHUA 4AZ2B 3SV8A 4Y6DA 2CN0H 3BTEE 1D3DB 3QGLA 3M3TA 4CRCA 1U37A 1QL8A 3EGGC 4I8LA 2TGAA 1ZOKA 1AB9C 4NA8A 1O0DH 3M7QA 1AO5A 4MQAA 4FUDA 3SUDA 1UTKA 1EP6A 3LC5A 3SGQE 2PKAA 2ZCHP 1EB2A 2Y5GA 3BTWE 3A8AA 5DKMA 2EEKA 2QT5A 4P2AB 3UNQA 1RZXA 3WKLA 3EA7A 1S6HA 4MPWA 2GMTB 2WPJS 1MC7A 3U8TH 3P8OA 1K1PA 1O2NA 3O8BA 3UR9A 4HZHA 2PGBB 2EGKA 1KXEA 2P93A 4XFQA 2FXRA 4Q3HA 5HETA 3F9FA 2ZTZA 1IQFA 4Y7AA 4NIWA 1OZIA 1TQ0B 1YLDA 2Z94A 2R3YA 1O3CA 3SU2A 3GCTF 3R0HA 1C9TA 1EP5A 4D8NA 5A2PA 3P95A 5EQQA 4LK4A 2BXUH 4K75A 1DM4B 1YPHC 1G2LA 2ZDKA 4LOYH 1V2MT 1L2EA 1W7GH 2PLXA 2Y5FA 2PZDA 2ANWA 1WAYB 1V5LA 5HYOA 3AW0A 1WOFA 1UJVA 4X1NU 4CR5A 1MU6B 1O5BB 3KHVA 1EOLA 3JZ2B 2Z9KA 1S5SA 1LVOA 2ZHEH 1UM1A 5E22A 2ALPA 1MQ6A 4GHNA 4CH8B 2VB0A 4WH8A 1ZGVA 2FOHA 2OXSA 1FV9A 3EGKH 1G30B 1BJUA 1ELAA 3SV7A 1O2HA 3RXOA 1V2JT 1FNIA 1DSTA 1P2KA 3ZVGA 2QCYA 3VB7A 1EQ9A 2BY7X 3BG4B 4K8YA 4IMZA 2F83A 3A80A 4YT7H 2OP9A 2HRVA 1S84A 3RM2H 3Q77A 4WMEA 3U98H 1DSUA 2ZO3H 1P3CA 3EE0B 1GJ8B 4NSYA 2FM2A 2PUXB 3DFJA 2EI7A 1O37A 2B0FA 5GCHF 1SVPA 3ZYEA 2YT7A 5FPSA 1DXPA 4TPYA 1AWFH 3K65B 2AGEX 2OBQA 1QJ7B 4AYYB 5C3NA 2WPHS 3E17A 2RA0A 4CBOA 3MTYA 4F8KA 1W11U 2F5YA 3NGHA 3ID2A 1OPHB 2F9PA 1GCDA 1YLCA 3MWIU 3BEUA 2A45B 1L4DA 4X6NA 3GCTG 1CGIE 2AEIH 2D8IA 1W0YH 4Y11E 3SZNA 3EQ0H 4AN7A 3DJAA 3TK5A 1K1LA 1WU1A 4E3BA 1T4VH 1BMMH 1YBOA 2EGOA 4NMOA 4M7GA 1C2MA 1A0LA 2QKTA 4RI0A 3ZRTA 2XWAA 5FPYA 2AWXA 2QXIA 3W95A 3L4FD 2FEQH 1NRSH 2OZFA 1E35B 1O33A 1KDQB 1XZ9A 4D7FA 4FU7A 2NWNA 2ANMH 2O8WA 3BPUA 2GCTC 1DANH 1FY5A 3V0XA 1QL7A 5E2OA 3QLPH 2QXGA 4H6SB 2OSGA 1UK2A 4Y10E 4Y76A 2A4QA 1ZPCA 3SN8A 4KGAA 5JXBA 1C2EA 4AMHA 2P3UB 4TY6A 2I0LA 1YPEH 3H5CB 2G8TA 3TITA 1TGCA 2ZA5A 1P06A 3UTUH 2HOBA 5PTPA 2D2DA 5JDUB 2EGNA 1A3BH 4MLFB 2PFEA 4CH2B 2A7HA 3UUZA 4MG3A 3GSLA 4ABFA 2QY0B 1UCYH 3P8GA 1GI0A 2PKAB 4INKA 1AMHA 2J94A 1O3EA 5DGJA 1RD3B 1A3EH 1F0TA 2KAIB 5G1DA 2DB5A 1YPGH 3A8BA 5EGMA 1V1TA 1BE9A 1LPGB 2QF3A 5GCHG 3HPMA 1Y5UT 2AS9A 1UJDA 1DWDH 1OXGA 1CA0B 1C2GA 1FCFA 2XBWA 1HLTH 3GY6A 3SGAE 2VGCC 1QAVB 3KEEA 4ISIH 4MDSA 4NWKA 4FUEA 5CMXH 2TBSA 3URDA 3M3SA 2FDAA 1C2JA 4PROA 1D6WA 3ODDA 1V2WT 4NIYA 1NM6A 2EDPA 4AOQA 1N99A 3FANA 4NMQA 1FC7A 4GHQA 1BHXF 3I77A 4JYVH 1UEQA 4YM9A 2DLUA 2LC7A 2ZP0H 4O97A 2EHRA 2XNIA 1O3PB 1WFGA 2EAQA 1EJNA 1L1JA 1UTLM 3FAOA 1O2MA 2GZVA 1P2JA 1NFXA 1OBXA 2M3MA 3TSWA 1A5HA 2ZWLH 3QUMP 4YT6H 3OY5U 2TRMA 1G3EA 2JWEA 3SNEA 4LXBH 2RRMA 1Y3XA 3AW1A 4H42U 3QDZB 1NU7B 2PKUA 4XHVA 2FYQA 4MPAA 3GY2A 2I6SA 1C1MA 2Y81A 3RLEA 1ZSKA 1F0RA 2AMPA 3MU0A 2BLWA 2FI5E 1Z1JA 1TA2A 4EDJA 1W12U 4CBNA 1F7ZA 8GCHF 4ZUHA 3TJNA 1GHBF 1ELBA 4BAQB 5I25A 1GBEA 3CBZA 2TGPZ 2PDZA 3ATLA 3SHAH 1E0FD 3ID4A 2LPRA 4ZKRU 1ELTA 2BD8A 2GDEH 1HCGA 4X2WA 2VPHA 5G4BA 2KRGA 2P95A 4I8HA 1WHDA 1QBNA 1BRUP 1TALA 2VIQA 3ZZ7A 2KG2A 3BTQE 4XBCA 1MAYA 4FVDA 2AGGX 4UFEH 1MKXK 2B5TB 3F9GA 4AYVB 4DW2U 4Q2OA 2GD4B 2PKSC 1BBRK 4JYTA 1LKBA 1WV7H 2PWXA 4FXGH 4X6MA 1KY9A 2VSPA 3ZZCA 2Y82A 2PUQH 2ZECA 3A7XA 1WTHD 4U01A 1SGRE 1YPJH 2BDGA 1BTPA 1A5IA 1FONA 1EJMA 1XUHA 3F9HA 5IDKA 4WXIA 2EEHA 2DE9A 2BY6X 4OAJA 1FLEE 2CV3A 1FY3A 3MU8A 4FUIA 5HF1A 5EPNA 5LPFA 1Q3OA 1TP3A 5F67A 1MTWA 1O3FA 5J4QA 3L3TA 4ISLA 1C5PA 1S83A 3M37A 3PDZA 2ZPSA 1KLTA 3RXPA 3SNAA 4JOJA 2Y80A 3R3GB 1NESE 1DLKB 2BD3A 2IJOB 3LKWA 1UF1A 4NIVA 2I6QA 4H6TA 1DVAH 1OX1A 1GG6C 1C5MD 1HAVB 1NO9H 3ZZ3A 2DE8A 4TYDA 1G3CA 1TBQH 3E90B 1QL9A 2C3SA 4K78A 1CHGA 1GJ7B 2NU1E 1X8SA 2XC5A 1QB9A 1C4Y2 1AZZA 1MBMA 1XUJA 2QF0A 1GHZA 1GHXH 1RJXB 3SU4A 2UUFB 1VJ9U 1RRKA 3SU0A 3BEFB 4FU8A 1SGEE 5D13A 2YOLA 3KF2A 5DG6A 1IHTH 3HKIB 1PQ7A 1DICA 2H5CA 3KQDA 1MD7A 1B7XB 2W7SA 1DY8A 3UOPA 4BXWA 2LA8A 2QKVA 1GJ5H 1LHFH 1A0JA 1YGCH 8GCHG 1TIOA 2ZPQA 3BTDE 1GHBG 4AGJA 1SGFA 2BX4A 3W94A 5G1EA 6GCHF 1FY4A 2Q1JA 2ZGCA 2GMTC 3GOVB 2PNTA 2VWLA 1V2VT 2VIOA 4X8UH 1GBMA 1SR5C 5FB8C 5LPEA 1HAIH 1YPHE 2Y5HA 2CJIA 3PTBA 3UREA 4KELA 1DWBH 1SQAA 1EJAA 1SC8U 1WSSH 3RXSA 1ZHPA 1BRBE 1LCYA 3TU7H 4GVDA 1GHAF 1UK4A 2XW9A 3A86A 1C2LA 1D9IA 1EAXA 2A7JA 2H9TH 3A88A 2L4SA 1T31A 3EA9A 3K2UA 3ID3A 1UEWA 1HJ9A 1NFUA 1L1NA 2OINA 1GBIA 2AMQA 1C1VH 4X2XA 4BAHB 2Q6DA 4OS6A 3VB6A 1MUEB 1UJ1A 1BIOA 4ZROA 1QBVH 3B9FH 2ODPA 1DUAA 1EPTC 1KYNA 4A1XA 2H2BA 2OCSA 2ESTE 5HFCA 4D76A 1O2KA 1P2MA 2DUCA 5FBEA 4G69A 2EXGA 3KIDU 3TGJE 1O36A 5T6FA 3MH4A 4I32A 5FX5A 2G2LA 1V2TT 1ZMJA 3Q00A 2BY9X 1H4WA 5GWZA 2KPKA 2DJTA 2M0ZA 3OX7U 4A92A 4E35A 2ZU4A 3C27B 1RS0A 1WG6A 1TPPA 1HAHH 1UHPA 4A5TS 1GL0E 2P3TB 2XBVA 1O34A 5H4IB 5C20A 3O8CA 4B74A 2Z9LA 3MNSA 1F5RA 1FY8E 3IITA 3VXFH 1RY4A 2SGEE 1ELCA 4RN6A 1UMAH 2VRFA 2J4IA 3GY7A 1X6DA 3TIUA 2OS6A 1ZLRA 1B0FA 3E0PB 2KAWA 1Y3VA 3V3MA 4E05H 4NGAH 6GCHG 1WJLA 4NFFA 3V13A 1MAXA 4BXSA 5F8XA 5EQSA 4Y8YA 1IQJA 4JORA 1SG8B 2JOAA 1GJ4H 3ENSB 1LHDH 1BT7A 1FAKH 4PQWA 2AYWA 2NU4E 5GLJA 2SGDE 2XXLA 2WUCA 2PKTA 3ZV8A 1FDPA 4ZHAA 3LGYA 5CHAB 1J9CH 1O2JA 2ZEBA 1K32A 5HJ1A 1TWXB 2GT8A 3RXUA 1GHAG 2V35A 4NA9H 1KWAA 1VJAU 4BANB 1AHTH 4ESTE 2FS8A 1UVOA 2FESH 1ZOMA 3N7OA 1V2KT 1RGWA 1O5DH 3A8DA 1UHBB 5E2PA 1MTNB 2HPQH 1QA0A 4U2WA 2OD3B 4GLYA 4MTBA 3ZYDA 2KOHA 3GDVA 1OBZA 1GDUA 5IYTA 3RXBA 2F9BH 2BDCA 3SV2H 1SQOA 2OC7A 1QCPA 1H8IH 3E3TA 1O2QA 4J1YA 1ESTA 1CBWC 1ANCA 3P70B 3Q3KA 1INCA 2ZPRA 2ZDAH 4U30A 4WXVA 3S9BA 1ABJH 4N6XA 2SFAA 1CHOF 1MKXH 2A32A 2GTBA 1WI2A 4F49A 1T32A 2M0UA 3ZVAA 2ASUB 1YPKH 5JBBS 1W10U 1GI2A 3Q3YA 2I1NA 3WKMA 1C2KA 4JMYA 3BSQA 1E37B 3SV6A 1FJSA 3UWIA 3UWJH 1LKAA 4Q80A 3UQVA 1P04A 2FLBH 4K2YA 4MNXA 2THFB 2A5AA 4THNH 2Z9GA 1C5SA 5HM9A 1PPCE 2ZDVH 3RXJA 3RXVA 1O2XA 1VGCB 2NU2E 3T28A 4AB8A 1FZZA 1C5RA 1W14U 3QX5H 4KP0A 3VQFA 1CQQA 3PWCA 1Y8TA 1CA0C 5C1YA 4ABHA 3DD2H 3MNCA 1C1RA 1PDRA 2G5VA 4HOPA 1V2ST 5LGOA 1O3DA 4ISHH 4NWLA 1GMDF 2HLCA 2QGRA 2VWRA 1GWAA 1VAEA 1GJDB 2A5KA 2HVXA 4IMQA 4K1TA 1O2LA 2BB4A 1HNEE 1K1NA 1ETTH 3PV4A 2XBXA 1D3TB 3A7TA 1NPMA 1GM1A 1BTYA 4OGYA 3RXCA 1FC9A 1W8BH 1O2PA 2ZCLP 1ANBA 1QLCA 1IQNA 4MNYA 1O32A 1TNHA 1KXDA 1OWKA 1Y3YA 2ZGHA 2Z3CA 2W3KA 2LNCA 1EAIA 3R0FA 1SI5H 1GI1A 1O30A 1ESAA 3U69H 1GI7B 5E0HA 1CGHA 4ZKSU 1GJAB 5JBCS 1PQ5A 3QE1A 4D9RA 4OS2A 2P3FH 3MNXA 2OC0A 4H11A 1EX3A 3ELAH 2FCFA 4WWYA 1UEZA 2GP9B 3VGCB 1BA8B 1OYTH 3UOUA 4ABAA 1Z87A 2OC1A 2VIDA 2EI6A 1M5ZA 2BDAA 2EA3A 1V6BA 3MI4A 3SJ9A 1C1QA 1J17T 1PPHE 3T25A 1Y7NA 2YUYA 4BTUB 1ELFA 3QWCH 1J15A 3RXRA 3UR6A 5H3JA 3BIVH 2D92A 1UTPA 1NTPA 1KLJH 2K20A 4X8VH 2A1DB 1BTXA 5E21A 3SOSA 1T7CA 3T62A 1GJBB 3QJNA 2WPIS 2OC8A 3GYMA 2SNWA 3M36A 3E6PH 2GDDA 4XE4A 3F68H 2AINA 3ITIA 1KSNA 3K6ZA 2UWOA 1O2GH 2SNVA 1HAGE 1RGRA 1T8LA 2QA9E 2ODYB 3TGKE 2FI4E 2H5DA 2ZU2A 1GMDG 1JIMA 1P09A 2BTCE 1NY22 2KOJA 3SNCA 9LPRA 2BOKA 3ZZBA 4Z0KA 4FUBA 1TQ3A 1P1EA 2Z3EA 4MNWA 1O38A 1YF4A 1TPOA 1NTEA 5EYZA 2Q6FA 5TCCA 2W7RA 1O3GA 2A0QB 4JZFH 1JBUH 1E36B 4GHTA 2ZFPH 4ISOA 3RMOH 1WQSA 1NRRH 1O39A 2XYAA 2OUAA 1TGBA 2E7KA 3QTVH 1O5EH 1FY1A 3LOXA 2WV4A 1YBWA 4MNVA 2FODA 1OOKB 5BRRE 4B2AA 4AFUA 3ZZ8A 4ABEA 2PR3A 5DP4A 1TBZH 1GHVH 1MTVA 2VNTA 3MH6A 2BZAA 3RL7A 2C8WB 4HGCA 1BJVA 2O2TA 1P01A 4UFFH 1E38B 5GPIB 3SHWA 1KXFA 1UFXA 4K60A 3M5MA 1Z8IB 2IN2A 3BTKE 3U8RH 3HVQC 1DE7H 3RC4A 3G01A 2DLSA 1OWIA 2EEJA 1GDQA 5F8ZA 1ZRBA 3SJ8A 2BVRH 2BQ7B 4CRGA 1MFGA 1TNLA 1GBTA 4UE7H 3AASA 1QHRB 3OY6U 1G2MA 1TX7A 1V5QA 1FIWA 1ZMLA 3MH5A 3AVZA 1W3CA 2ZDNA 4HOPB 3RUOA 1KIGH 2BDYA 3A7VA 2BY8X 2UZCA 3A85A 3LJJA 1XXFA 3S0NA 2BLOA 1GVKB 2ZFFH 1ETRH 3HKJB 2OPGA 1UTJA 3RXTA 1O2YA 3KL6A 1EATA 3GGEA 4JOHA 2F3CE 1GQ5A 2BXTH 2VH6A 3VFEA 3PB1E 1HAOH 4XOJA 2VWMA 1X5NA 3ZVCA 2M0TA 1WIFA 1HXEH 2EC9H 3JZ1B 1NRNH 3KZEA 3B23B 1XM1A 2Y6TA 1O3KA 2ZGXH 1TOCB 4ZAEA 1OWDA 1VR1H 5CE1A 5EW1H 1WCZA 1FPCH 5DJ7A 2A4OA 2FYRA 3PWBA 4GVUA 5EG4A 4CHAC 1N7TA 1DDJA 5HFDA 2G5NA 2A31A 2ZTXA 3PYHA 2A5IA 1GJ9B 1L4ZA 1MBQA 3BEIB 3KHFA 1ZJKA 5GIBA 2JILA 5GXPA 3CBXA 1Z71A 5GDSH 2B9LA 3F1SB 2NU0E 2QYIA 1OKXA 3PS4A 3TNSA 3DHKH 4IW4E 5DP6A 1GI5A 3RC5A 4E7NA 1G3DA 1HYLA 2IWNA 2JREA 3PDVA 3K50A 1J16A 3EAJA 2ZGBH 1IU0A 4X0WU 1ZTKA 4BAKB 3RC6A 1TYNA 3QJMA 1A61H 1GBJA 2HNTC 4IBLH 2FOFA 1XUGA 4FUCA 2OQUA 2PGQB 1O5CB 1TOMH 3NK8A 2GZ7A 1D3PB 1NF3C 1IU2A 2AWUA 1SB1H 3TJOA 1HV7A 2LC6A 1Q31A 1ANEA 4AX9H 1P2QA 1O2SA 1X5RA 3LGVA 1P1DA 2ZZUH 3TH4H 2XRCA 4IC5A 5E11A 4TWYA 5L6NH 4YYXA 4A6LA 3FZDA 1AWHB 1JOUB 1HAYB 5CHAC 1ZTJA 1OSSA 1LMWB 2JINA 4UDWH 5I46H 7LPRA 2DMZA 2R3UA 4GVCA 3LNXA 1EZQA 1C5XB 5TJXA 1C2FA 1IQLA 4IS5A 3RXMA 2W26A 2SGAA 3GDUA 1MQ5A 2HGAA 1MTNC 4NZQA 5GJ4B 2PA1A 1AUJA 4DG4A 3GY4A 1EUFA 2PTCE 4YOIA 4NZLA 3SO3A 1PPBH 4D9QA 2JIKA 3RXFA 5ESTE 3PMJA 3E1XB 4NXPA 1THPB 1MZAA 2VWOA 1C1SA 5A2MH 2ZF0H 1GI9B 2FWWA 1YYY1 2O8MA 2KA9A 1KEFA 3ZVDA 1QFKH 3UNSA 3RU4E 5A8ZA 3MO9A 3GCOA 3MOCA 4SGBE 1UTNA 5L2ZH 4B76A 6ESTA 4R2ZA 2SGPE 3R69A 3BV9B 2G55A 1I92A
chains in the Genus database with same CATH superfamily
5K7RA 1C5VA 5EODA 4DIHH 2K1QA 2GV6A 4WMFA 2VBCA 1IQGA 2FOBA 4Q6SA 2QXJA 1UVTH 2KJPA 1QZ8A 5EJLA 3Q76A 3A7WA 3RU4D 1O5FH 3SUZA 4UFDH 5F03A 1YCPH 3OTPA 2XC4A 1DITH 5DSFA 2CF9H 1W0ZU 1GBDA 1VGCC 1N6FA 2VVCA 2BOHB 1NZQH 2CHAB 4X2YA 4UFGH 1GBHA 5FL7D 4UD9H 3R68A 4OEOA 1TLDA 2WHXA 3H7TA 4ABIA 1W7XH 3SNBA 1P03A 1RXPA 4JZEH 2TPIZ 3RL8A 2KBSA 1XVOA 1VA8A 5FHTA 1HRTH 4ZMAH 2OBOA 1NROH 4E34A 1TNGA 1YWUA 4I8KA 1CE5A 1OP8A 2ODQA 3E16B 3STIA 1N8OB 1ZR0A 1C5NH 4JK5A 3JXTA 1HDTH 1SGNE 1Y5BT 3TLOA 6CHAB 1OWHA 1SMFE 5LH8A 1AKSA 1VCPA 2Q6GA 1ZJDA 4B1TA 1DPOA 1QR3E 1QQ4A 1BTZA 4Q2PA 1F5KU 3MU1A 1WHAA 1HPGA 1TA6A 7KMEH 2J98B 4RT0A 3KGPA 4CREA 1BMAA 2AWWA 1S6LA 2O8TA 1MCVA 2O8LA 3DFLA 3GICB 1G9OA 3QDOA 3HK6B 2FPZA 1ELEE 3A84A 1QJ6B 1TAWA 4NNLA 1LO6A 5FXLA 1VB7A 2STBE 3M7TA 1BQYA 2GV7A 1HAXB 3VXEH 1BFEA 1K28D 5EXNA 1T8OA 5AF9H 1RFNA 3O8DA 4NIXA 4B2CA 2FN5A 1DY9A 4AG2A 2EDZA 1SBWA 2GZ8A 3VGCC 1VKYA 4F48B 4FUJA 5A0AE 5HGGA 2JKHA 1ZHMA 1T8NA 2HNTF 1Z8JB 4JL7A 5DK1A 1S6FA 1O35A 2XTTB 4OS7A 4AB9A 5E0GA 5C1XA 2P94A 1C9PA 1RIWB 1W9EA 4K72A 4IC6A 2BDBA 5B42A 5HMAA 1E34B 1XKBC 3HATH 1LQEA 3KCGH 2R0KA 2EI8A 3QN7A 1PQ8A 3RLWH 5FX6A 4TY7A 1BMLA 3MNBA 1W13U 2XBYA 3HGNA 3M61U 1V2PT 2JH0D 2LUIA 3T2NA 3TVJB 1K1IA 1O2OA 2ZCKP 2OCVB 3GDSA 1HJ8A 2Z7FE 2OQSA 7GCHF 5HF4A 2A4GA 3SU1A 4HFPB 1D3QB 1KLIH 1Q2WA 3N99A 2CMYA 5B6OA 2XWBI 5HEYA 1V2QT 3GJ9A 2K1ZA 2D1JA 1SL3A 1WYKA 1VZQH 2HLDD 1A4WH 2XNDD 4J2YB 1GI3A 2H9HA 2STAE 1B5GH 1SQRA 3SZEA 4BOHA 1X7AC 2BX3A 3S9AA 4A1TA 1YM0A 1HXFH 3U8OH 3TMHA 1QRWA 2KM0A 2Q9VA 1G36A 2V90A 1QY6A 3CP7A 3A7YA 3FFGA 3RXIA 5CHBA 2BD5A 4YLQH 1JIRA 4FVBA 1NN6A 3QTOH 5HEDA 1K22H 4Z8JA 3GCNA 1B0EA 1C2HA 2IWPA 3BG4C 2ZPMA 4K3JA 3Q3XA 1VCQA 2EV8A 4DURA 3MH7A 1GHWH 1P05A 4CRFA 4VGCB 1S0RA 2NU3E 1K1MA 1C5WB 4SGAE 2KOMA 1O2VA 3M3VA 3KNXA 2FNEA 4CR9A 4I31A 2KYLA 1Z8GA 3BG8A 1N1LA 3NRLA 4IGDA 3FVFB 5ABWA 2PHBA 2BM2A 2FZZA 1ZPBA 3ZZ4A 2CGAA 1DFPA 4Q2QA 4P00A 2I4SA 4NMRA 4NMVA 8KME2 3VB3A 3HPKA 2ZHQH 4ZH8A 2KV8A 3UQOA 1TMBH 4JZDH 3H7OA 1IQHA 4I7YH 1AIXH 2O9QA 4Z6AH 2F9UA 5C5OA 4LZ1H 5IL9A 2FOEA 3UNRA 1N7FA 3FZZA 2IWOA 2WYJA 5AFZH 1ID5H 3PV5A 1SHYA 1BTHH 1F92A 5CDFE 3B8JA 3SU3A 4JYUH 4Q63A 2Z17A 2AMDA 1GPZA 1KMHB 3RU4T 4LMMA 1V3XA 2Z3DA 1QAUA 2Y7ZA 2FLRH 4RKJB 1O2IA 2A7CA 1GBFA 2SGFE 1UK3A 4OEPA 3V7TA 1PPEE 1U39A 1AQ7A 1CT4E 4NFEA 3N7EA 3P8NA 2ZNKH 2IPQX 3DT0H 3NFKA 2D26C 1F0UA 5A8XA 7GCHG 1P02A 5L2YH 2VIPA 1MZDA 1CT0E 1XUIA 1E1QD 4RSPA 3VEQB 3SV9A 2D90A 3F2HA 2C8ZB 2BZ6H 3F6UH 3UIRA 5EPYA 1GMHF 2YMSB 4YOGA 1P8VC 3GY5A 3ATWA 3FP6E 2W5EA 1P9UA 1DX5M 1O2WA 1A2CH 2ZU5A 1N6XA 3I1EA 4Y79A 3LONA 1Z8RA 1C4V2 2ZTYA 4K5ZA 4ZKOU 2G4TA 2FI3E 3RXAA 1DWEH 1ETSH 4WJG2 4X6PA 1MKWK 2KJDA 1V2UT 1QBOA 5HM2A 4A1VA 4Q6HA 3DIWA 3PMAB 1EPTA 3CBYA 2HNTE 4FOUC 5HIYA 1N6DA 3I29A 5DP7A 1JMOH 1GMCF 2JETB 4A7IB 4NA7A 1D5GA 4GCHF 3QGJA 4D7GA 1VITF 3LGTA 4REYA 2CSJA 2PV9B 2KJKA 3T26A 3EE7A 4IN2A 5EZ0A 4ABDA 1AY6H 2J38A 2R2WU 1P57B 2L74A 1QGFA 5BPEA 1RTKA 1UW7A 1W0KD 3WWFA 1SFQB 2ZU3A 4QT8C 3URCA 2HE4A 1QA7A 4K1SA 2VVUA 1FX0B 3SFJA 1VJ6A 1AU8A 5JBAS 4K69A 4INHA 1AGJA 4YLUA 2JIZD 1ANDA 3PMBB 1X5QA 4MPVA 1AE8H 3NXPA 4I33A 2EJYA 1WBGB 5EQRA 1ZUBA 1TPAE 5C0TA 2CF8H 1GI8B 2H9EH 4L8NA 2AGIX 3ZZAA 1GJ6A 1UTMA 4B2BA 3WWBA 1TP5A 3ZZ6A 1AFQB 5SGAE 1UM7A 3M5LA 2ZIQH 4XBBA 4JZIA 2ULLA 4DJZB 1A46H 2DKRA 1XKAC 3IWMA 2I6VA 5GNDA 1P10A 3PO1B 1W2KH 1C5TA 4YZUA 5FPTA 1KXBA 2QIQA 1DWCH 1MCTA 3SHCH 3O8RA 1HAPH 2XCFA 4OS1A 2WL7A 1GBKA 3T5FH 2W3IA 3K82A 1K21H 2ZG0H 4K6YA 1C5OH 1GMHG 1DLEA 1H8DH 1O5GH 3KQBA 5K0HA 2BDIA 4Q2NA 2WINI 1AE5A 3P8FA 2M5TA 1TGTA 3MO6A 1L6OA 4P0CA 4FUGA 2BD9A 2XC0A 2ZGJA 3IG6B 2H2ZA 2P8OB 1GBAA 2C90B 1CHOG 1BCUH 1NS3A 2QBWA 1SGTA 3OEHD 3K9XB 4Z1MD 2WPLS 3SQEE 3ATIA 4E06H 5EXMA 2QG1A 2BDHA 2M10A 3RXLA 1O3OA 1W0JD 3SOEA 1UVUH 1RGQA 2IOTA 1GMCG 4Y7BA 4GCHG 1LTOA 1VITG 2WPMS 3ZZ9A 1OWJA 3O46A 2EQNA 1C1WH 2CHAC 5JBTA 1AVGH 4WMDA 1AVWA 4X1QU 1TFXA 3QZRA 4DVAU 1Z6JH 3CS7A 2IWQA 3WY8A 1O3IA 4INLA 2YT8A 1A5GH 4DT7B 2KL1A 1LQDB 3L33A 3TK9A 2H6MA 3NWUA 3TK6A 4NSVA 2L97A 1T8MA 3LC3A 5F3XA 2KAIA 1QIXB 2KCPA 1FUJA 1YCPK 3KN2A 3S7KB 5DO4H 3RXDA 2REYA 1Y59T 3EDXB 1UVPA 4F55A 5DTHA 1N8OC 1TX6A 1C5QA 3TGIE 1ZHRA 6CHAC 1HJAB 5KEDA 4BAMB 1QAVA 4DCDA 3PRDA 3B76A 2QC2A 1TMUH 1UO6A 3BN9A 1EAUA 1NBME 4I8JA 2Q3GA 1O31A 3GYLB 1H9LB 3LPRA 5EU8A 5A0CA 2V1WA 3OE7D 2BLQA 3ZV9A 1H1BA 3KQEA 4BNRA 4FUHA 3DSPA 1IHSH 1O5AB 1JRSA 1QURH 2V0BA 2RCZA 3BTHE 3NUMA 3TJVA 2RFKC 5DPAA 1BOQA 3LH3A 1NBMD 1EPTB 4DGJA 4Y71A 1S0QA 3LH1A 2VU8E 5JB9S 4WYTA 1UTQA 1WFVA 2CXVA 4AORA 2K8IA 5E1YA 2C8YB 1D6RA 2ANYA 4ISNA 2KCAA 3RMLH 2ENOA 4JOGA 3I18A 3PROA 2YTWA 1GVLA 1YP9A 1Z6EA 3FP7E 3BTGE 4E7RG 2FIRH 4XSKU 1F5LA 1C1UH 1P9SA 2BY5X 3EYDA 1AFEH 3ZVEA 1PJPA 1UJUA 3SJOA 3ATMA 2G4UA 2PW8H 1C1TA 2HALA 2BQWB 2IPHA 3CYYA 1ZZZA 3NZIA 1RIWC 2JXOA 1TNIA 2FTLE 1HBTH 1TRNA 3UB0A 2DM8A 2VJ1A 4X1SU 3LNYA 3KDGA 1WTGH 3FP8E 2VH0A 3LJOA 1BMNH 1WQVH 3RXKA 1NC6A 2ZFTA 4KTCA 2AIQA 3BIUH 1MKWH 3LT3A 2M2AA 1THRH 2GZ9A 5EOKA 1W9OA 1C5ZB 3ID1A 2G00A 3GCHB 2BD4A 1K0HA 4F4OC 2FX6A 2J34A 2RDLA 1O2ZA 3GY3A 3HGPA 4JJ0A 2KZ4A 2UUJB 4CRAA 4JZ1A 5I7ZA 1C1OA 4OS4A 4LZ4B 1S81A 1XX9A 2RA3A 1ZPZA 4R0IA 1QRXA 1QQUA 1KXCA 4FU9A 1O3BA 3UFAA 3M35A 2OGPA 4DY7B 1P2IA 2HVYB 8LPRA 1T2MA 3UY9A 4B75A 2F0AA 3A83A 3A7ZA 1MMJN 1GBLA 4BTIB 3M5OA 1TABE 1DOJA 1XVMA 3DJ1A 2FOMB 1BRAA 4VGCC 2JH5D 1HAVA 2P59A 1GGDB 4WVPE 2YUBA 2I0IA 1F2SE 1IQEA 3SI3H 4AFQA 1AUTC 1TRMA 4DOQA 2EEIA 1P11E 1DUEA 2VIWA 3HPTB 1G3BA 1GCTB 2G5MB 3STJA 1CBWB 1ORFA 1AVXA 1FC6A 4XBDA 3TPIZ 4B73A 1A7SA 4YO9A 2AH4X 3A81A 4HG6A 5E0JA 1K2I1 2SGQE 2FS9A 1K1OA 1R6JA 1FIZA 2QXHA 2W7UA 2QN5T 2P16A 1U38A 2WUBA 2HPPH 1M9UA 3GY8A 2BVXH 3U9AH 3VB4A 5FCKA 1SQTA 1V6DA 2V3OH 3D49H 4KKDA 3I78A 4XD7D 4Y0YE 3S69A 5HEBA 1TB6H 1Y3UA 1TE0A 5C67A 1P12E 1THSH 2AIPA 2WV9A 2GGVB 1GI6A 3LGIA 1JWTA 2LOBA 2WPKS 5FBIA 3MU5A 4UONA 4AGKA 3P92A 3U1JB 3LIWA 3BTFE 1FMGA 1V62A 5FAHA 1OYQA 1D4PB 2RG3A 5AVDA 1ARBA 3HK3B 1C1PA 1BUIA 1O3AA 2C93B 3EGHC 4HI3A 1DT2A 2BHGA 2YMSC 4K1EA 3TNTA 3PLPA 3DORA 5A8YA 2UWLA 1WF7A 3T29A 5HDYA 2BQ6B 1GBBA 4X8SH 2AFQB 3D62A 1TMTH 1WH1A 1BBRE 2UWPA 4OS5A 5DP5A 3NCLA 3RMMH 1TRYA 4NMTA 3NKKA 1BB0B 4KTSA 3RLYH 4JOKA 2PTNA 2VINA 1ELDE 3ZVFA 2KR7A 1ZSJA 2HWLB 4NCYA 1PYTD 4ZKNU 4NNMA 2J2UA 1MU8B 2F9VA 3E8LA 1C5UA 1Q7XA 1QB6A 2O8UA 1GL1A 2JETC 1U3BA 3QIKA 2MHOA 1K9OE 2W4FA 3PM3A 3KQCA 1IQMA 4U32A 2AERH 2RDEA 2I04A 1MFLA 1CA8B 1EZSC 2L4TA 1Y3WA 1SSXA 2KQFA 2KPLA 2ILNA 2CS5A 3BF6H 4TSFD 3SU6A 2J95A 1RTFB 3DUXH 5T6GA 5HFEA 1AB9B 1SGIB 2EEGA 1L1GA 3TJUA 1EZXC 4H4FA 3PMHB 2R4HA 4YOJA 1XXDA 3SU5A 1LVMA 5EW2H 4WH6A 3PTNA 1YPLH 4TPIZ 3SGBE 3NCVA 4R8TB 3RXEA 2A4RA 4X6OA 3PRBA 5C5NA 1SLUB 1OS8A 1SOZA 1OP2A 2FMJA 4DT4A 2FOAA 2GX4A 4Q7YA 4JOPA 1SGDE 1KXAA 1NRPH 1Y5AT 5DP3A 1SKYE 1MTUA 4MPXA 1AFQC 3RXGA 3KZDA 1LPKB 2YNBA 3RM0H 1PQAA 1YC0A 2J97A 3NPSA 3O5NA 2OQ5A 4UU6A 2TGTA 3PO1C 2VWNA 3QZQA 1H9HE 1LVBA 4ABBA 1H9IE 4ZHLU 2BD2A 1TBRH 1SFIA 2ZDLA 2C4FH 1HUTH 2FX4A 2W6ID 3OU0A 4KFWA 4ZXYH 1BHXB 1P3EA 5C2ZA 1PPZA 3SW2B 3QO6A 2VIVA 3PV2A 4JOEA 1COWD 5F6MA 1EOJA 1V2NT 5T3HA 2RCEA 3RMNH 1KTSB 4JOFA 3M7UA 1LHGH 3FY5A 1IAUA 1C5LH 1XUFA 3AAUA 1N6YA 1SLVB 5DP8A 3U1IB 2GVFA 3MO3A 1WF8A 1UHBA 3SNDA 1CT2E 2BVSH 2ZC9H 1MH0A 5C1UA 1ARCA 2ALVA 3DJ3A 2P8OC 3SQHE 2ZQ1A 3T27A 3MYWA 1P2NA 4NXRA 1BRCE 1S85A 2ZFSA 3SUFA 2F9OA 4XDEA 4IN1A 2BYAX 1VCWA 2CSSA 4AG1A 2FOGA 4WYUA 3SBKA 3K1RA 3A87A 2P3WA 3PLKA 2JSNA 1P0SH 4Q7ZA 5C17A 1EAWA 1Z1IA 2BLVA 3TH2H 2H2CA 1N6EA 1YCPM 1FAXA 4MVNA 4NXQA 5HFFA 2DC2A 1SLXB 1WI4A 3ZZDA 3KYFA 1LHCH 1VITH 2A2XH 4GPGA 4CRBA 1SPJA 1ACBE 1IQKA 3OFND 1U6QA 4Y8ZA 3F9EA 4UU5A 5A09A 2FTMA 1C4U2 1C5YB 2BMGB 2ZKSA 3MMGA 1F0SA 2JH6D 1C2DA 1YLNA 1V2RT 1X45A 2V6NA 1PFXC 4BAOB 4YESB 5T6DA 4NMSA 3BTME 2V3HH 1FQ3A 3GISB 1AZ8A 4O3TA 1FPHH 5DP9A 1HIAA 1ZGIA 1HJAC 2PSXA 1GQ4A 2GEFA 2ZI2H 1Q3PA 3SUGA 1T4UH 4BTTB 1BDAA 1UVSH 2J92A 2OTVA 4HTCH 1Z7KA 2ZHFH 4ZHMU 5E6PB 4Q2KA 5A0BA 1CVWH 3SI4H 2YNAA 2ANKH 4O3UA 4AFSA 4YDPA 4FUFA 4ZXXH 1I16A 2UUKB 1UTOA 1G9IE 2BD7A 1SHHB 2HE2A 2ZDMA 4RKOB 1CGJE 1GI4A 5EJ1A 1OBYA 2GT7A 2TIOA 2H1UA 4X2VA 4O9VA 1CU1A 1ZSLA 3OYPA 1C2IA 1W9QA 2GCTB 1QNJA 2X7ZA 3D23A 3KYGA 3OSYA 4ABGA 1S82A 9ESTA 4X1PU 4CHAB 1UEPA 4ASHA 5LPRA 4JCNA 3LGUA 3MFJA 5HIZA 3E0NB 4JK6A 1AI8H 3ZZ5A 1YKTA 2MX6A 1GBCA 2F9NA 4GAWA 2GKVE 1N7EA 2A2QH 3LDXH 2VZ5A 2XCNA 3F3BA 3TSVA 2OLGA 4CRDA 4Z33A 1V2OT 1TPSA 4I8GA 6LPRA 8ESTE 3A89A 2F91A 1CSOE 1P2OA 2ZU1A 3A8CA 4X1RU 4B71A 5HXFA 1MD8A 1MABB 3ESTA 2QKUA 4KTUA 1HGTH 2C8XB 1KTTB 1FN6A 5AHGH 2FOCA 3RDZA 2DAZA 1NFYA 3L6PA 2H3LA 2ZHWH 2R0LA 2BYGA 1FN8A 2Y7XA 3V12A 1WUNH 1J14A 3QK1A 1SOTA 4MPUA 3CS0A 1ESBA 3RXQA 4RT1A 2ZFRH 3MU4A 3AAVA 4WY3A 4Y0ZE 4JJ3A 1QRZA 1SGQE 2UUYA 2VGCB 3GCHC 1LHEH 1AKSB 1BTWA 1NU9A 1QTFA 4ABJA 1O3HA 2VSVA 2D8WA 1OP0A 2GCHF 1EXFA 1SGYE 1XUKA 1PPFE 4GSOA 3P17H 2FO9A 3PLBA 1C1NA 1LPZB 5TCAA 1EASA 2KCOA 3TH3H 5JPMH 1BITA 2ZFQH 1TQ7B 2B8OH 3RP2A 1Z86A 3AXAA 1LDTT 1QJ1B 5E8EH 3VG8A 3SJIA 4NMPA 3S7HB 1G32B 1ZMNA 3CH8A 2FP7B 2PSYA 3DCLA 5EXLA 5HFBA 2WYGA 3EA8A 1TNKA 1PYTC 5ETXA 3LGWA 1UCYE 1BZXE 5FCRA 4O03A 1NFWA 3NFLA 2G52A 1GGDC 3E91A 4OGXA 4KFVA 1ZYOA 4K76A 7ESTE 1L0ZA 1MTSA 2R2MB 1J8AA 1HB0B 1GCTC 1GHYH 2G81E 2H3MA 1RTLA 1CO7E 4FLNA 1Q3XA 1SGFG 1PPGE 4ASUD 3FN8A 1QB1A 1O2RA 3RXHA 3D65E 4K8BA 3CC0A 1EKBB 1GDNA 3FO8D 1BBRH 1TGSZ 4Y8XA 3TSZA 1TX8A 1O3NA 5F8TA 1AD8H 3BTTE 4WF8A 4DIIH 2ZHDA 2B7DH 3SJKA 1DXWA 2OMJA 5B6LA 3LU9B 2WV5A 3P6ZB 3OTJE 1SLWB 2ZQ2A 1A1RA 1HAZB 1JRTA 1ELGA 4FETA 3ODFA 1SGPE 2R9PA 5ESBA 1O3MA 2EDVA 2G51A 3ATKA 3VQGA 1NRQH 1GJCB 2J9NA 2Z9JA 4FGMA 1HIAB 2PKSB 3K6YA 3M5NA 1BTUA 3I4WA 3DA9B 3MHWU 1YPMH 1IHJA 2F43B 1DS2E 3A82A 5AFYH 1EZUC 1ZRKA 1K1JA 1UCYK 5L30H 5JB8S 1JXPA 1NT1A 1IOEA 1ZTLA 2Z9IA 1O3LA 1TGNA 2GCHG 1G37A 2YMSD 3VPKA 1O3JA 1IQIA 3QGNB 4TWWA 2ZPLA 4YTAA 5JYIA 5ILBA 3S9CA 1B8QA 2QV1A 3SORA 2M0VA 1OWEA 5J4SA 2Z6BD 1TNJA 1ELVA 3CENA 4NG9H 4GUXA 2FE5A 4AFZA 1SGCA 1GVZA 1UITA 1XMNB 4UEHH 2HGTH 1HFDA 3OEED 4Q7XA 1FI8A 3SUEA 1GG6B 1KDQA 3C1KA 4O06A 1LVYA 4X8TH 1O2UA 1O2TA 3VB5A 1A0HB 3UPEA 1TONA 2QAAA 1V2LT 1EB1H 1FXYA 3ZVBA 1AN1E 2TGDA 2VVVA 1ABIH 3SHUA 4AZ2B 3SV8A 4Y6DA 2CN0H 3BTEE 1D3DB 3QGLA 3M3TA 4CRCA 1U37A 1QL8A 3EGGC 4I8LA 2TGAA 1ZOKA 1AB9C 4NA8A 1O0DH 4XRNA 3M7QA 1AO5A 4MQAA 4FUDA 3SUDA 1UTKA 1EP6A 3LC5A 3SGQE 2PKAA 2ZCHP 1EB2A 2Y5GA 3BTWE 2EY4C 3A8AA 5DKMA 2EEKA 2QT5A 4P2AB 3UNQA 1RZXA 3WKLA 3EA7A 1S6HA 1H8HD 4MPWA 2GMTB 2WPJS 1MC7A 3U8TH 3N7DA 3P8OA 1K1PA 1O2NA 3O8BA 3UR9A 4HZHA 2PGBB 2EGKA 1KXEA 2P93A 4XFQA 2FXRA 4Q3HA 5HETA 3F9FA 2ZTZA 1IQFA 4Y7AA 4NIWA 1OZIA 1TQ0B 1YLDA 2Z94A 2R3YA 1O3CA 3SU2A 3GCTF 3R0HA 1C9TA 1EP5A 4D8NA 5A2PA 5T1VA 3P95A 5EQQA 4LK4A 2BXUH 4K75A 1DM4B 3ZIAD 1YPHC 1G2LA 5EIYA 2ZDKA 4LOYH 1V2MT 1L2EA 1W7GH 2PLXA 2Y5FA 2PZDA 2ANWA 1WAYB 1V5LA 5HYOA 3AW0A 2AHME 1WOFA 1UJVA 4X1NU 4CR5A 1MU6B 1O5BB 3KHVA 1EOLA 3JZ2B 2Z9KA 1S5SA 1LVOA 2ZHEH 1UM1A 5E22A 2ALPA 1MQ6A 4GHNA 4CH8B 2VB0A 4WH8A 1ZGVA 2FOHA 2OXSA 1FV9A 3EGKH 1G30B 1BJUA 1ELAA 3SV7A 1O2HA 3RXOA 1V2JT 1FNIA 1DSTA 3MQKC 1P2KA 3ZVGA 2QCYA 3VB7A 1EQ9A 2BY7X 3BG4B 4K8YA 4IMZA 1E79D 1H8ED 2F83A 3A80A 4YT7H 4B6FA 2OP9A 2HRVA 1S84A 3RM2H 3Q77A 4WMEA 3U98H 1DSUA 2ZO3H 1P3CA 3EE0B 1GJ8B 4NSYA 2FM2A 2PUXB 3DFJA 2EI7A 1O37A 2B0FA 5GCHF 1SVPA 3ZYEA 2YT7A 5FPSA 1DXPA 2V3MA 4TPYA 1AWFH 5HKKD 3K65B 2AGEX 2OBQA 5DN6D 1QJ7B 4AYYB 5C3NA 2WPHS 3E17A 2RA0A 4CBOA 3MTYA 4F8KA 1W11U 2F5YA 3NGHA 3ID2A 1OPHB 2F9PA 1GCDA 1YLCA 3MWIU 3BEUA 4YXWD 2A45B 1L4DA 4X6NA 3GCTG 1CGIE 2AEIH 2D8IA 1W0YH 4Y11E 3SZNA 3EQ0H 4AN7A 3DJAA 3TK5A 1K1LA 1WU1A 4E3BA 1T4VH 1BMMH 1YBOA 2EGOA 4NMOA 4M7GA 1C2MA 1A0LA 2QKTA 4RI0A 3ZRTA 2XWAA 5FPYA 2AWXA 2QXIA 3W95A 3L4FD 2FEQH 1NRSH 2OZFA 1E35B 1O33A 1KDQB 1XZ9A 4D7FA 4FU7A 2NWNA 4B6EA 2ANMH 2O8WA 3BPUA 2GCTC 1DANH 1FY5A 3V0XA 1QL7A 5E2OA 3QLPH 2QXGA 4H6SB 2OSGA 3U28C 1UK2A 4Y10E 4Y76A 2A4QA 1ZPCA 3SN8A 4KGAA 5JXBA 1C2EA 4AMHA 2P3UB 4TY6A 2I0LA 1YPEH 3H5CB 2G8TA 2JJ1D 3TITA 1TGCA 2ZA5A 1P06A 3UTUH 2HOBA 5PTPA 2D2DA 5JDUB 2EGNA 1A3BH 4MLFB 2PFEA 4CH2B 2A7HA 3UUZA 4MG3A 3GSLA 4ABFA 2QY0B 3H09A 1UCYH 3P8GA 1GI0A 2PKAB 4INKA 1AMHA 2J94A 1O3EA 5DGJA 1RD3B 1A3EH 1F0TA 2KAIB 5G1DA 5C0UA 2DB5A 1YPGH 3A8BA 5EGMA 1V1TA 1BE9A 1LPGB 2QF3A 5GCHG 3HPMA 1Y5UT 2AS9A 1UJDA 1DWDH 1OXGA 1CA0B 1C2GA 1FCFA 2XBWA 1HLTH 3GY6A 3SGAE 2VGCC 1QAVB 3KEEA 4ISIH 4MDSA 4NWKA 4FUEA 5CMXH 2TBSA 3URDA 3M3SA 2FDAA 1C2JA 4PROA 1D6WA 3ODDA 1V2WT 4NIYA 1NM6A 2EDPA 4AOQA 1N99A 3FANA 4NMQA 1FC7A 4GHQA 1BHXF 3I77A 4JYVH 1UEQA 2W6JD 4YM9A 2DLUA 2LC7A 2ZP0H 4O97A 2EHRA 2XNIA 1O3PB 1WFGA 2EAQA 4OM9A 1EJNA 1L1JA 1UTLM 3FAOA 1O2MA 2GZVA 1P2JA 2V7QD 1NFXA 1OBXA 2M3MA 3TSWA 1A5HA 2ZWLH 3QUMP 4YT6H 3OY5U 2TRMA 1G3EA 2JWEA 3SNEA 4LXBH 2RRMA 1Y3XA 3AW1A 3AK5A 4H42U 3QDZB 1NU7B 2PKUA 4XHVA 2FYQA 4MPAA 3GY2A 2I6SA 1C1MA 2Y81A 3RLEA 1ZSKA 1F0RA 2AMPA 3MU0A 2BLWA 2FI5E 1Z1JA 1TA2A 4EDJA 1W12U 4CBNA 1F7ZA 8GCHF 4ZUHA 3TJNA 1GHBF 1ELBA 4BAQB 5I25A 1GBEA 3CBZA 2TGPZ 2PDZA 1YY3A 3ATLA 3SHAH 1E0FD 3ID4A 2LPRA 1WDIA 4ZKRU 1ELTA 2BD8A 3DSGA 2GDEH 3F0PA 1HCGA 4X2WA 2VPHA 5G4BA 2KRGA 2QF4A 2P95A 4I8HA 1WHDA 1QBNA 1BRUP 1TALA 2VIQA 3ZZ7A 2KG2A 3BTQE 4XBCA 1MAYA 4FVDA 2AGGX 4UFEH 1MKXK 2B5TB 3F9GA 4AYVB 4DW2U 4Q2OA 2GD4B 2PKSC 1BBRK 4JYTA 1LKBA 1WV7H 2PWXA 4FXGH 4X6MA 1KY9A 2VSPA 2K0QA 3ZZCA 2Y82A 2PUQH 2ZECA 3A7XA 1WTHD 4U01A 1SGRE 1YPJH 2BDGA 1BTPA 1A5IA 1FONA 1EJMA 1XUHA 3F9HA 5IDKA 4WXIA 2EEHA 2LP6A 2DE9A 2BY6X 4OAJA 1FLEE 2CV3A 1FY3A 5IK2D 3MU8A 4FUIA 5HF1A 5EPNA 5LPFA 1Q3OA 1TP3A 5F67A 1MTWA 1O3FA 5J4QA 3L3TA 4ISLA 1C5PA 1S83A 3M37A 3PDZA 2ZPSA 1KLTA 3RXPA 3SNAA 4JOJA 2Y80A 3R3GB 1NESE 1DLKB 2BD3A 2IJOB 3LKWA 1UF1A 4NIVA 2I6QA 4H6TA 1DVAH 1OX1A 1GG6C 1C5MD 1HAVB 1NO9H 3ZZ3A 2DE8A 4TYDA 1G3CA 1TBQH 3E90B 1QL9A 2C3SA 4K78A 1CHGA 1GJ7B 2NU1E 1X8SA 2XC5A 1QB9A 1C4Y2 1AZZA 1MBMA 1XUJA 2QF0A 1GHZA 1GHXH 1RJXB 4I86A 3SU4A 2UUFB 1VJ9U 1RRKA 3SU0A 3BEFB 4FU8A 1SGEE 5D13A 5KGOA 2YOLA 3KF2A 5DG6A 1IHTH 2OK5A 3KDKA 3HKIB 1PQ7A 1DICA 2H5CA 3KQDA 1MD7A 1B7XB 2W7SA 1DY8A 3UOPA 4BXWA 2LA8A 2QKVA 1EFRD 1GJ5H 1LHFH 1A0JA 1YGCH 8GCHG 1TIOA 2ZPQA 3BTDE 1GHBG 4AGJA 1SGFA 2BX4A 3W94A 5G1EA 6GCHF 1FY4A 2Q1JA 2ZGCA 2GMTC 3GOVB 2PNTA 4ACBA 2VWLA 1V2VT 2VIOA 4X8UH 1GBMA 1SR5C 5FB8C 5LPEA 1HAIH 1YPHE 2Y5HA 2CJIA 3PTBA 3UREA 4KELA 1DWBH 1SQAA 1EJAA 1SC8U 1WSSH 3RXSA 1ZHPA 1BRBE 1LCYA 1E1RD 3TU7H 4GVDA 1GHAF 1UK4A 2XW9A 3A86A 1C2LA 1D9IA 1EAXA 2A7JA 2H9TH 3A88A 2L4SA 1T31A 3EA9A 3K2UA 3ID3A 1UEWA 1HJ9A 1NFUA 1L1NA 2OINA 1GBIA 2AMQA 1C1VH 4X2XA 4BAHB 2Q6DA 4OS6A 3VB6A 1MUEB 1UJ1A 1BIOA 4ZROA 1QBVH 3B9FH 2ODPA 1DUAA 1EPTC 1KYNA 4A1XA 2H2BA 2OCSA 2ESTE 5HFCA 4D76A 1O2KA 1P2MA 2DUCA 5FBEA 4G69A 2EXGA 1OHHD 3KIDU 3TGJE 5F53A 1O36A 5T6FA 3MH4A 4I32A 5FX5A 2G2LA 1V2TT 1ZMJA 3Q00A 2BY9X 1H4WA 5GWZA 2KPKA 2DJTA 2M0ZA 3OX7U 4A92A 4E35A 2ZU4A 3C27B 1RS0A 5EJZA 1WG6A 1TPPA 1HAHH 1UHPA 4A5TS 1GL0E 2P3TB 2XBVA 1O34A 5H4IB 5C20A 3O8CA 4B74A 2Z9LA 3MNSA 1F5RA 1FY8E 3IITA 3VXFH 1RY4A 2SGEE 1ELCA 4RN6A 1UMAH 3CNRA 2VRFA 2J4IA 3GY7A 1X6DA 3TIUA 2OS6A 1ZLRA 1B0FA 3E0PB 2KAWA 1Y3VA 3V3MA 4E05H 4NGAH 6GCHG 1WJLA 4NFFA 3V13A 2PP6A 1MAXA 4BXSA 5F8XA 5EQSA 4Y8YA 1IQJA 4JORA 1SG8B 2JOAA 1GJ4H 3ENSB 1LHDH 1BT7A 1FAKH 4PQWA 2AYWA 2NU4E 5GLJA 2SGDE 2XXLA 2WUCA 2PKTA 3ZV8A 1FDPA 4ZHAA 3LGYA 5CHAB 1J9CH 1O2JA 2ZEBA 1K32A 5HJ1A 1TWXB 2GT8A 3RXUA 1GHAG 2V35A 4NA9H 1KWAA 1VJAU 2JDID 1AHTH 4BANB 4ESTE 2FS8A 1UVOA 2FESH 1ZOMA 3N7OA 1V2KT 1RGWA 1O5DH 3A8DA 1UHBB 5E2PA 1MTNB 2HPQH 1QA0A 4U2WA 2OD3B 3KQ5A 4GLYA 4MTBA 3ZYDA 2KOHA 3GDVA 1OBZA 1GDUA 5IYTA 3RXBA 2F9BH 2BDCA 3SV2H 1SQOA 2OC7A 1QCPA 1H8IH 3E3TA 1O2QA 4Q4LA 4J1YA 1ESTA 1CBWC 1ANCA 3P70B 3Q3KA 1INCA 2ZPRA 2ZDAH 4U30A 4WXVA 3S9BA 1ABJH 4N6XA 2SFAA 1CHOF 1MKXH 2A32A 2GTBA 1WI2A 4F49A 1T32A 2M0UA 3ZVAA 2ASUB 3UAIC 1YPKH 5JBBS 1W10U 1GI2A 3FOAA 3Q3YA 2I1NA 3WKMA 1C2KA 4JMYA 3BSQA 1E37B 3SV6A 1FJSA 3SYJA 3UWIA 3UWJH 1LKAA 4Q80A 3UQVA 1P04A 2FLBH 4K2YA 4MNXA 2THFB 2A5AA 4THNH 2Z9GA 1C5SA 5HM9A 1PPCE 2ZDVH 3RXJA 3RXVA 3GS9A 1O2XA 1VGCB 2NU2E 3T28A 4AB8A 1FZZA 4ACAA 1C5RA 1W14U 3QX5H 4KP0A 3VQFA 1CQQA 3F2FA 1Y8TA 1CA0C 3PWCA 2F4LA 5C1YA 4ABHA 3DD2H 3MNCA 1C1RA 1PDRA 2G5VA 3OAAD 4HOPA 1V2ST 5LGOA 1O3DA 4ISHH 4NWLA 1GMDF 2HLCA 2QGRA 2VWRA 1GWAA 1VAEA 1GJDB 2A5KA 2HVXA 4IMQA 4K1TA 1O2LA 2BB4A 1HNEE 1K1NA 1ETTH 3PV4A 2XBXA 1D3TB 3A7TA 1NPMA 1GM1A 1BTYA 4OGYA 3RXCA 1FC9A 1W8BH 1O2PA 2QE7D 1X9ZA 2KCYA 2ZCLP 1ANBA 1QLCA 1IQNA 4MNYA 1O32A 1TNHA 1KXDA 2L6OA 1OWKA 1Y3YA 2ZGHA 2Z3CA 2W3KA 2LNCA 1EAIA 3R0FA 1SI5H 1GI1A 1O30A 1ESAA 3U69H 1GI7B 5E0HA 1CGHA 4ZKSU 1GJAB 5JBCS 1PQ5A 3QE1A 4D9RA 4OS2A 2P3FH 3MNXA 2OC0A 4H11A 1EX3A 3ELAH 2FCFA 4WWYA 1UEZA 2GP9B 3VGCB 1BA8B 1OYTH 3UOUA 4ABAA 1Z87A 2OC1A 2VIDA 2EI6A 1M5ZA 2BDAA 2EA3A 1V6BA 3MI4A 3SJ9A 4ZCNA 1C1QA 1J17T 1PPHE 3T25A 1Y7NA 2YUYA 4BTUB 1ELFA 3QWCH 1J15A 3RXRA 3UR6A 5H3JA 3BIVH 2D92A 1UTPA 1NTPA 1KLJH 2K20A 4X8VH 2A1DB 1BTXA 5E21A 3SOSA 1T7CA 3T62A 1GJBB 3QJNA 2WPIS 2OC8A 3GYMA 2SNWA 3M36A 3E6PH 2GDDA 4XE4A 3F68H 2AINA 3ITIA 1KSNA 3K6ZA 2UWOA 1O2GH 2WZQA 2SNVA 1HAGE 1RGRA 1T8LA 2QA9E 2WPDD 2ODYB 3TGKE 2FI4E 2H5DA 2XOKD 2ZU2A 1GMDG 1JIMA 1P09A 2BTCE 1NY22 2KOJA 3SNCA 9LPRA 2BOKA 2J5UA 3ZZBA 4Z0KA 4FUBA 1TQ3A 3F2GA 1P1EA 2Z3EA 4MNWA 1O38A 1YF4A 1TPOA 1NTEA 5EYZA 2Q6FA 5TCCA 2W7RA 1O3GA 2A0QB 4JZFH 1JBUH 1E36B 4GHTA 2ZFPH 4ISOA 3RMOH 1WQSA 2KFWA 1NRRH 1O39A 2XYAA 2OUAA 1TGBA 2E7KA 3QTVH 1O5EH 1FY1A 3LOXA 2WV4A 1BMFD 2QF5A 1YBWA 4MNVA 2FODA 1OOKB 5BRRE 4B2AA 4AFUA 3ZZ8A 3F0OA 4ABEA 2PR3A 5DP4A 1TBZH 1GHVH 1MTVA 2VNTA 3MH6A 2BZAA 3RL7A 2C8WB 2IJD1 4HGCA 1BJVA 2O2TA 1P01A 2JJ2D 4UFFH 1E38B 5GPIB 3SHWA 1KXFA 1UFXA 4K60A 3M5MA 1Z8IB 2IN2A 3BTKE 3U8RH 3HVQC 1DE7H 3RC4A 5C94A 3G01A 2DLSA 1OWIA 2EEJA 1GDQA 5F8ZA 1ZRBA 3SJ8A 2BVRH 2BQ7B 4CRGA 1MFGA 1TNLA 1GBTA 4UE7H 3AASA 1QHRB 3OY6U 2KX4A 1G2MA 1TX7A 1V5QA 1FIWA 1ZMLA 3MH5A 3AVZA 1W3CA 2ZDNA 4HOPB 3RUOA 1KIGH 2BDYA 3A7VA 2BY8X 2UZCA 3A85A 3LJJA 1XXFA 3S0NA 2BLOA 1GVKB 2ZFFH 1ETRH 3HKJB 2OPGA 1UTJA 3RXTA 1O2YA 3KL6A 1EATA 3GGEA 4JOHA 2F3CE 1GQ5A 4AC9A 2BXTH 2VH6A 3VFEA 3PB1E 1HAOH 4XOJA 2LELA 1X5NA 2VWMA 3ZVCA 2M0TA 1WIFA 1HXEH 2EC9H 3JZ1B 1NRNH 3KZEA 3B23B 1XM1A 2Y6TA 1O3KA 2ZGXH 1TOCB 4ZAEA 5KECA 1OWDA 2J98A 3DSOA 1VR1H 5CE1A 5EW1H 1WCZA 3W1EA 1FPCH 5DJ7A 2A4OA 2FYRA 3PWBA 4GVUA 5EG4A 4CHAC 1N7TA 1DDJA 5HFDA 2G5NA 2A31A 2ZTXA 3PYHA 2A5IA 1GJ9B 2CK3D 1L4ZA 1MBQA 3BEIB 3KHFA 1ZJKA 5GIBA 2JILA 5GXPA 3CBXA 1Z71A 5GDSH 2B9LA 3F1SB 2NU0E 2QYIA 1OKXA 3PS4A 3TNSA 2GJGA 3DHKH 4IW4E 5DP6A 1GI5A 3RC5A 4TT3D 4E7NA 1G3DA 1HYLA 2IWNA 2JREA 3PDVA 3K50A 1J16A 3EAJA 2ZGBH 1IU0A 3FKSD 1ZTKA 4X0WU 4BAKB 3RC6A 1TYNA 3QJMA 1A61H 1GBJA 2HNTC 4IBLH 2FOFA 1XUGA 4FUCA 2OQUA 2PGQB 1O5CB 1TOMH 3NK8A 2WSSD 2GZ7A 1D3PB 1NF3C 1IU2A 2AWUA 1SB1H 3TJOA 1HV7A 2LC6A 1Q31A 1ANEA 4AX9H 1P2QA 3WW7A 1O2SA 1X5RA 3LGVA 1P1DA 2ZZUH 3TH4H 2XRCA 4IC5A 5E11A 4M9FA 4TWYA 5L6NH 4YYXA 4A6LA 3FZDA 1AWHB 1JOUB 1HAYB 5CHAC 1ZTJA 1OSSA 1LMWB 2JINA 4UDWH 5I46H 7LPRA 2DMZA 2R3UA 4GVCA 3LNXA 1EZQA 1C5XB 5TJXA 1C2FA 1IQLA 4IS5A 3RXMA 2W26A 1WXRA 2SGAA 3GDUA 1MQ5A 2HGAA 1MTNC 4NZQA 5GJ4B 2PA1A 1AUJA 4DG4A 3GY4A 1EUFA 2PTCE 4YOIA 4NZLA 3SO3A 1PPBH 4D9QA 2JIKA 3GABA 3RXFA 5ESTE 3PMJA 3E1XB 4NXPA 1THPB 1MZAA 2VWOA 1C1SA 5A2MH 2ZF0H 1GI9B 2FWWA 1YYY1 2O8MA 2KA9A 1KEFA 3ZVDA 1QFKH 3UNSA 3RU4E 5A8ZA 3MO9A 3GCOA 3MOCA 4SGBE 1UTNA 5L2ZH 4P02A 4B76A 6ESTA 4R2ZA 2SGPE 3R69A 3BV9B 2G55A 1I92A
chains in the Genus database with same CATH topology
5K7RA 1C5VA 5EODA 4DIHH 2K1QA 2GV6A 4WMFA 1IQGA 2FOBA 4Q6SA 2QXJA 1UVTH 2KJPA 3RU4D 3Q76A 3A7WA 1O5FH 3SUZA 4UFDH 5F03A 1YCPH 3OTPA 2XC4A 1DITH 2CF9H 1W0ZU 1GBDA 1VGCC 1N6FA 2VVCA 2BOHB 1NZQH 2CHAB 4X2YA 4UFGH 1GBHA 4UD9H 3R68A 4OEOA 1TLDA 3H7TA 4ABIA 1W7XH 3SNBA 1P03A 1RXPA 4JZEH 2TPIZ 3RL8A 2KBSA 1XVOA 1VA8A 5FHTA 1HRTH 4ZMAH 2OBOA 1NROH 4E34A 1TNGA 4I8KA 1CE5A 1OP8A 2ODQA 3E16B 3STIA 1N8OB 1ZR0A 1C5NH 4JK5A 3JXTA 1HDTH 1SGNE 1Y5BT 3TLOA 6CHAB 1OWHA 1SMFE 5LH8A 1AKSA 1VCPA 2Q6GA 1ZJDA 4B1TA 1DPOA 1QR3E 1QQ4A 1BTZA 4Q2PA 1F5KU 3MU1A 1WHAA 1HPGA 1TA6A 7KMEH 3KGPA 4CREA 1BMAA 2AWWA 2O8TA 1MCVA 2O8LA 3DFLA 3GICB 1G9OA 3QDOA 3HK6B 2FPZA 1ELEE 3A84A 1QJ6B 1TAWA 4NNLA 1LO6A 5FXLA 1VB7A 2STBE 3M7TA 1BQYA 2GV7A 1HAXB 3VXEH 1BFEA 1K28D 5EXNA 1T8OA 5AF9H 1RFNA 3O8DA 4NIXA 4B2CA 2FN5A 1DY9A 4AG2A 2EDZA 1SBWA 2GZ8A 3VGCC 4FUJA 5A0AE 5HGGA 2JKHA 1ZHMA 1T8NA 2HNTF 1Z8JB 4JL7A 5DK1A 1S6FA 1O35A 2XTTB 4OS7A 4AB9A 5E0GA 5C1XA 2P94A 1C9PA 1RIWB 1W9EA 4K72A 4IC6A 2BDBA 5B42A 5HMAA 1E34B 1XKBC 3HATH 1LQEA 3KCGH 2R0KA 2EI8A 3QN7A 1PQ8A 3RLWH 5FX6A 4TY7A 1BMLA 3MNBA 1W13U 2XBYA 3HGNA 3M61U 1V2PT 2JH0D 2LUIA 3T2NA 3TVJB 1K1IA 1O2OA 2ZCKP 2OCVB 3GDSA 1HJ8A 2Z7FE 2OQSA 7GCHF 5HF4A 2A4GA 3SU1A 4HFPB 1D3QB 1KLIH 1Q2WA 5B6OA 2CMYA 2XWBI 5HEYA 1V2QT 3GJ9A 2K1ZA 2D1JA 1SL3A 1WYKA 1VZQH 1A4WH 4J2YB 1GI3A 2H9HA 2STAE 1B5GH 4BOHA 1X7AC 2BX3A 3S9AA 4A1TA 1YM0A 1HXFH 3U8OH 3TMHA 1QRWA 2Q9VA 1G36A 2V90A 1QY6A 3CP7A 3A7YA 3FFGA 3RXIA 2BD5A 4YLQH 1JIRA 4FVBA 1NN6A 3QTOH 5HEDA 1K22H 4Z8JA 3GCNA 1B0EA 1C2HA 2IWPA 3BG4C 2ZPMA 4K3JA 3Q3XA 1VCQA 2EV8A 4DURA 3MH7A 1GHWH 1P05A 4CRFA 4VGCB 1S0RA 2NU3E 1K1MA 1C5WB 4SGAE 2KOMA 1O2VA 3M3VA 3KNXA 2FNEA 4CR9A 4I31A 2KYLA 1Z8GA 3BG8A 1N1LA 4IGDA 3FVFB 5ABWA 2PHBA 2BM2A 2FZZA 1ZPBA 3ZZ4A 2CGAA 1DFPA 4Q2QA 2I4SA 4NMRA 4NMVA 8KME2 3VB3A 3HPKA 2ZHQH 4ZH8A 2KV8A 3UQOA 1TMBH 4JZDH 3H7OA 1IQHA 4I7YH 1AIXH 2O9QA 4Z6AH 2F9UA 5C5OA 4LZ1H 5IL9A 2FOEA 3UNRA 1N7FA 3FZZA 2IWOA 2WYJA 5AFZH 1ID5H 3PV5A 1SHYA 1BTHH 1F92A 3B8JA 3SU3A 4JYUH 2Z17A 2AMDA 1GPZA 3RU4T 4LMMA 1V3XA 2Z3DA 1QAUA 2Y7ZA