1SOZA

Crystal structure of degs protease in complex with an activating peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
311
structure length
281
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 281
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sozA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA02
1C1QA 1S82A 2JH0D 1TP5A 3M7QA 3I77A 2P94A 3E8LA 4Y79A 1QJ6B 5E2OA 1AFQC 1BA8B 1GDUA 1PDRA 4WXVA 1O2LA 3RXTA 4UFGH 1P2NA 5DP4A 2A31A 1P0SH 3HK6B 1EZUC 1SBWA 2HLCA 3M3VA 1PFXC 3LH1A 3PV5A 1O2XA 1TOMH 1Z71A 2GDDA 4I8LA 2CHAB 2ZIQH 4OS5A 1EP5A 3VGCB 1HRTH 2W5EA 1S6HA 4CRGA 4DT7B 3MYWA 5D13A 3RM0H 1O32A 2F9PA 1TFXA 1GBDA 3DIWA 3TSVA 2HPPH 1F2SE 5FBIA 3AXAA 2R9PA 2O9QA 1UCYK 1RRKA 1AGJA 2FI5E 3HPKA 1QAVB 4A1VA 1V5QA 1C2HA 1YPLH 3MU8A 3SQHE 5EPYA 2PFEA 2ENOA 1GWAA 3MH5A 5L2YH 3RC5A 1G9OA 1W9QA 3U1IB 1BMMH 2ANMH 1Q2WA 1CE5A 1L1GA 1L4ZA 4R0IA 1WBGB 2QC2A 4JZIA 1AIXH 2BX4A 4K60A 2FNEA 2KOMA 3QTVH 2ZFRH 2YOLA 1VA8A 2ZA5A 4DGJA 1QL9A 4K75A 1KXCA 1SL3A 4ESTE 7GCHG 4FUBA 3RXBA 2Y81A 1QJ7B 5FPYA 2ZGCA 1OWKA 4X8VH 1RTFB 6ESTA 1BMLA 1GG6B 3TJOA 1UTMA 2P3FH 4H42U 4HGCA 1TGBA 1UVUH 3TGIE 2GP9B 2ZPLA 1D3PB 1RIWB 4O03A 1G2LA 5HDYA 2FODA 1QFKH 1OX1A 1KEFA 1GJ7B 1C2IA 2ZDKA 1GJDB 2IN2A 4K1TA 1SQTA 2R4HA 4D9QA 4K78A 2GV7A 3JZ2B 3ODFA 1JBUH 2QXHA 3BEUA 3A7YA 4LK4A 2UZCA 4MPAA 1P05A 4NNMA 1OSSA 1A5IA 3PO1B 1C1UH 4Q2OA 3IITA 1OP0A 3KIDU 4X1NU 1C5TA 1SGTA 2K1ZA 1C5QA 4E7RG 3HPTB 2OS6A 2BVRH 1SMFE 2VWNA 2DB5A 1E0FD 2UWOA 4XHVA 2TGPZ 3F1SB 2DE9A 2KYLA 1YPHE 4BXWA 2Z3DA 1CA0C 1V2LT 3NCLA 1GI6A 1TPPA 2HNTE 1AB9C 1CA0B 2GCHF 2AEIH 1BJUA 4MNYA 3NFKA 1IQLA 2AIQA 4X8UH 1E34B 4Q3HA 2ZGJA 3AW0A 3LIWA 1HYLA 2XWAA 4ABJA 1MTUA 2BHGA 2V35A 3RXCA 1WHDA 4Z8JA 3SU4A 1AVWA 3VEQB 4E7NA 1UM7A 1V5LA 1CQQA 1TOCB 2NU4E 4BAHB 1P12E 4P2AB 4A1XA 1TQ3A 2ZFQH 5F8TA 1RFNA 3E17A 1C2KA 3EA9A 1JRTA 1SG8B 1XUJA 3SOSA 1ZRBA 2ZU5A 2VPHA 5DK1A 1ZMLA 3GY6A 4ZMAH 2UWPA 3ZZCA 1GBCA 2I0LA 3BPUA 2BQWB 4OGYA 2SNVA 1ZTJA 1LVBA 2EHRA 3ENSB 4ABEA 3ZVGA 2GDEH 1TA2A 3A8CA 2J92A 3SZNA 3A7XA 3ELAH 3UR9A 3MU1A 2PV9B 4ZKOU 2KJDA 3NKKA 1CBWB 2FOMB 1W2KH 1LHCH 1WAYB 1XX9A 3S9CA 3ZVEA 1C1OA 2ZU4A 3TLOA 1T8MA 2SGPE 2KRGA 5HFEA 2GKVE 2H3LA 3D62A 4HI3A 1UF1A 1N8OC 2FOEA 1CU1A 3RP2A 1U6QA 1ZJDA 2PKSC 1TBZH 1NC6A 3SNEA 1KXDA 1N6YA 1A0HB 3LPRA 1OWJA 1C2EA 1C5PA 3C1KA 5FAHA 2TRMA 2XC5A 1DFPA 1J16A 4GUXA 3URDA 3GCTF 4ABAA 3EE0B 1VGCC 2PSYA 2WUBA 4REYA 2QV1A 1K1OA 2YNBA 4YYXA 2PDZA 1TNLA 4JYUH 4ABGA 2Q1JA 4ABDA 1V2KT 1MFLA 1RJXB 1ZR0A 5EW1H 2UUFB 3TITA 3EA8A 1EJMA 1WCZA 3CBZA 1MMJN 4INLA 1X7AC 2MX6A 4FUFA 1GBHA 3PLPA 4ZHMU 3ATWA 1GBJA 4YLQH 3ZZ4A 1DSUA 1TE0A 3B9FH 1HAXB 3K65B 3BTFE 4X2YA 2ZTXA 2JINA 1Z8RA 1V2JT 1Y5AT 1V2QT 1YLCA 1FPCH 1VAEA 2BD9A 2HOBA 3E3TA 5LPRA 2AWUA 1SGRE 2DC2A 2QKVA 3ATKA 1BDAA 3SNDA 3TJVA 2I6QA 3ZZDA 3DFJA 5FCKA 2ZGBH 1G2MA 1C5OH 5GDSH 1CA8B 3ID2A 1WFVA 2ANKH 4X6NA 5DKMA 1N1LA 4I8JA 3LDXH 2G55A 1UVPA 1W9OA 2EEKA 2D92A 2GZ9A 5DP8A 2BDIA 4CH8B 1UEZA 1GI8B 2PA1A 1O3DA 1HAVA 2GGVB 1YBWA 3Q3XA 2KPLA 1B0FA 4UFEH 3UIRA 3MHWU 2EGNA 4WVPE 3NZIA 3A7ZA 4YOGA 2XW9A 5T6GA 1UJUA 4JOKA 4PROA 2KA9A 5ABWA 2XC0A 1C1VH 1GM1A 3U8OH 1PQ7A 4Y10E 2KBSA 3LH3A 1UVOA 1J15A 5JDUB 1X5NA 2V0BA 4WJG2 5I46H 5FX5A 4AN7A 3JXTA 1EXFA 1EATA 3T28A 1GQ5A 1NRQH 2B0FA 4WH8A 3P17H 4YO9A 1W7XH 5JBAS 2QXIA 1TQ0B 3M5LA 1EQ9A 1UHBB 3H5CB 3GY2A 4JZFH 5E1YA 4MNXA 4SGAE 4JOEA 2ZGXH 1TBRH 3TIUA 2CV3A 4VGCB 3RMMH 1FC7A 5C20A 5G1DA 1UHPA 2J34A 3O8RA 3SUZA 2VZ5A 1UEPA 3SOEA 3QTOH 3TSWA 1LTOA 1NROH 3PTNA 3E6PH 1IU0A 1OP2A 3SNBA 2ZWLH 1SFIA 1WIFA 1EB1H 2SGFE 2ZTYA 4BTUB 7GCHF 1CGJE 1ZJKA 1YPGH 3BTDE 1BIOA 4BAKB 5L6NH 3A7VA 1GBLA 2QAAA 1MZAA 3M3TA 1HAVB 1MTNB 1DE7H 1PQAA 3DJ3A 1QBOA 1UCYE 1JOUB 1Q3OA 4R2ZA 1O2TA 1ELFA 1RGWA 1ELEE 3A81A 1BE9A 1UITA 3KQDA 3RM2H 1W8BH 4JMYA 1OWDA 2XYAA 3JZ1B 1BFEA 1O3CA 3ZYDA 2IWNA 2ZF0H 1O5AB 1GBEA 1TX8A 2FXRA 3LGIA 1BTXA 1O38A 3GISB 2OQSA 3OTPA 1FN6A 3DUXH 3H7OA 3SU6A 2F9BH 1XKAC 2G5NA 1O2MA 1GDQA 3RU4T 3CYYA 1Z1IA 3SV7A 4CHAB 1DS2E 5E0JA 5AFYH 1EAWA 1KTSB 1YP9A 2FX4A 3GCHB 2ZG0H 2ZCLP 2OZFA 1HDTH 1HBTH 1A3BH 3L6PA 1N6EA 2PTNA 3O8DA 4XBDA 3UPEA 1LQEA 4KFVA 2XCNA 1U37A 1N6FA 1TAWA 1GHAG 4AB9A 1P57B 2JETC 1PYTC 1TPSA 4JYTA 1P11E 1Y3VA 1IQJA 1NESE 2SGEE 4FUJA 2ZPSA 4X8TH 4MPVA 5HM2A 3M3SA 3A88A 2ANWA 1EJNA 1HPGA 1RZXA 1WI2A 1GL1A 2VB0A 1A2CH 5EU8A 3SV8A 3T25A 1C4V2 1H9IE 1SGEE 1TGCA 3GY4A 5J4QA 1O2YA 5GWZA 5HEDA 2WL7A 1UCYH 3S69A 3MU0A 4YT6H 4AB8A 3L4FD 2ZECA 3PV2A 3FFGA 1QBVH 2OSGA 1GBIA 1SC8U 5BRRE 2EDPA 1W12U 1O3AA 1ANDA 2NU2E 1BBRE 1N99A 3PV4A 5JB8S 2XC4A 5DTHA 5GIBA 2KQFA 1AFEH 2ODYB 1O2SA 5GPIB 1TGTA 2QA9E 2Z3CA 1EPTA 1BRCE 3LJJA 3U9AH 5SGAE 1S0RA 3EA7A 5ESTE 1L1JA 1NPMA 4KKDA 1DUAA 1EP6A 3SUFA 4MDSA 3Q3KA 3U8RH 3CBXA 1D3DB 2FN5A 1GGDC 1P10A 1ZGIA 3EAJA 1GDNA 4ZAEA 1NFXA 3CENA 1LHEH 1UTNA 2BLWA 3K6ZA 1F0TA 3A86A 1CGHA 2EI6A 1RXPA 3VB6A 1PPCE 2DMZA 4J1YA 4UU6A 4X1PU 1OYQA 1O2IA 2CMYA 4NMOA 4O06A 1SGYE 2A5KA 2BD2A 2QN5T 4JL7A 5H4IB 1PPGE 3PMJA 2DUCA 3RXVA 3SGAE 3OX7U 4E34A 3RXGA 2G2LA 3QWCH 5H3JA 2ZHFH 5E21A 1YCPK 3PLBA 1O5DH 1BTHH 5C1UA 1BMNH 2IJOB 3RXQA 1QB1A 2G4TA 2GMTB 2GCHG 1QLCA 1J17T 2THFB 1FY1A 3CH8A 2XBWA 3QX5H 2CS5A 3SHUA 2WV4A 4UFDH 1MFGA 1V62A 2J2UA 3KZEA 1OKXA 3HVQC 1DITH 1SGIB 2GX4A 1QHRB 3GY8A 3A7TA 1QAUA 1FMGA 2BOHB 4FUIA 3SV9A 2FTLE 3DA9B 4FUEA 1EPTB 2KG2A 2VJ1A 2BD5A 1OOKB 1MCTA 3SU2A 2VIWA 1MQ5A 3UNRA 5C5OA 3SUDA 1O3NA 2RCEA 4JZEH 5HETA 2VSPA 4TPIZ 4U2WA 2VWLA 4E3BA 3SJ9A 2W7SA 5B6LA 2BZAA 2EI8A 2P8OC 2FIRH 4CRBA 4BAQB 4K69A 2KAIA 1GI9B 4LZ4B 1AD8H 4H6SB 4NA8A 4AGJA 3SBKA 4LXBH 1C1WH 5JBTA 3BN9A 2E7KA 1A0LA 3CC0A 1MD7A 3VXEH 6GCHG 2VGCB 1NRSH 2ZC9H 2JXOA 1O39A 3PMAB 1GMCF 4FUDA 2FPZA 1KLJH 2NU0E 1SGDE 3KZDA 1FLEE 1KTTB 1NS3A 2F83A 2G8TA 2QIQA 5DGJA 3TNTA 3NFLA 5C67A 2OMJA 1QRZA 2GT7A 5F67A 1C5UA 1GBKA 2BD7A 3RXAA 1AU8A 3ID3A 5HEBA 1Q7XA 2YT8A 2R3YA 1G9IE 4B2BA 1IQFA 1HAOH 2AMDA 1PPZA 2VINA 4AOQA 9ESTA 2CJIA 4NMSA 3TJUA 1L4DA 4GCHF 3L3TA 2BVSH 1LQDB 1ABIH 1TRYA 1GVZA 5A0AE 4NIWA 4FGMA 2AGGX 1Y5BT 3TNSA 3S9AA 2F91A 3LGYA 4WMDA 4YESB 3ZZ7A 1DY8A 1O3KA 3BEFB 3GY3A 1O5FH 1K1MA 1GBTA 2ODPA 5E0HA 3R69A 1WV7H 2XNIA 2A7CA 5PTPA 1ETSH 1DUEA 2AERH 1GVKB 2BXTH 2AH4X 2KAIB 1P3CA 2EGKA 4NSYA 1P2OA 1FQ3A 1S81A 3HKJB 1ELGA 1INCA 4Y76A 3Q00A 2ZEBA 1HJAB 3QZRA 5IYTA 3SGBE 1WOFA 1HJ9A 5FCRA 2BOKA 2OBQA 2Y5HA 2Z9LA 4JZ1A 2V3OH 2BVXH 2O8TA 3GY7A 1OZIA 1WUNH 1XUFA 3TGKE 2Z9KA 1LPZB 1WU1A 2ZO3H 3STJA 2M0ZA 3HKIB 2VWOA 1C5LH 2ZI2H 5F8XA 1MTSA 3SI4H 1UTOA 4XFQA 2WYJA 4Q6SA 2XBVA 3TK5A 1X5QA 3FVFB 2CHAC 2QYIA 2FOGA 1HXFH 4HOPB 3E16B 1GI1A 2OQUA 2DM8A 2PSXA 2TGDA 4ISIH 1O3JA 3VGCC 4O9VA 4I7YH 1NRRH 4TWYA 1KY9A 4DCDA 5DP3A 1OWHA 5DP6A 2EXGA 5EXNA 1O0DH 3I78A 3NXPA 3H7TA 2XRCA 3QK1A 1HLTH 2ULLA 3W95A 1MKWH 1N6DA 5CE1A 5EQQA 3HPMA 1RS0A 4OS1A 1GHAF 1RTLA 2A7HA 3S7KB 1XUGA 3SV6A 4LMMA 5JYIA 1O2ZA 2P3UB 1TALA 3FP6E 1SHHB 1WTHD 2VH6A 3TH2H 1V6DA 1S83A 1VR1H 4JYVH 5FPTA 3O5NA 1SFQB 2TPIZ 1X5RA 1O5GH 1SR5C 1U3BA 1ORFA 2H5DA 1CHGA 3AAVA 1RD3B 4K8YA 2EEIA 2C8WB 3KCGH 1WFGA 1P9UA 1NRPH 3SGQE 2C3SA 3UNSA 3KHFA 1Q3PA 1SGPE 5FPSA 1UM1A 5HFBA 1Y7NA 2J95A 3BF6H 3M7UA 3RXFA 1EUFA 1SGNE 1ZTKA 2O8MA 2ZU3A 1XZ9A 1GG6C 3TGJE 1Z6JH 1B8QA 4NGAH 4O3TA 1B5GH 1HAGE 3T62A 1DX5M 1QCPA 1O37A 1GI4A 2BB4A 1RIWC 1UJDA 2F3CE 2Y80A 1C5RA 3RXHA 2CF8H 2ZQ2A 5A8ZA 1ELCA 1MUEB 1LMWB 1O2QA 2IWOA 3O8BA 1MBQA 2BLVA 1SOTA 1EASA 4ZHLU 2FOFA 3VB7A 2C8XB 2Y82A 1LCYA 2STBE 1XXFA 1C4Y2 1AMHA 2VIPA 1J8AA 3VB4A 5HMAA 1GHYH 1GBFA 4OS2A 1V2RT 3PO1C 1GVLA 1HGTH 2W4FA 2ZHQH 1P2QA 4F4OC 2WPIS 2SNWA 2P3TB 2H6MA 4AMHA 5F3XA 1CT2E 3VB5A 3U1JB 4AORA 3BTKE 6CHAB 2FOCA 2GZ8A 4K6YA 1IQIA 3GGEA 1GHWH 2PKTA 1CHOG 3MTYA 1F92A 3I4WA 1FJSA 3Q76A 7ESTE 2F9OA 4XBCA 2YUBA 3CBYA 1GHBF 1VB7A 4O97A 1DSTA 3Q3YA 5E2PA 3ZZ9A 4NNLA 2H2ZA 3AVZA 1DXPA 1PJPA 1BBRK 1QQUA 4FUHA 1AVXA 3DORA 4K72A 1F5LA 2F9VA 1W10U 5FHTA 2V1WA 2Z6BD 1KXBA 2C4FH 5DPAA 1AY6H 2FOHA 3ZZ5A 3K82A 4NMTA 2AMPA 3QGLA 2AMQA 2OQ5A 2QKTA 4FUGA 1HCGA 1XUIA 2QXJA 4A92A 3FZDA 5DG6A 1IQKA 3V13A 5B6OA 4Z33A 4I33A 2OINA 1ETTH 3ZZ3A 1O2HA 3KN2A 4WMFA 3EGGC 3PWBA 1A46H 4H11A 2NU3E 1U38A 2JH6D 1K28D 1SI5H 4B2CA 1SVPA 2UUYA 1D9IA 1CSOE 2ZCKP 3MU4A 2ZU1A 3FZZA 5BPEA 1JIMA 4Y11E 1CBWC 5ESBA 5G4BA 3S9BA 3SW2B 1YM0A 1KLTA 4X0WU 3TH3H 1WG6A 4MVNA 2KAWA 4YDPA 1P2IA 1UJ1A 3BTQE 3OU0A 4EDJA 1VJ9U 6GCHF 1ARBA 2V3HH 2KJKA 3MNCA 3RL8A 6LPRA 1BB0B 2BM2A 1GI2A 3MNBA 1E35B 1EOJA 1JMOH 1P2MA 3UOUA 4K5ZA 1X6DA 1G3EA 2R0KA 5E11A 3E90B 1D6WA 2ZGHA 3AAUA 1RGRA 2L4TA 1KXAA 1SLUB 5EODA 1AUJA 1HAPH 3K1RA 1O35A 1ANEA 2PGBB 3LGVA 1V2OT 3SHWA 1FXYA 2H1UA 1K22H 1O3PB 3QN7A 1BRUP 2W7UA 3MNSA 2YUYA 4IC5A 4X1QU 1GJ5H 3ESTA 3ITIA 3RXPA 1ZTLA 3D49H 2OGPA 5L30H 2QGRA 4MQAA 3EYDA 1C2DA 1TMBH 2A4QA 3LT3A 5DP9A 5GLJA 2C93B 3NK8A 1DXWA 3QO6A 3O8CA 4DW2U 1MH0A 2PW8H 4RSPA 1UHBA 1ZLRA 3EQ0H 1K1NA 3N7OA 2JWEA 1P8VC 1WQSA 1S85A 1C4U2 2R2WU 1L2EA 4GSOA 3SV2H 2M5TA 4Q6HA 4CREA 5F8ZA 3UNQA 1YCPH 3SHCH 2O8WA 4P0CA 2EI7A 5A8XA 4MLFB 5E6PB 3QLPH 2Y6TA 1V1TA 3IG6B 4B76A 2G52A 5LH8A 1GCTB 5EPNA 2GZVA 3PDVA 1DWCH 3ZRTA 1IQNA 1MKWK 3LOXA 2O2TA 4FXGH 1XKBC 5T6FA 3S7HB 4RKJB 1UTJA 4WH6A 2ODQA 3E0NB 1V6BA 1N7EA 4CRAA 1P04A 3F9FA 2Z94A 3I29A 4B2AA 3RLEA 3RUOA 3ZVCA 2VSVA 1LKBA 2Q6DA 1SGCA 1LDTT 1AI8H 1LVMA 2O8LA 3NPSA 2LUIA 3W94A 1GMCG 4CBOA 3TU7H 2B7DH 1GBMA 2Z17A 1AN1E 3ZZ6A 2RDLA 8GCHF 2EGOA 1TA6A 1DWEH 1SLWB 2GVFA 2DE8A 1O2VA 2ZFTA 1YGCH 2Q9VA 3GCNA 1FY4A 4ZH8A 4VGCC 4ISHH 4HZHA 1Z8GA 2R3UA 4KFWA 2A4RA 1H9HE 3FP7E 1SHYA 1GJAB 4GCHG 5C1YA 2C8YB 5CHAB 1YKTA 2BYAX 1KXFA 2Z3EA 2GV6A 3DT0H 3QGNB 1K1PA 4D8NA 5I7ZA 4FUCA 3A85A 1EZXC 2BZ6H 2BQ6B 2BDBA 1ESBA 4IBLH 3UQOA 2WINI 3G01A 1TYNA 3GOVB 2PWXA 2RA0A 4Y8ZA 4NIYA 5K0HA 4GVCA 1IHJA 3RXOA 5E0GA 2BXUH 1V2NT 2PGQB 4D7GA 1F0SA 1MTNC 2ZHDA 3QDZB 3MO6A 4CRFA 1C5NH 2ILNA 1LO6A 1GJ9B 2BLOA 2ZCHP 1KXEA 1OBZA 2BY7X 3PMHB 4WF8A 4UFFH 3A84A 2AGIX 4AYYB 2DKRA 2REYA 1MCVA 1KLIH 2A4GA 5EQSA 1TMUH 1AE8H 5DO4H 1EKBB 3MO3A 2PNTA 1C1SA 4UDWH 4CR5A 5HXFA 5AVDA 3L33A 1GMDF 5E22A 2FOAA 1RGQA 3PWCA 4ZROA 5A09A 1ZHMA 4GHQA 1N7FA 1FY8E 3MO9A 2BDHA 1DLKB 1U39A 1F5KU 4CBNA 1AZ8A 1WQVH 2ZDLA 1T31A 2BDGA 3A8DA 3QIKA 4ISOA 4O3UA 1GHVH 1DANH 1D5GA 1Y59T 5F03A 3BG8A 4CHAC 4AFQA 2K20A 2I1NA 3SJ8A 1CHOF 1TNKA 3GCHC 1DDJA 3SORA 1ELAA 2ZFPH 4H6TA 4NG9H 1C5WB 1QY6A 1T4VH 2ALPA 3RLWH 2FZZA 1XUKA 3TJNA 4WYUA 3SNAA 3RC4A 5FBEA 4Q2NA 3KEEA 5EZ0A 2I4SA 4KELA 2FM2A 8KME2 2GCTB 1LVOA 1MZDA 2FX6A 3FAOA 4DG4A 4Y0YE 2EDZA 1DT2A 3ATLA 4XE4A 4B74A 1FY5A 2I6VA 1CT0E 1TNGA 1IOEA 1B7XB 1OBXA 3BV9B 2PUQH 1W9EA 3RC6A 5EGMA 3P92A 4F49A 3V3MA 9LPRA 1BRBE 2BTCE 4Q2PA 5GCHF 3VXFH 2EV8A 5EG4A 5DP7A 3RXUA 1HB0B 4X2WA 4NWLA 2FYRA 2FE5A 4OAJA 4D76A 3UQVA 1Y3UA 5FB8C 4JK5A 4DY7B 1TABE 1AQ7A 4IS5A 4M7GA 2BD4A 2ZHEH 4DIIH 1ELTA 5HF1A 1FI8A 3HATH 5C2ZA 2ZPMA 3A8BA 1QR3E 1VITH 1NFUA 1WF7A 2ZTZA 3KQBA 2A45B 1MC7A 1W7GH 1FNIA 1ANCA 4FU7A 4IW4E 3T26A 3PM3A 2SGAA 2VIDA 1JIRA 1FAXA 2G5MB 1D3TB 3ZZAA 4LZ1H 4XSKU 3LU9B 1ZYOA 1G30B 5GXPA 1O3OA 3P8GA 1WH1A 1TNIA 1AO5A 2Z7FE 3AW1A 2WPLS 1PYTD 1QA0A 2WYGA 4WWYA 3KQCA 3DFLA 5DP5A 4WXIA 3SU1A 3FP8E 1E37B 1TBQH 2A7JA 1MTVA 3CS0A 2FMJA 2GMTC 4ABHA 2Q6GA 2HVXA 4Q7YA 3RXJA 1GHBG 1F7ZA 1O2GH 2ZPRA 4NIVA 1DWDH 2ASUB 1PQ5A 1ELBA 5EYZA 1J9CH 3AASA 4K2YA 1O5BB 2C8ZB 2HRVA 4K1EA 3B23B 1O2OA 3P70B 2EA3A 1V2PT 1HAYB 5HJ1A 1O36A 1SGQE 1K1IA 3FY5A 1EPTC 2J94A 2V6NA 3RLYH 2XWBI 1QBNA 1W0ZU 4Y7BA 5A0CA 1V2MT 5I25A 4BXSA 1Z7KA 1TNHA 3SQEE 1MAYA 1O2UA 5LGOA 2M3MA 1VJAU 1BBRH 1UK4A 4X6OA 3CP7A 2B9LA 3DJ1A 1IHSH 3VB3A 5IDKA 1P1DA 4HTCH 1BOQA 1ESAA 1AWFH 2L97A 1GI7B 3VQFA 1C5YB 2QCYA 2A4OA 5T3HA 3ATIA 3SHAH 1ANBA 2ZDVH 2EEJA 1O33A 1C5VA 1BZXE 4MPWA 1JRSA 1A4WH 4ZXXH 2VGCC 3RXMA 4GPGA 1AE5A 4NIXA 5L2ZH 4KTUA 4SGBE 2HE4A 2OTVA 1BTYA 4YM9A 2GZ7A 3QUMP 1MD8A 1ID5H 2HE2A 2BLQA 1V2WT 2A32A 3RXRA 1AZZA 1C1PA 4OEPA 2FESH 2VIVA 3A82A 4X1RU 3RU4D 1K32A 4Q80A 1OYTH 2VIOA 2BY9X 4JCNA 4AG2A 1X8SA 1X45A 2Z9JA 2BD3A 5A2PA 1H4WA 1CT4E 4HOPA 5A2MH 1NU9A 2QF3A 2XBYA 1EAXA 1ZUBA 1EX3A 3MH6A 1GBAA 3TPIZ 4OGXA 1KDQA 3D65E 5TCCA 4HFPB 2FWWA 1K1JA 4BANB 3BG4B 4MTBA 4YT7H 1THSH 3BTEE 1C2JA 1JWTA 5AFZH 4U30A 3ODDA 3T27A 2DLUA 3PB1E 1YPJH 1O34A 1QJ1B 4Y71A 4DIHH 1XM1A 1QL7A 1BMAA 2KJPA 3UTUH 2BDAA 1MTWA 1T7CA 2BY6X 4NFFA 2C90B 2QF0A 1BRAA 3RXSA 4I8HA 1AVGH 2HWLB 1AHTH 4QT8C 1QTFA 3A80A 1HJAC 3M7TA 2D1JA 4TY7A 3GSLA 1NFYA 1EZQA 1NZQH 3WY8A 4AYVB 3RXDA 1JXPA 1W11U 3F68H 1GHZA 4AZ2B 2FTMA 2HPQH 1FIZA 4NMRA 1CVWH 2VVUA 4A1TA 4DJZB 4Y8XA 3T2NA 1DPOA 1A3EH 1P06A 3KHVA 1WTGH 3MH4A 1THRH 1TRMA 1ZHRA 1FONA 1TWXB 2A0QB 4YZUA 3LONA 3SJIA 1LHFH 5C5NA 1IAUA 4JK6A 2HGAA 3SU0A 3SU3A 4AX9H 1NT1A 4X2XA 2OUAA 2Y5GA 5HYOA 3LGUA 5AHGH 2JOAA 3RMLH 4MNVA 1BJVA 4UEHH 2HALA 3RU4E 3UREA 1KDQB 3E0PB 2Z9GA 1NU7B 3B76A 4Y8YA 3MOCA 2ALVA 1FZZA 1XMNB 1ZHPA 2W3IA 4GVUA 4MNWA 2G4UA 4FU8A 2D8IA 3UWJH 2UUJB 1FAKH 1AFQB 8GCHG 2H2CA 1OWEA 2JILA 2MHOA 1FN8A 2AWXA 3R68A 1S0QA 4NZLA 1SOZA 1KIGH 5JPMH 2ZP0H 3QE1A 4Q2KA 3F9GA 1A5GH 2AIPA 2K1QA 3PROA 4NWKA 3SJOA 1FIWA 2ZKSA 5CMXH 2Z9IA 3I1EA 1HUTH 2KPKA 4GLYA 3MWIU 1UEQA 1PQ8A 1OXGA 4CH2B 4ZXYH 2M0TA 1K2I1 2ZNKH 1Y5UT 1MKXH 4YLUA 1V2UT 4IMZA 1W14U 2EEGA 1ELVA 1ZOMA 4CRCA 2X7ZA 3VQGA 2D2DA 2GT8A 3MH7A 3PLKA 1O5EH 1O3IA 3A83A 2BYGA 3SUGA 1AKSA 3NGHA 1A5HA 1SB1H 3LGWA 2DLSA 2CN0H 3PTBA 4NFEA 4FVDA 1T8OA 3ZZ8A 1ZPBA 3M37A 2VIQA 1QURH 1YPMH 1W13U 3HK3B 1FDPA 4Y6DA 3SNCA 2JREA 4WYTA 4ZKRU 2FOBA 1RY4A 1Z87A 3LGTA 3BTME 1GMDG 1EAUA 2OBOA 4X6PA 1TB6H 1VCQA 3OSYA 1BCUH 1TX6A 1GCDA 6CHAC 1TGSZ 1UFXA 3M36A 1D6RA 5TCAA 3EGKH 1C2LA 1YYY1 1NM6A 2BY8X 2IOTA 1QRWA 3GY5A 5HFFA 2OCSA 4AFSA 2F9NA 3LKWA 1SGFA 4Q2QA 2AS9A 2KL1A 4JOPA 2H9TH 4I8GA 1TMTH 2VU8E 3F9EA 1Z6EA 1ARCA 1S84A 3S0NA 3PS4A 1WI4A 2KOHA 1OS8A 2I04A 3ZVDA 2OC0A 2FDAA 2F9UA 2VNTA 2Y7ZA 1UTKA 4BTTB 2H5CA 1BTPA 2IWPA 2QBWA 2J38A 1LVYA 1AKSB 3MNXA 2BQ7B 4RI0A 1BTUA 1GMHG 1O3BA 4Q7XA 1HAHH 4TYDA 2TGAA 5DJ7A 3OTJE 1GHXH 3LNXA 5JBCS 1FV9A 1NN6A 4PQWA 3M35A 3BTGE 1AB9B 1TRNA 1SQOA 3RMOH 1UEWA 2LC7A 4NMQA 1E38B 1P1EA 2OP9A 4BAOB 2ZPQA 1KYNA 1K9OE 5GCHG 1ZSJA 1P9SA 1QB6A 1CGIE 2I0IA 4IN2A 2XCFA 2LOBA 4ZUHA 3GDSA 1Y3XA 3PYHA 3MFJA 1RTKA 3UUZA 2P95A 1OPHB 3CS7A 2P16A 1F0UA 4A6LA 5G1EA 4ABIA 1P03A 1SSXA 3FANA 2DJTA 4GAWA 4E06H 3ATMA 5EQRA 1TGNA 3KQEA 2PKAA 5A8YA 2M10A 1QB9A 3BSQA 2EEHA 2BY5X 3VPKA 1SLXB 1L1NA 1LPKB 3BEIB 3MU5A 1O3FA 1ZPCA 2VVCA 2SGDE 3T5FH 3BIUH 3LNYA 3DHKH 3R0FA 4JOFA 1Z86A 3P8NA 1O2RA 1TLDA 4NXRA 1XXDA 4TWWA 3A8AA 2OC8A 4AFUA 2G00A 2KV8A 2G51A 2A2QH 3DD2H 1P02A 1UTQA 4FU9A 1C1RA 4ISLA 3ZVBA 3R3GB 2D8WA 3ID1A 4INKA 1NF3C 5LPEA 3PMBB 3OYPA 3RXIA 1N6XA 2TGTA 2ZDMA 2PZDA 3BTWE 1N8OB 4UONA 1Z1JA 2PKSB 1EOLA 3GICB 3KF2A 1ZSKA 4NZQA 4NMVA 3MMGA 1FY3A 2H9HA 1NY22 2B5TB 1Z8IB 7KMEH 3ZV9A 3RXEA 1HV7A 4ZKSU 2VWRA 4Z6AH 1AWHB 3EGHC 1C9TA 1DWBH 1O3MA 1VGCB 3SFJA 2FLRH 1GPZA 3DJAA 2EDVA 3IWMA 2OC7A 3P8OA 4ZHAA 1ELDE 3GYLB 5F6MA 3K2UA 1YC0A 4AGKA 4E05H 1M5ZA 1H8DH 4U32A 2W3KA 1IQMA 2PKAB 2QXGA 3K6YA 3V7TA 2Y7XA 1C2GA 1S6FA 1THPB 2FS8A 1GCTC 3P6ZB 1W3CA 1NO9H 1FPHH 5EOKA 3E91A 4K1SA 2AWWA 2SGQE 5EXLA 4D9RA 3QJMA 1DICA 1TQ7B 1QA7A 4OS6A 4NXQA 1PPFE 1O3EA 2WV5A 1M9UA 1F5RA 3A7WA 3UFAA 4Y7AA 2FYQA 1GJBB 5LPFA 4CR9A 1YCPM 2L4SA 2WUCA 2R0LA 4DOQA 1HXEH 1H9LB 2NU1E 2P3WA 4JOHA 1QQ4A 3E1XB 1H1BA 2SFAA 4YOIA 1BHXF 1LHGH 1P2KA 2BDCA 1UK2A 2AFQB 4ISNA 5HM9A 1DM4B 3K50A 1P09A 4GHTA 4WY3A 2XXLA 1Y8TA 2JH5D 1GI5A 1SGFG 5A0BA 1VZQH 1MKXK 1TP3A 1C1NA 1WHAA 2ZQ1A 3NWUA 2VVVA 2R2MB 3SUEA 1TNJA 2ESTE 4UU5A 3V12A 1BITA 3Q77A 1DOJA 5FXLA 1V2ST 1BT7A 4IC6A 5CHAC 3SN8A 1G37A 2M0UA 1W0YH 1XVMA 1WYKA 3GJ9A 2EJYA 3ID4A 1SLVB 1HJ8A 3P95A 4IMQA 4BNRA 1LKAA 1LPGB 1YF4A 5HEYA 2J9NA 1T2MA 1P01A 1VITG 3PDZA 3I18A 1T32A 1OBYA 4ABBA 4JOJA 4BTIB 1GL0E 4K8BA 2CGAA 3T29A 1YPEH 1CO7E 3SJKA 4E35A 1MQ6A 1O2KA 1OP8A 2ZHWH 2NWNA 3TMHA 1ZRKA 1HAZB 2FS9A 2IPHA 2OC1A 2A2XH 3GDUA 2RRMA 1VCWA 4N6XA 2LNCA 1PPHE 1ZZZA 1C5XB 4GHNA 2HNTF 1AUTC 3QZQA 5HFCA 4B1TA 3TH4H 2FI3E 3BTTE 1GJ6A 2PTCE 1A0JA 4R8TB 1NTEA 2A1DB 3RXLA 2ZFFH 3LJOA 2CSSA 4MPXA 2WPJS 1G3BA 1D4PB 1YLDA 2VH0A 3VFEA 2DAZA 5E8EH 3UR6A 1HAIH 1F0RA 2OLGA 1KSNA 1HFDA 1ETRH 2I6SA 2G5VA 1MBMA 4MG3A 4U01A 1G36A 1V2TT 4ABFA 3M61U 2RG3A 4INHA 2Q6FA 2ZZUH 1UMAH 4KTCA 1A61H 5C3NA 2VWMA 2CSJA 5HFDA 2ZU2A 3U8TH 5K7RA 2EAQA 2RA3A 2ZFSA 2GCTC 2W7RA 1GI3A 1PPBH 4H4FA 5FX6A 1T4UH 2P59A 2TIOA 3MI4A 2GTBA 5TJXA 4AFZA 1MU6B 1YBOA 2CF9H 3ZV8A 4ASHA 5T6DA 1ESTA 1WF8A 1GMHF 2ZDNA 1NRNH 1V3XA 4BAMB 2FCFA 3RMNH 3NUMA 1WSSH 1C2MA 1TPOA 3BTHE 1BTWA 1TIOA 2YT7A 5C1XA 3WKMA 4UE7H 2BDYA 1Y3WA 4LOYH 1UTLM 4X6MA 2JETB 4KTSA 4OEOA 3R0HA 2ZDAH 1O2JA 4OS4A 3V0XA 3A89A 2H9EH 3KL6A 1DLEA 4JORA 2TBSA 1C5SA 2BD8A 5AF9H 2KOJA 1Q3XA 3UY9A 1I16A 4CRDA 4NA7A 2JIKA 3ZZBA 4K76A 1O2WA 1QGFA 3U98H 1HIAA 1O5CB 1EJAA 1NFWA 4NA9H 2H2BA 2H3MA 1G32B 3KGPA 3GYMA 5HF4A 3TVJB 2LC6A 2UWLA 1FCFA 1C5ZB 1ZSLA 1DVAH 1P2JA 1TPAE 2ANYA 1MAXA 2YNAA 1EB2A 1BQYA 2WPHS 3ZVAA 7LPRA 2LPRA 4X1SU 2F0AA 4DVAU 4TPYA 1GI0A 3QDOA 2PUXB 4XDEA 2A5IA 4YTAA 3SU5A 2FP7B 1VCPA 1GJ8B 1UVTH 4NMPA 1O2NA 1D3QB 2PR3A 2VRFA 1GJ4H 3F9HA 4B71A 3U69H 1FC9A 4D7FA 1GGDB 1I92A 3HGNA 4WMEA 4DURA 5HGGA 1FUJA 2WPMS 3RL7A 5GJ4B 1T8LA 3UOPA 3GCOA 2Y5FA 1UVSH 4KP0A 4MPUA 3QGJA 2JKHA 4JZDH 1XVOA 1NTPA 4NSVA 3SI3H 1PPEE 1IQEA 1IQGA 3BIVH 1UTPA 1GQ4A 3QJNA 2PHBA 1ZPZA 2F5YA 1G3CA 2CXVA 5J4SA 2UUKB 2A5AA 1HIAB 1YPKH 4A5TS 2O8UA 3F6UH 4XOJA 2OCVB 1XUHA 2GD4B 3M5MA 1A7SA 2V90A 1ACBE 1IHTH 1J14A 1O3GA 4Z0KA 4NCYA 2EC9H 3HGPA 2QT5A 4B73A 2D90A 1T8NA 4ZKNU 1O3LA 1Z8JB 1UJVA 3TSZA 5ETXA 1K1LA 2FO9A 3B8JA 4X2VA 1UK3A 1O3HA 1TONA 3ZVFA 3O46A 1P3EA 3D23A 1A1RA 3M5OA 5JB9S 2G81E 1SQAA 2W26A 1BHXB 2RCZA 3A87A 4THNH 1SPJA 1QRXA 1L6OA 2IWQA 1O2PA 3LC5A 5JXBA 4TY6A 1B0EA 1C2FA 2P8OB 2QY0B 2PKUA 3UWIA 2M0VA 4YOJA 1IU2A 4KGAA 1EZSC 4I32A 2PLXA 3OY5U 2LA8A 4Q7ZA 1K21H 4J2YB 1ZGVA 1G3DA 1Y3YA 4I31A 3LC3A 1QIXB 3TK6A 2HGTH 4A7IB 4BOHA 4K3JA 2AYWA 3BG4C 1ZOKA 2XBXA 8LPRA 3RXKA 2Q3GA 1OWIA 1R6JA 2P93A 4I8KA 1E36B 3EDXB 4OS7A 1HNEE 3GDVA 4RN6A 5JBBS 4IN1A 1L0ZA 4B75A 2OXSA 1C1TA 2BX3A 1IQHA 1WJLA 1VITF 3RDZA 4IGDA 2FLBH 2STAE 3GCTG 1ABJH 3WKLA 1O30A 4RKOB 2FEQH 1QL8A 1QNJA 2XTTB 1Q31A 4F8KA 2AINA 1GBBA 3P8FA 1H8IH 3SO3A 8ESTE 5EW2H 1TX7A 2B8OH 2BMGB 1YPHC 3M5NA 3OY6U 1EAIA 1UO6A 2AGEX 2OD3B 2QG1A 2HNTC 1DY9A 2OPGA 4JOGA 4X8SH 3TK9A 1O31A 4AG1A 1BTZA 1VJ6A 2J4IA 3C27B 1BUIA 4UD9H 2YTWA 3ZYEA 1N7TA 2FI4E 4GVDA 4NXPA 2WPKS 1QAVA 1ZMJA 5EXMA 5GNDA 1V2VT 4FVBA 3KNXA 1ZMNA 3URCA 2D26C 1C1MA 1S5SA 1LHDH 4XBBA 1C5MD 1MU8B 3K9XB 2QKUA 1KWAA 1C9PA 1GJCB 1FC6A 4Y0ZE 3STIA 4L8NA 4G69A
chains in the Genus database with same CATH superfamily
1C1QA 1S82A 2JH0D 1TP5A 3M7QA 3I77A 2P94A 3E8LA 4Y79A 1QJ6B 5E2OA 1AFQC 1BA8B 1GDUA 1PDRA 4WXVA 1O2LA 3RXTA 4UFGH 1P2NA 3F2HA 5DP4A 2A31A 1P0SH 3HK6B 1EZUC 1SBWA 2HLCA 3M3VA 1PFXC 3LH1A 3PV5A 1O2XA 1TOMH 1Z71A 2GDDA 4I8LA 2CHAB 2ZIQH 4OS5A 1EP5A 3VGCB 1HRTH 2W5EA 1S6HA 4CRGA 4DT7B 3MYWA 5D13A 3RM0H 2JJ1D 1O32A 2F9PA 1TFXA 1GBDA 3DIWA 3TSVA 2HPPH 1F2SE 5FBIA 1QZ8A 3OAAD 3AXAA 2R9PA 2O9QA 1UCYK 1RRKA 1AGJA 2FI5E 3HPKA 1QAVB 4A1VA 1V5QA 1C2HA 1YPLH 3MU8A 3SQHE 5EPYA 2PFEA 2ENOA 1GWAA 3MH5A 5L2YH 3RC5A 1G9OA 1W9QA 3U1IB 1BMMH 2ANMH 1Q2WA 1CE5A 1L1GA 1L4ZA 4R0IA 1WBGB 2QC2A 4JZIA 1AIXH 2BX4A 4K60A 2FNEA 2KOMA 3QTVH 2ZFRH 2YOLA 1VA8A 2ZA5A 4DGJA 1QL9A 4K75A 1KXCA 1SL3A 4ESTE 7GCHG 4FUBA 3RXBA 2Y81A 1QJ7B 5FPYA 2ZGCA 1OWKA 4X8VH 1RTFB 6ESTA 1BMLA 1GG6B 3TJOA 1UTMA 2P3FH 4H42U 5KGOA 4HGCA 1TGBA 1UVUH 4F55A 3TGIE 2GP9B 5HKKD 2ZPLA 1D3PB 1RIWB 4O03A 1G2LA 5HDYA 2FODA 1QFKH 1OX1A 1KEFA 1GJ7B 1C2IA 1YLNA 1GJDB 2ZDKA 2IN2A 4K1TA 1SQTA 2R4HA 4D9QA 4K78A 2GV7A 3JZ2B 3ODFA 1JBUH 2QXHA 3BEUA 3A7YA 4LK4A 2UZCA 4MPAA 1P05A 4NNMA 1OSSA 1A5IA 3PO1B 1C1UH 4Q2OA 3IITA 1OP0A 3KIDU 4X1NU 1C5TA 1SGTA 2K1ZA 1C5QA 4E7RG 3HPTB 5EJZA 2OS6A 2BVRH 1SMFE 2VWNA 2DB5A 1E0FD 2UWOA 4XHVA 2TGPZ 3F1SB 2DE9A 2KYLA 1YPHE 3N7EA 4BXWA 2Z3DA 1CA0C 1V2LT 3NCLA 1GI6A 1TPPA 2HNTE 1AB9C 1CA0B 2GCHF 2AEIH 1BJUA 4MNYA 3NFKA 1IQLA 2AIQA 4X8UH 2V7QD 1E34B 4Q3HA 2ZGJA 3AW0A 3LIWA 1HYLA 4FLNA 2XWAA 4ABJA 1MTUA 2BHGA 2V35A 3RXCA 1WHDA 2PP6A 4Z8JA 3SU4A 1AVWA 3VEQB 4E7NA 1UM7A 1V5LA 1CQQA 1TOCB 2NU4E 4Q4LA 4BAHB 1P12E 4P2AB 4A1XA 1TQ3A 2ZFQH 5F8TA 1RFNA 3E17A 1C2KA 3EA9A 1JRTA 1SG8B 1XUJA 3SOSA 1ZRBA 2ZU5A 2VPHA 5DK1A 1ZMLA 3GY6A 4ZMAH 2UWPA 2LELA 3ZZCA 1GBCA 2I0LA 3BPUA 2BQWB 4OGYA 2SNVA 1ZTJA 1LVBA 2EHRA 3ENSB 4ABEA 3ZVGA 2GDEH 1TA2A 3A8CA 2J92A 3SZNA 3A7XA 3ELAH 3UR9A 3MU1A 2PV9B 4ZKOU 2KJDA 3NKKA 1CBWB 2FOMB 1W2KH 1LHCH 1WAYB 1XX9A 3S9CA 3ZVEA 1C1OA 2ZU4A 3TLOA 1T8MA 2SGPE 2KRGA 5HFEA 2GKVE 2H3LA 3D62A 4HI3A 1UF1A 1N8OC 2FOEA 1CU1A 3RP2A 1U6QA 1ZJDA 2PKSC 1TBZH 1NC6A 3SNEA 3WWFA 1KXDA 2GEFA 1N6YA 3H09A 1A0HB 3LPRA 1OWJA 1C2EA 1C5PA 3C1KA 5FAHA 2TRMA 2XC5A 1DFPA 1J16A 4GUXA 3URDA 2JSNA 3GCTF 4ABAA 3EE0B 1VGCC 2PSYA 2WUBA 4REYA 2QV1A 1K1OA 2YNBA 4YYXA 2PDZA 1TNLA 4JYUH 4ABGA 2Q1JA 4ABDA 1V2KT 1MFLA 1RJXB 1ZR0A 5DSFA 5EW1H 2UUFB 3TITA 3EA8A 1EJMA 1WCZA 3CBZA 1MMJN 4INLA 1X7AC 2MX6A 4FUFA 3KYGA 1GBHA 3PLPA 4ZHMU 3ATWA 1GBJA 4YLQH 3ZZ4A 1DSUA 1TE0A 3DSPA 3B9FH 1HAXB 3K65B 3BTFE 4X2YA 2ZTXA 2JINA 1Z8RA 1V2JT 1Y5AT 1V2QT 1YLCA 1FPCH 1VAEA 2BD9A 2HOBA 3E3TA 5LPRA 2AWUA 1SGRE 2DC2A 2QKVA 1EFRD 3ATKA 1BDAA 3SNDA 3TJVA 2I6QA 3ZZDA 3DFJA 5FCKA 2ZGBH 1G2MA 1C5OH 5GDSH 1CA8B 3ID2A 1WFVA 2ANKH 4X6NA 5DKMA 1N1LA 2WZQA 4I8JA 3LDXH 2G55A 1UVPA 1W9OA 2EEKA 2D92A 2GZ9A 2KR7A 2BDIA 5DP8A 1UEZA 1GI8B 4CH8B 2PA1A 1O3DA 1HAVA 2GGVB 1YBWA 3Q3XA 2KPLA 1B0FA 4UFEH 3UIRA 3MHWU 2EGNA 4WVPE 3NZIA 3A7ZA 4YOGA 2XW9A 5T6GA 1UJUA 4JOKA 4PROA 2KA9A 5ABWA 2XC0A 1C1VH 1GM1A 3U8OH 1PQ7A 4Y10E 2KBSA 3LH3A 1UVOA 1J15A 5JDUB 1X5NA 2V0BA 4WJG2 5I46H 5FX5A 4AN7A 3JXTA 1EXFA 1EATA 3T28A 1GQ5A 1NRQH 2B0FA 4WH8A 3P17H 4YO9A 1W7XH 5JBAS 2QXIA 1TQ0B 3M5LA 1EQ9A 1UHBB 3H5CB 3GY2A 3ZIAD 4JZFH 5E1YA 4MNXA 4SGAE 4JOEA 2ZGXH 1TBRH 3TIUA 2CV3A 4VGCB 3RMMH 2KZ4A 1FC7A 5C20A 5G1DA 1UHPA 2J34A 3O8RA 3SUZA 2VZ5A 1UEPA 3SOEA 3QTOH 3TSWA 1LTOA 1NROH 1H8HD 3PTNA 3E6PH 1IU0A 1OP2A 3SNBA 4F48B 2ZWLH 1SFIA 1WIFA 1EB1H 2SGFE 2ZTYA 4BTUB 7GCHF 1CGJE 1ZJKA 1YPGH 3BTDE 1BIOA 4BAKB 5C0TA 5L6NH 3A7VA 1GBLA 2QAAA 1MZAA 3M3TA 1HAVB 1MTNB 1DE7H 1PQAA 3DJ3A 1QBOA 3OEED 1UCYE 1JOUB 1Q3OA 4R2ZA 1O2TA 1ELFA 1RGWA 1ELEE 3A81A 1BE9A 1UITA 3KQDA 3RM2H 1W8BH 4JMYA 1OWDA 2XYAA 3JZ1B 1BFEA 1O3CA 2CK3D 3ZYDA 2IWNA 2ZF0H 1O5AB 1GBEA 1TX8A 2FXRA 3LGIA 1BTXA 1O38A 3GISB 2OQSA 3OTPA 2YMSD 1FN6A 3DUXH 5IK2D 3H7OA 3SU6A 2F9BH 1XKAC 2G5NA 1O2MA 1GDQA 3RU4T 3CYYA 1Z1IA 3SV7A 4CHAB 1DS2E 5E0JA 5AFYH 1EAWA 1KTSB 2KM0A 5C94A 1YP9A 2FX4A 3GCHB 2ZG0H 2ZCLP 2OZFA 1HDTH 1HBTH 1A3BH 3L6PA 1N6EA 2PTNA 3O8DA 3PRBA 4XBDA 3UPEA 1LQEA 4KFVA 2XCNA 1U37A 1N6FA 1TAWA 1GHAG 4AB9A 1P57B 2JETC 1PYTC 1TPSA 4JYTA 1P11E 1Y3VA 1IQJA 1NESE 2SGEE 4FUJA 2ZPSA 4X8TH 4MPVA 5HM2A 3M3SA 1WXRA 3A88A 2ANWA 1EJNA 1HPGA 1RZXA 1WI2A 1GL1A 2VB0A 1A2CH 5EU8A 3SV8A 3T25A 1C4V2 1H9IE 1SGEE 1TGCA 3GY4A 5J4QA 1O2YA 5GWZA 5HEDA 3NCVA 2WL7A 1UCYH 3S69A 3MU0A 4YT6H 4AB8A 3L4FD 2ZECA 3PV2A 3FFGA 1QBVH 2OSGA 1GBIA 1SC8U 5BRRE 2EDPA 1W12U 1O3AA 5ILBA 1ANDA 2NU2E 1BBRE 1N99A 3PV4A 5JB8S 2XC4A 5DTHA 5GIBA 2KQFA 1AFEH 2ODYB 1O2SA 5GPIB 1TGTA 2QA9E 2Z3CA 1EPTA 1BRCE 3LJJA 3U9AH 5SGAE 1S0RA 3EA7A 5ESTE 1L1JA 1NPMA 4KKDA 1DUAA 1EP6A 3SUFA 4MDSA 3Q3KA 3U8RH 3CBXA 1D3DB 2FN5A 1GGDC 1P10A 1ZGIA 3EAJA 1GDNA 4ZAEA 1NFXA 3CENA 2KCAA 1LHEH 1UTNA 2BLWA 3K6ZA 1F0TA 3A86A 1CGHA 2EI6A 1RXPA 3VB6A 1PPCE 2DMZA 4J1YA 4UU6A 4X1PU 1OYQA 1O2IA 2CMYA 2QF5A 4NMOA 4O06A 1SGYE 2A5KA 2BD2A 2QN5T 4JL7A 5H4IB 1PPGE 3PMJA 3DSOA 2DUCA 3W1EA 3RXVA 3SGAE 3OX7U 4E34A 4ASUD 3RXGA 2G2LA 3QWCH 5H3JA 2ZHFH 5E21A 1YCPK 3PLBA 1O5DH 1BTHH 5C1UA 1BMNH 2IJOB 3RXQA 1QB1A 2G4TA 2GMTB 2GCHG 1QLCA 1J17T 2THFB 1FY1A 3KYFA 3CH8A 2XBWA 1W0JD 2F43B 3QX5H 2CS5A 3SHUA 2WV4A 4UFDH 1MFGA 1V62A 2J2UA 3KZEA 1OKXA 3HVQC 1DITH 1SGIB 2GX4A 1QHRB 3GY8A 3A7TA 1QAUA 1FMGA 2BOHB 4FUIA 3SV9A 2FTLE 3DA9B 4FUEA 1EPTB 2KG2A 2VJ1A 2BD5A 1OOKB 1MCTA 3SU2A 2VIWA 1MQ5A 3UNRA 5C5OA 3SUDA 1O3NA 2RCEA 4JZEH 5HETA 2VSPA 4TPIZ 4U2WA 2VWLA 4E3BA 3SJ9A 2W7SA 5B6LA 2BZAA 2EI8A 2P8OC 2FIRH 4CRBA 2KFWA 4BAQB 4K69A 2KAIA 1GI9B 4LZ4B 1AD8H 4H6SB 4NA8A 4AGJA 3SBKA 4LXBH 1C1WH 5JBTA 3BN9A 3CNRA 2E7KA 1A0LA 3CC0A 1MD7A 3F3BA 3VXEH 6GCHG 2VGCB 1KMHB 1NRSH 2ZC9H 2JXOA 1O39A 3PMAB 1GMCF 4FUDA 2FPZA 1KLJH 2NU0E 1SGDE 3KZDA 1FLEE 1KTTB 1NS3A 2F83A 2G8TA 2QIQA 5DGJA 3TNTA 3NFLA 5C67A 2OMJA 1QRZA 2GT7A 3PRDA 5F67A 1C5UA 1GBKA 2BD7A 3RXAA 1AU8A 3ID3A 5HEBA 1Q7XA 2YT8A 2R3YA 1G9IE 4B2BA 1IQFA 1HAOH 2AMDA 1PPZA 2VINA 1W0KD 4AOQA 9ESTA 2CJIA 4NMSA 3TJUA 1L4DA 4GCHF 3L3TA 2BVSH 1LQDB 1ABIH 1TRYA 3AK5A 1GVZA 5A0AE 4NIWA 4FGMA 2AGGX 1Y5BT 3TNSA 3S9AA 2F91A 3LGYA 4WMDA 4YESB 3ZZ7A 1DY8A 1O3KA 3BEFB 3GY3A 1O5FH 1K1MA 1GBTA 2ODPA 5E0HA 3R69A 1WV7H 2XNIA 2A7CA 5PTPA 1ETSH 1DUEA 2AERH 1GVKB 2BXTH 2AH4X 2KAIB 1P3CA 2EGKA 4NSYA 1P2OA 1FQ3A 1S81A 3HKJB 1ELGA 1INCA 4Y76A 5C17A 3Q00A 2ZEBA 1HJAB 3FOAA 3QZRA 5IYTA 3SGBE 1WOFA 1HJ9A 5FCRA 2BOKA 2OBQA 2Y5HA 2Z9LA 4JZ1A 2V3OH 2BVXH 2O8TA 3GY7A 1OZIA 1WUNH 1XUFA 3TGKE 2Z9KA 1LPZB 1WU1A 2ZO3H 4B6EA 3STJA 2M0ZA 2L74A 3HKIB 2VWOA 1C5LH 2ZI2H 5F8XA 1MTSA 3SI4H 1UTOA 4XFQA 2WYJA 4Q6SA 2XBVA 2XOKD 3TK5A 1X5QA 3FVFB 2CHAC 1COWD 2FOGA 1HXFH 4HOPB 2QYIA 2KCPA 3E16B 1GI1A 2OQUA 2DM8A 2PSXA 2TGDA 4ISIH 1O3JA 3VGCC 4O9VA 4I7YH 1NRRH 4TWYA 1KY9A 4DCDA 5DP3A 1OWHA 5DP6A 4XD7D 2EXGA 5EXNA 1O0DH 3I78A 3NXPA 3H7TA 2XRCA 3QK1A 1HLTH 2ULLA 3W95A 1MKWH 1N6DA 5CE1A 5EQQA 3HPMA 1RS0A 4OS1A 1GHAF 1RTLA 2A7HA 3S7KB 1XUGA 3SV6A 4LMMA 5JYIA 1O2ZA 2P3UB 1TALA 3FP6E 1SHHB 1WTHD 2VH6A 3TH2H 1V6DA 1S83A 1VR1H 4JYVH 5FPTA 3O5NA 1SFQB 2TPIZ 1X5RA 1O5GH 1SR5C 1U3BA 1ORFA 2H5DA 1CHGA 3NRLA 3AAVA 1RD3B 4K8YA 2EEIA 2C8WB 2QE7D 3KCGH 1WFGA 1P9UA 2EQNA 1NRPH 3SGQE 2C3SA 3UNSA 3KHFA 1Q3PA 1SGPE 5FPSA 1UM1A 5HFBA 1Y7NA 2J95A 3BF6H 3M7UA 3RXFA 1EUFA 1SGNE 1ZTKA 3F0OA 2O8MA 2ZU3A 1XZ9A 1GG6C 1NBME 3TGJE 1Z6JH 1B8QA 4NGAH 4O3TA 1B5GH 1HAGE 3T62A 1DX5M 1QCPA 1O37A 1GI4A 2BB4A 1RIWC 1UJDA 2F3CE 2Y80A 1C5RA 3RXHA 2CF8H 2ZQ2A 5A8ZA 1ELCA 1MUEB 1LMWB 1O2QA 2IWOA 3O8BA 1MBQA 2BLVA 1SOTA 1EASA 4ZHLU 3UB0A 2FOFA 3VB7A 2C8XB 2Y82A 1LCYA 2STBE 1XXFA 1C4Y2 1AMHA 2VIPA 5FL7D 1J8AA 3VB4A 5HMAA 1GHYH 1GBFA 4OS2A 1WDIA 1V2RT 3PO1C 1GVLA 1HGTH 2W4FA 2ZHQH 1P2QA 4F4OC 2WPIS 2SNWA 2P3TB 2H6MA 4AMHA 5F3XA 1CT2E 3VB5A 2J98A 3U1JB 4AORA 3BTKE 6CHAB 2FOCA 2WPDD 3N7DA 2GZ8A 4P02A 4K6YA 1IQIA 3GGEA 1GHWH 2PKTA 1CHOG 3MTYA 1F92A 3I4WA 1FJSA 2KCOA 3Q76A 7ESTE 2F9OA 4XBCA 2YUBA 3CBYA 1GHBF 1VB7A 4O97A 1DSTA 3Q3YA 5E2PA 3ZZ9A 4NNLA 2H2ZA 3AVZA 1DXPA 1PJPA 1BBRK 1QQUA 4FUHA 1AVXA 3DORA 4K72A 1F5LA 2F9VA 3GABA 1W10U 5FHTA 2V1WA 2Z6BD 1KXBA 2C4FH 5DPAA 1AY6H 2FOHA 3ZZ5A 3K82A 4NMTA 2AMPA 3QGLA 2AMQA 2OQ5A 2QKTA 4FUGA 1HCGA 1XUIA 2QXJA 4A92A 3FZDA 5DG6A 2XNDD 1IQKA 3V13A 5B6OA 4Z33A 4I33A 5EIYA 2OINA 1ETTH 3ZZ3A 1O2HA 3KN2A 4WMFA 3EGGC 3PWBA 1A46H 4H11A 2NU3E 1U38A 2JH6D 1K28D 1SI5H 4B2CA 1SVPA 2UUYA 1D9IA 1CSOE 2ZCKP 3MU4A 2ZU1A 3FZZA 5BPEA 1JIMA 4Y11E 1CBWC 5ESBA 5G4BA 1E1RD 3S9BA 3SW2B 3KQ5A 1YM0A 1KLTA 4X0WU 3TH3H 1WG6A 2J98B 5HIZA 4MVNA 2KAWA 4YDPA 1P2IA 1UJ1A 3BTQE 3OU0A 4EDJA 1VJ9U 6GCHF 1ARBA 2V3HH 2KJKA 3MNCA 3RL8A 6LPRA 1BB0B 2BM2A 1GI2A 3MNBA 1E35B 1EOJA 1JMOH 1P2MA 3UOUA 4K5ZA 1X6DA 1G3EA 2R0KA 5E11A 3E90B 1D6WA 2ZGHA 3AAUA 1RGRA 2L4TA 4FOUC 3EE7A 1KXAA 1SLUB 5EODA 1AUJA 1HAPH 3K1RA 1O35A 1ANEA 5DN6D 2PGBB 3LGVA 1V2OT 3SHWA 1FXYA 2H1UA 1K22H 1O3PB 4RT1A 3QN7A 1BRUP 2W7UA 3MNSA 2YUYA 4IC5A 4X1QU 1GJ5H 3ESTA 3ITIA 3VG8A 3RXPA 1ZTLA 3D49H 5KEDA 2OGPA 5L30H 2QGRA 4MQAA 3EYDA 1C2DA 1TMBH 2A4QA 3LT3A 5DP9A 5GLJA 2C93B 3NK8A 1DXWA 3QO6A 3O8CA 4DW2U 1MH0A 2PW8H 4RSPA 1UHBA 1ZLRA 3EQ0H 1K1NA 3N7OA 2JWEA 1P8VC 1WQSA 1S85A 1C4U2 2R2WU 1L2EA 1SQRA 2LP6A 4GSOA 3SV2H 2M5TA 4Q6HA 4CREA 5F8ZA 3UNQA 1YCPH 3SHCH 2O8WA 4P0CA 2EI7A 5A8XA 4MLFB 5E6PB 3QLPH 2Y6TA 1V1TA 3IG6B 4B76A 2G52A 5LH8A 1GCTB 5EPNA 2GZVA 3PDVA 1DWCH 3ZRTA 1IQNA 1MKWK 3LOXA 2O2TA 4FXGH 1XKBC 5T6FA 3S7HB 4RKJB 1UTJA 4WH6A 2ODQA 3E0NB 1V6BA 1N7EA 4CRAA 1P04A 3F9FA 2Z94A 3I29A 4B2AA 3RLEA 3RUOA 3ZVCA 2VSVA 1LKBA 2Q6DA 1SGCA 1LDTT 1AI8H 1X9ZA 1LVMA 2O8LA 3NPSA 2LUIA 3W94A 3OFND 1GMCG 4CBOA 3TU7H 2B7DH 1GBMA 2Z17A 1AN1E 3ZZ6A 2RDLA 8GCHF 2EGOA 1TA6A 1DWEH 1SLWB 2GVFA 2DE8A 1H8ED 1O2VA 2ZFTA 1YGCH 2Q9VA 3GCNA 1FY4A 4ZH8A 4VGCC 4ISHH 4HZHA 1Z8GA 2R3UA 1MABB 4KFWA 2A4RA 1H9HE 3FP7E 1SHYA 1GJAB 4GCHG 5C1YA 2C8YB 5CHAB 1YKTA 2BYAX 1KXFA 2Z3EA 2YMSB 2GV6A 3DT0H 3OEHD 3QGNB 1K1PA 4D8NA 5I7ZA 4FUCA 3A85A 1EZXC 2BZ6H 2BQ6B 2BDBA 1ESBA 4IBLH 3UQOA 2WINI 3G01A 1TYNA 3GOVB 2PWXA 2RA0A 4Y8ZA 4NIYA 5K0HA 4GVCA 1IHJA 3RXOA 5E0GA 2BXUH 1V2NT 2PGQB 4D7GA 1F0SA 1MTNC 2ZHDA 3QDZB 3MO6A 4CRFA 1C5NH 2ILNA 2EY4C 1LO6A 1GJ9B 2BLOA 2ZCHP 1KXEA 1OBZA 2BY7X 3PMHB 4WF8A 4UFFH 3A84A 2AGIX 4AYYB 2DKRA 2REYA 1MCVA 1KLIH 2A4GA 5EQSA 1TMUH 1AE8H 3SYJA 5DO4H 1EKBB 3MO3A 2PNTA 1C1SA 4UDWH 4CR5A 5HXFA 5AVDA 3L33A 1GMDF 5E22A 2FOAA 1RGQA 3PWCA 4ZROA 5A09A 1ZHMA 1OHHD 4GHQA 2J5UA 3U28C 1N7FA 1FY8E 3MO9A 2BDHA 1DLKB 1U39A 1F5KU 4CBNA 1AZ8A 1WQVH 2ZDLA 1T31A 2BDGA 3A8DA 3QIKA 4ISOA 4O3UA 1GHVH 1DANH 1D5GA 1Y59T 2M2AA 5F03A 3BG8A 5F53A 4CHAC 4AFQA 2K20A 2I1NA 3SJ8A 1CHOF 1TNKA 3GCHC 1DDJA 3SORA 1ELAA 2ZFPH 4H6TA 4NG9H 1C5WB 1QY6A 1T4VH 2ALPA 3RLWH 2FZZA 1BMFD 1XUKA 4WYUA 3TJNA 3SNAA 3RC4A 5FBEA 4Q2NA 2K8IA 3KEEA 5EZ0A 2I4SA 4KELA 2FM2A 8KME2 2GCTB 4I86A 1LVOA 1MZDA 2FX6A 3FAOA 4DG4A 4Y0YE 2EDZA 1DT2A 3ATLA 4XE4A 4RT0A 4B74A 1FY5A 2I6VA 1CT0E 1TNGA 1IOEA 4AC9A 1B7XB 1OBXA 3BV9B 2PUQH 1W9EA 3RC6A 5EGMA 3P92A 4F49A 3V3MA 9LPRA 1BRBE 2BTCE 4Q2PA 5GCHF 3VXFH 2EV8A 5EG4A 5DP7A 3RXUA 1HB0B 4X2WA 4NWLA 2FYRA 2FE5A 4OAJA 4D76A 3UQVA 1Y3UA 5FB8C 4JK5A 4DY7B 1TABE 1AQ7A 4IS5A 4M7GA 2BD4A 2ZHEH 4DIIH 1ELTA 5HF1A 1FI8A 3HATH 5C2ZA 2ZPMA 2WV9A 3A8BA 1QR3E 1VITH 1NFUA 1WF7A 2ZTZA 3KQBA 2A45B 1MC7A 1W7GH 1FNIA 1ANCA 4FU7A 4IW4E 3T26A 3PM3A 2SGAA 2VIDA 1JIRA 1FAXA 2G5MB 1D3TB 3ZZAA 4LZ1H 4XSKU 3LU9B 1ZYOA 1G30B 2JIZD 5GXPA 1O3OA 3P8GA 1WH1A 1TNIA 1AO5A 2Z7FE 3AW1A 2WPLS 1PYTD 1QA0A 2WYGA 4WWYA 2IPQX 3KQCA 3DFLA 5DP5A 4WXIA 3SU1A 3FP8E 1E37B 1TBQH 2A7JA 1MTVA 3CS0A 2FMJA 2GMTC 4ABHA 2Q6GA 4YXWD 2HVXA 4Q7YA 3RXJA 1GHBG 1F7ZA 1O2GH 2ZPRA 4NIVA 1DWDH 2ASUB 2HLDD 1PQ5A 1ELBA 5EYZA 1J9CH 3AASA 4K2YA 1O5BB 2C8ZB 2HRVA 4K1EA 3B23B 1O2OA 3P70B 2EA3A 1V2PT 1HAYB 5HJ1A 1O36A 1SGQE 1K1IA 3FY5A 1EPTC 2J94A 2V6NA 3RLYH 2XWBI 1QBNA 1W0ZU 4Y7BA 5A0CA 1V2MT 5I25A 2L6OA 4BXSA 1Z7KA 1TNHA 3SQEE 1MAYA 1O2UA 5LGOA 2M3MA 1VJAU 1BBRH 1UK4A 4X6OA 3CP7A 2B9LA 3DJ1A 1IHSH 3VB3A 5IDKA 1P1DA 4HTCH 1BOQA 4P00A 1ESAA 1AWFH 2L97A 1GI7B 3VQFA 1C5YB 2QCYA 2A4OA 5T3HA 3ATIA 3SHAH 1ANBA 2ZDVH 2EEJA 1O33A 1C5VA 1BZXE 4MPWA 1JRSA 1A4WH 4ZXXH 2VGCC 3RXMA 4GPGA 1AE5A 4NIXA 5L2ZH 4KTUA 4SGBE 2HE4A 2OTVA 1BTYA 4YM9A 2GZ7A 3QUMP 1MD8A 1ID5H 2HE2A 2BLQA 1V2WT 2A32A 3RXRA 1AZZA 1C1PA 4OEPA 2FESH 2VIVA 3A82A 4X1RU 3RU4D 1K32A 4Q80A 1OYTH 2VIOA 5B42A 2BY9X 4JCNA 5C0UA 4AG2A 1X8SA 1X45A 2Z9JA 2BD3A 5A2PA 1H4WA 1CT4E 4HOPA 5A2MH 1NU9A 2QF3A 2XBYA 1EAXA 1ZUBA 1EX3A 3MH6A 1GBAA 3TPIZ 4OGXA 1KDQA 3D65E 5TCCA 4HFPB 2FWWA 1K1JA 4BANB 3BG4B 4MTBA 4YT7H 1THSH 3BTEE 1C2JA 1JWTA 3FKSD 5AFZH 4U30A 3ODDA 3T27A 2DLUA 3PB1E 3WW7A 2V3MA 1YPJH 1O34A 1QJ1B 2JJ2D 4Y71A 1XM1A 4DIHH 4JJ0A 1QL7A 1BMAA 2KJPA 3UTUH 2BDAA 1MTWA 1T7CA 2BY6X 4NFFA 2C90B 2QF0A 1BRAA 3RXSA 4I8HA 1AVGH 2HWLB 1AHTH 4QT8C 2JDID 1QTFA 3A80A 1HJAC 3M7TA 2D1JA 4TY7A 3GSLA 2WHXA 1NFYA 1EZQA 1NZQH 3WY8A 1NBMD 4AYVB 3RXDA 1E79D 1JXPA 1W11U 3F2FA 3F68H 1GHZA 4AZ2B 2FTMA 2HPQH 1FIZA 4NMRA 1CVWH 2VVUA 4A1TA 4DJZB 4Y8XA 3T2NA 1DPOA 1A3EH 1P06A 3KHVA 1WTGH 3MH4A 1THRH 1TRMA 1ZHRA 1FONA 1TWXB 2A0QB 2W6ID 4YZUA 3LONA 3SJIA 1LHFH 5C5NA 1IAUA 1YY3A 2HGAA 4JK6A 3SU0A 3SU3A 4AX9H 1NT1A 4X2XA 2OUAA 2Y5GA 4FETA 5HYOA 3LGUA 5AHGH 2JOAA 3RMLH 4MNVA 1BJVA 4UEHH 2HALA 3RU4E 3UREA 1KDQB 3E0PB 2Z9GA 1NU7B 3B76A 4Y8YA 2W6JD 3MOCA 2ALVA 1FZZA 1XMNB 1ZHPA 2W3IA 4GVUA 4MNWA 2G4UA 4FU8A 2D8IA 3UWJH 2UUJB 1FAKH 1AFQB 8GCHG 2H2CA 1OWEA 2JILA 2MHOA 1FN8A 2RDEA 2AWXA 3R68A 1S0QA 4NZLA 1SOZA 1KIGH 5JPMH 2ZP0H 3QE1A 4Q2KA 3F9GA 1A5GH 2AIPA 2K1QA 3PROA 4NWKA 3SJOA 1FIWA 2ZKSA 5CMXH 2Z9IA 3I1EA 1HUTH 2KPKA 4GLYA 3MWIU 1UEQA 1PQ8A 2GJGA 1OXGA 4CH2B 4ZXYH 2M0TA 1K2I1 2ZNKH 1Y5UT 1MKXH 4YLUA 4TT3D 1V2UT 4IMZA 1W14U 2EEGA 1ELVA 1ZOMA 4CRCA 2X7ZA 3VQGA 2D2DA 2GT8A 3MH7A 4ZCNA 3PLKA 1O5EH 1O3IA 3A83A 2BYGA 3SUGA 1AKSA 3NGHA 4OM9A 1A5HA 1SB1H 3LGWA 2DLSA 2CN0H 3FO8D 3PTBA 4NFEA 4FVDA 1T8OA 3ZZ8A 1ZPBA 3M37A 2VIQA 1QURH 1YPMH 1W13U 3HK3B 1FDPA 4Y6DA 3SNCA 2KCYA 2JREA 4WYTA 4ZKRU 2FOBA 1RY4A 1Z87A 3LGTA 3BTME 1GMDG 1EAUA 2OBOA 4X6PA 1TB6H 1VCQA 3OSYA 1BCUH 1TX6A 1GCDA 6CHAC 5KECA 1TGSZ 1UFXA 5T1VA 3M36A 1D6RA 2K0QA 3DSGA 5TCAA 3EGKH 1C2LA 2AHME 1YYY1 1NM6A 2BY8X 2IOTA 1QRWA 3GY5A 5HFFA 2OCSA 4AFSA 2F9NA 3LKWA 1SGFA 4Q2QA 2AS9A 2KL1A 4JOPA 2H9TH 4I8GA 1TMTH 2VU8E 3F9EA 1Z6EA 1ARCA 1S84A 3KDKA 3S0NA 3PS4A 1WI4A 4M9FA 2KOHA 1OS8A 2I04A 3ZVDA 2OC0A 2FDAA 2F9UA 2VNTA 2Y7ZA 1UTKA 4BTTB 2H5CA 1BTPA 2IWPA 2QBWA 2J38A 1LVYA 1AKSB 3MNXA 5HIYA 2BQ7B 4RI0A 1BTUA 1GMHG 1O3BA 4Q7XA 1HAHH 4TYDA 3F2GA 2TGAA 5DJ7A 3UAIC 1VKYA 3OTJE 1GHXH 3LNXA 5JBCS 1FV9A 1NN6A 4PQWA 3M35A 3BTGE 1AB9B 1TRNA 1SQOA 3RMOH 1UEWA 4ACBA 2LC7A 4NMQA 1E38B 1P1EA 2OP9A 4BAOB 2ZPQA 1KYNA 1K9OE 5GCHG 1ZSJA 1P9SA 1QB6A 1CGIE 2I0IA 4IN2A 2XCFA 2LOBA 4ZUHA 3GDSA 1Y3XA 3PYHA 3MFJA 1RTKA 3UUZA 2P95A 1OPHB 3CS7A 2P16A 1F0UA 4A6LA 5G1EA 4ABIA 1P03A 1SSXA 3FANA 2DJTA 4GAWA 4E06H 3ATMA 5EQRA 1TGNA 3KQEA 2PKAA 5A8YA 2M10A 1FX0B 1QB9A 3BSQA 2EEHA 2BY5X 3VPKA 1SLXB 1L1NA 1LPKB 3BEIB 3MU5A 1O3FA 1ZPCA 2VVCA 4TSFD 2SGDE 3T5FH 3BIUH 3LNYA 3DHKH 3R0FA 4JOFA 1Z86A 3P8NA 1O2RA 1TLDA 4NXRA 1XXDA 4TWWA 3A8AA 2OC8A 4AFUA 2G00A 2KV8A 2G51A 2A2QH 3DD2H 1P02A 1UTQA 4FU9A 1C1RA 4ISLA 3ZVBA 3R3GB 2D8WA 3ID1A 4INKA 1NF3C 5LPEA 3PMBB 3OYPA 3RXIA 1N6XA 2TGTA 2ZDMA 2PZDA 3BTWE 1N8OB 4UONA 1Z1JA 2PKSB 1EOLA 3GICB 3KF2A 1ZSKA 4NZQA 4NMVA 3MMGA 1FY3A 2H9HA 1NY22 2B5TB 1Z8IB 7KMEH 3ZV9A 3RXEA 1HV7A 4ZKSU 2VWRA 4Z6AH 1AWHB 3EGHC 1C9TA 1DWBH 1O3MA 1VGCB 3SFJA 2FLRH 1GPZA 3DJAA 2EDVA 3IWMA 2OC7A 3P8OA 4ZHAA 1ELDE 3GYLB 5F6MA 3K2UA 1YC0A 4AGKA 4E05H 1M5ZA 1H8DH 4U32A 2W3KA 1IQMA 2PKAB 2QXGA 3K6YA 3V7TA 2Y7XA 1C2GA 1S6FA 1THPB 2IJD1 2FS8A 1GCTC 3P6ZB 1W3CA 1NO9H 1FPHH 5EOKA 4Z1MD 3E91A 4K1SA 2AWWA 2SGQE 5EXLA 4D9RA 3QJMA 1DICA 1TQ7B 1QA7A 4OS6A 4NXQA 1PPFE 1O3EA 2WV5A 1M9UA 1F5RA 3A7WA 3UFAA 4Y7AA 2FYQA 1GJBB 5LPFA 4CR9A 1YCPM 2L4SA 2WUCA 2R0LA 4DOQA 1HXEH 1H9LB 2NU1E 2P3WA 4JOHA 1QQ4A 3E1XB 1H1BA 2SFAA 4YOIA 1BHXF 1LHGH 1P2KA 2BDCA 1UK2A 2AFQB 4ISNA 5HM9A 1DM4B 3K50A 1P09A 4GHTA 4WY3A 3N99A 2XXLA 1Y8TA 2JH5D 1GI5A 1SGFG 5A0BA 1VZQH 1MKXK 1TP3A 1C1NA 3F0PA 1WHAA 2ZQ1A 3NWUA 2VVVA 2R2MB 3SUEA 1TNJA 2KX4A 2ESTE 4UU5A 3V12A 1BITA 3Q77A 1DOJA 5FXLA 1V2ST 3WWBA 1BT7A 4IC6A 5CHAC 3SN8A 1G37A 2M0UA 2YMSC 1W0YH 1XVMA 1WYKA 3GJ9A 2RFKC 2EJYA 3ID4A 1SLVB 1HJ8A 3P95A 4IMQA 4BNRA 1LKAA 1LPGB 1YF4A 5CDFE 5HEYA 2J9NA 1T2MA 1P01A 1VITG 3PDZA 3I18A 1T32A 1OBYA 4ABBA 4JOJA 4BTIB 1GL0E 4K8BA 2CGAA 3T29A 1YPEH 1CO7E 2F4LA 3SJKA 4E35A 1MQ6A 1O2KA 1OP8A 2ZHWH 2NWNA 3TMHA 1ZRKA 1HAZB 2FS9A 2IPHA 2OC1A 2A2XH 3GDUA 2RRMA 1VCWA 4N6XA 2LNCA 1PPHE 1ZZZA 1C5XB 4GHNA 2HNTF 1AUTC 3QZQA 5HFCA 4B1TA 3TH4H 2FI3E 1UW7A 3BTTE 1GJ6A 2PTCE 1A0JA 4R8TB 1NTEA 2A1DB 3RXLA 2ZFFH 2OK5A 3LJOA 2VBCA 2CSSA 4MPXA 2WPJS 1G3BA 1D4PB 1YLDA 2VH0A 3VFEA 2DAZA 3OE7D 5E8EH 3UR6A 1HAIH 1F0RA 2OLGA 1KSNA 1HFDA 1ETRH 2I6SA 2G5VA 1MBMA 1K0HA 4MG3A 4U01A 1G36A 1V2TT 4ABFA 3M61U 2RG3A 4INHA 5EJLA 2Q6FA 2J97A 1UMAH 2ZZUH 4KTCA 1A61H 5C3NA 2VWMA 2CSJA 5EJ1A 5HFDA 2ZU2A 3U8TH 5K7RA 2EAQA 2RA3A 2ZFSA 2GCTC 2W7RA 1GI3A 1PPBH 4H4FA 5FX6A 1T4UH 2P59A 2TIOA 3MI4A 2GTBA 5TJXA 4AFZA 1MU6B 1YBOA 2CF9H 3ZV8A 4ASHA 5T6DA 2HVYB 1ESTA 1WF8A 1GMHF 2ZDNA 1NRNH 1V3XA 4BAMB 2FCFA 3RMNH 3NUMA 1WSSH 1C2MA 1TPOA 3BTHE 1BTWA 1TIOA 2YT7A 3SZEA 5C1XA 3WKMA 4UE7H 2BDYA 1Y3WA 4LOYH 1UTLM 4X6MA 2JETB 4KTSA 4OEOA 3R0HA 2ZDAH 1O2JA 4OS4A 3V0XA 4JJ3A 3A89A 2H9EH 3KL6A 1DLEA 4JORA 2TBSA 1C5SA 2BD8A 5AF9H 2KOJA 1Q3XA 3UY9A 1I16A 4CRDA 4NA7A 2JIKA 3ZZBA 4K76A 1O2WA 1QGFA 3U98H 1HIAA 1O5CB 1EJAA 1NFWA 4NA9H 2H2BA 2H3MA 1G32B 3KGPA 3GYMA 5HF4A 3TVJB 2LC6A 2UWLA 1FCFA 1C5ZB 1ZSLA 1DVAH 1P2JA 1TPAE 2ANYA 1MAXA 2YNAA 1EB2A 5CHBA 1BQYA 2WPHS 3ZVAA 7LPRA 2LPRA 4X1SU 2F0AA 4DVAU 4TPYA 1GI0A 3QDOA 2PUXB 4XDEA 2A5IA 4YTAA 3SU5A 2FP7B 1VCPA 1GJ8B 1UVTH 4NMPA 1O2NA 1D3QB 2PR3A 3GS9A 3DCLA 2VRFA 1GJ4H 3F9HA 4B71A 3U69H 1FC9A 4D7FA 4DT4A 1GGDB 1I92A 3HGNA 4WMEA 4DURA 1S6LA 1FUJA 5HGGA 2WPMS 3RL7A 5GJ4B 1T8LA 3UOPA 3GCOA 2Y5FA 1UVSH 4XRNA 4KP0A 4MPUA 3QGJA 2JKHA 4JZDH 1XVOA 1NTPA 4NSVA 5IL9A 1PPEE 3SI3H 1IQEA 1IQGA 3BIVH 1UTPA 1GQ4A 3QJNA 2PHBA 1ZPZA 2F5YA 1G3CA 2CXVA 5J4SA 2UUKB 2A5AA 1HIAB 1YPKH 4A5TS 2O8UA 3F6UH 4XOJA 2OCVB 1XUHA 2GD4B 3M5MA 1A7SA 2V90A 1ACBE 1IHTH 1J14A 1O3GA 4Z0KA 4NCYA 2EC9H 3HGPA 2QT5A 4B73A 2D90A 1T8NA 4ZKNU 1O3LA 1Z8JB 1UJVA 3TSZA 5ETXA 1K1LA 3KDGA 1E1QD 2FO9A 3B8JA 4X2VA 1UK3A 1O3HA 1TONA 3ZVFA 3O46A 1P3EA 3D23A 1A1RA 3M5OA 5JB9S 2G81E 1SQAA 2W26A 1BHXB 2RCZA 3A87A 4THNH 1SPJA 2QF4A 1QRXA 1L6OA 2IWQA 1O2PA 3LC5A 5JXBA 4TY6A 1B0EA 1C2FA 2P8OB 2QY0B 2PKUA 3UWIA 2M0VA 4YOJA 1IU2A 4KGAA 1EZSC 4I32A 2PLXA 3OY5U 2LA8A 4Q7ZA 1K21H 4J2YB 1ZGVA 1G3DA 1Y3YA 4I31A 3LC3A 1QIXB 3TK6A 2HGTH 3FN8A 4A7IB 4BOHA 4K3JA 2AYWA 3BG4C 1ZOKA 2XBXA 8LPRA 3RXKA 1SKYE 2Q3GA 1OWIA 1R6JA 2P93A 4I8KA 1E36B 3EDXB 3MQKC 4OS7A 1HNEE 3GDVA 4RN6A 5JBBS 4IN1A 1L0ZA 4B75A 2OXSA 1C1TA 2BX3A 1IQHA 1WJLA 1VITF 3RDZA 4IGDA 2FLBH 2STAE 3GCTG 1ABJH 3WKLA 1O30A 4RKOB 2FEQH 1QL8A 1QNJA 2XTTB 1Q31A 4HG6A 4F8KA 2AINA 1GBBA 3P8FA 1H8IH 3SO3A 8ESTE 5EW2H 1TX7A 2B8OH 2BMGB 1YPHC 3M5NA 3OY6U 1EAIA 1UO6A 2AGEX 2OD3B 2QG1A 2HNTC 1DY9A 2OPGA 4JOGA 4X8SH 3TK9A 1O31A 4ACAA 4AG1A 1BTZA 1VJ6A 2J4IA 3C27B 1BUIA 4UD9H 2YTWA 3ZYEA 1N7TA 2FI4E 4GVDA 4NXPA 2WPKS 1QAVA 4B6FA 1ZMJA 5EXMA 5GNDA 1V2VT 4FVBA 3KNXA 1ZMNA 3URCA 2D26C 1C1MA 1S5SA 1LHDH 4XBBA 1C5MD 1MU8B 3K9XB 2QKUA 1KWAA 1C9PA 2WSSD 1YWUA 1GJCB 1FC6A 4Y0ZE 3STIA 4L8NA 4Q63A 4G69A
chains in the Genus database with same CATH topology
1C1QA 1S82A 2JH0D 1TP5A 3M7QA 3I77A 2P94A 3E8LA 4Y79A 1QJ6B 5E2OA 1AFQC 1BA8B 1GDUA 1PDRA 4WXVA 1O2LA 3RXTA 4UFGH 1P2NA 5DP4A 2A31A 1P0SH 3HK6B 1EZUC 1SBWA 2HLCA 3M3VA 1PFXC 3LH1A 3PV5A 1O2XA 1TOMH 1Z71A 2GDDA 4I8LA 2CHAB 2ZIQH 4OS5A 1EP5A 3VGCB 1HRTH 2W5EA 1S6HA 4CRGA 4DT7B 3MYWA 5D13A 3RM0H 1O32A 2F9PA 1TFXA 1GBDA 3DIWA 3TSVA 2HPPH 1F2SE 5FBIA 3AXAA 2R9PA 2O9QA 1UCYK 1RRKA 1AGJA 2FI5E 3HPKA 1QAVB 4A1VA 1V5QA 1C2HA 1YPLH 3MU8A 3SQHE 5EPYA 2PFEA 2ENOA 1GWAA 3MH5A 5L2YH 3RC5A 1G9OA 1W9QA 3U1IB 1BMMH 2ANMH 1Q2WA 1CE5A 1L1GA 1L4ZA 4R0IA 1WBGB 2QC2A 4JZIA 1AIXH 2BX4A 4K60A 2FNEA 2KOMA 3QTVH 2ZFRH 2YOLA 1VA8A 2ZA5A 4DGJA 1QL9A 4K75A 1KXCA 1SL3A 4ESTE 7GCHG 4FUBA 3RXBA 2Y81A 1QJ7B 5FPYA 2ZGCA 1OWKA 4X8VH 1RTFB 6ESTA 1BMLA 1GG6B 3TJOA 1UTMA 2P3FH 4H42U 4HGCA 1TGBA 1UVUH 3TGIE 2GP9B 2ZPLA 1D3PB 1RIWB 4O03A 1G2LA 5HDYA 2FODA 1QFKH 1OX1A 1KEFA 1GJ7B 1C2IA 2ZDKA 1GJDB 2IN2A 4K1TA 1SQTA 2R4HA 4D9QA 4K78A 2GV7A 3JZ2B 3ODFA 1JBUH 2QXHA 3BEUA 3A7YA 4LK4A 2UZCA 4MPAA 1P05A 4NNMA 1OSSA 1A5IA 3PO1B 1C1UH 4Q2OA 3IITA 1OP0A 3KIDU 4X1NU 1C5TA 1SGTA 2K1ZA 1C5QA 4E7RG 3HPTB 2OS6A 2BVRH 1SMFE 2VWNA 2DB5A 1E0FD 2UWOA 4XHVA 2TGPZ 3F1SB 2DE9A 2KYLA 1YPHE 4BXWA 2Z3DA 1CA0C 1V2LT 3NCLA 1GI6A 1TPPA 2HNTE 1AB9C 1CA0B 2GCHF 2AEIH 1BJUA 4MNYA 3NFKA 1IQLA 2AIQA 4X8UH 1E34B 4Q3HA 2ZGJA 3AW0A 3LIWA 1HYLA 4FLNA 2XWAA 4ABJA 1MTUA 2BHGA 2V35A 3RXCA 1WHDA 4Z8JA 3SU4A 1AVWA 3VEQB 4E7NA 1UM7A 1V5LA 1CQQA 1TOCB 2NU4E 4BAHB 1P12E 4P2AB 4A1XA 1TQ3A 2ZFQH 5F8TA 1RFNA 3E17A 1C2KA 3EA9A 1JRTA 1SG8B 1XUJA 3SOSA 1ZRBA 2ZU5A 2VPHA 5DK1A 1ZMLA 3GY6A 4ZMAH 2UWPA 3ZZCA 1GBCA 2I0LA 3BPUA 2BQWB 4OGYA 2SNVA 1ZTJA 1LVBA 2EHRA 3ENSB 4ABEA 3ZVGA 2GDEH 1TA2A 3A8CA 2J92A 3SZNA 3A7XA 3ELAH 3UR9A 3MU1A 2PV9B 4ZKOU 2KJDA 3NKKA 1CBWB 2FOMB 1W2KH 1LHCH 1WAYB 1XX9A 3S9CA 3ZVEA 1C1OA 2ZU4A 3TLOA 1T8MA 2SGPE 2KRGA 5HFEA 2GKVE 2H3LA 3D62A 4HI3A 1UF1A 1N8OC 2FOEA 1CU1A 3RP2A 1U6QA 1ZJDA 2PKSC 1TBZH 1NC6A 3SNEA 1KXDA 2GEFA 1N6YA 1A0HB 3LPRA 1OWJA 1C2EA 1C5PA 3C1KA 5FAHA 2TRMA 2XC5A 1DFPA 1J16A 4GUXA 3URDA 2JSNA 3GCTF 4ABAA 3EE0B 1VGCC 2PSYA 2WUBA