1SOZA

Crystal structure of degs protease in complex with an activating peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
311
structure length
281
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 281
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1sozA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sozA02
1O3DA 1XXFA 1H8IH 3U8RH 5HFBA 1FY3A 1K1JA 2VU8E 2ZU3A 3A8CA 5SGAE 1ZTJA 4ISOA 4CR5A 5LPRA 1EJNA 4DVAU 2VPHA 4WJG2 1O3KA 1G30B 1XVOA 2YTWA 2XBWA 3QX5H 1LVYA 4BAHB 3URDA 2M0VA 2OCSA 2K20A 1JIRA 2ZDLA 2KRGA 3PO1C 2GT8A 1LVMA 2OBQA 5JPMH 1NFYA 1ESAA 1K1OA 4NIYA 9LPRA 2Z6BD 1NROH 1MCVA 4FUIA 1S0QA 7KMEH 4I33A 1WQSA 2UUYA 3T2NA 2NU2E 1HAOH 3BTWE 3CS7A 2BDGA 1DXWA 1ZZZA 4WMFA 1UHBB 4ISHH 3DJ3A 4X8SH 1O3CA 1DX5M 3F9GA 3JZ1B 3AXAA 1AZZA 2W3IA 1IQEA 3PROA 1C9TA 4OAJA 1UTKA 3GCHB 4BTTB 3V12A 2GTBA 5GLJA 2JWEA 4UEHH 2OP9A 1ZOMA 2FS8A 1MUEB 4UFFH 1PFXC 1ZHPA 1W7GH 2V0BA 3T26A 2XWAA 3RXKA 3NFKA 5LPEA 2FNEA 2BY8X 2FOFA 1BTPA 4QT8C 4TY7A 2J34A 1DM4B 1QY6A 3TJVA 1EZQA 4ZXXH 2H9EH 2F83A 3A89A 2A5KA 1ANDA 1E38B 2F9BH 1P09A 2YNBA 2OXSA 2RA3A 1QBNA 3LIWA 1DDJA 3ZZCA 4NXPA 1WH1A 1UK3A 2OBOA 1V2MT 2G8TA 1GI8B 5GDSH 1MCTA 3ZZ9A 1TNKA 3A82A 1L1JA 3NFLA 2ZPRA 1C5TA 3RXFA 4RKJB 1YLCA 3FP6E 1O2GH 4ABFA 3PMBB 1MBMA 1C5MD 1NRNH 3TJOA 3DD2H 5F8TA 2F9NA 1Q7XA 4GHTA 1I92A 2ZHEH 2TRMA 1IQFA 2BDIA 5E21A 1TP3A 1ZMJA 2BX4A 3VB4A 3HVQC 4E05H 2VIQA 3TJNA 1BFEA 1EJAA 2BM2A 2Z3CA 3S0NA 1HJ9A 2SGDE 1HAXB 1PQ8A 2UUJB 3BTFE 3P8FA 3Q00A 4XDEA 2VWMA 3TK6A 1HB0B 1D5GA 2LC7A 5DTHA 3H7TA 4Q7YA 3GJ9A 4LXBH 1P9UA 2P3TB 3O8BA 1K32A 4YLUA 3EQ0H 3RP2A 1GL0E 1AY6H 3P92A 3M37A 3SU3A 4JOHA 2C8XB 1AN1E 4LZ1H 2SFAA 1MTWA 2FI4E 1TABE 1FC6A 1C4U2 5I25A 1IQIA 4JOKA 2A4GA 1D9IA 1MU8B 1QB1A 1B8QA 2CN0H 1Q3PA 1C5ZB 3MWIU 1UVSH 2ZFPH 1QTFA 4X0WU 1O2RA 3BTEE 1C5VA 1HAHH 3S9AA 4NIWA 1QIXB 2Z3DA 4CHAC 4E34A 1QA0A 2I6VA 4UFEH 5IDKA 4K1EA 5C5OA 1DANH 3M5MA 2FWWA 3MU5A 2A5AA 1FV9A 3SUFA 4BTUB 5AHGH 2CV3A 1KWAA 1JXPA 4BTIB 2R3YA 3LNYA 2AGIX 5HYOA 3RXJA 1YGCH 1YPEH 1FY4A 4K6YA 1ZPBA 4B2CA 1J17T 3E8LA 2XTTB 3ODFA 5DP4A 3SHUA 2BZAA 2TGDA 1OP8A 1TNLA 4GPGA 1O2NA 4JCNA 1V2OT 2FI5E 4BNRA 1KTSB 1BIOA 4X8UH 1GBAA 1YF4A 1WCZA 2VIWA 1KTTB 2W3KA 1V62A 4XE4A 1VJ9U 3OTJE 4NIVA 1QHRB 4GHNA 1V6DA 2ANWA 2UWPA 5ESTE 4I8JA 1Y59T 5L2ZH 1GMCF 1CGIE 4NMRA 1EUFA 1TALA 1AHTH 1Z8IB 1IQLA 1LHDH 1UHBA 2P94A 1MD8A 4FU8A 4J1YA 3CP7A 4DY7B 1SGCA 2XNIA 3MU8A 3SUDA 1TQ3A 3R68A 3ID3A 1SC8U 2H5DA 2OINA 4I8HA 2KOHA 2BD3A 3BTDE 3O8RA 4YM9A 4IS5A 4FGMA 5AFZH 1ELEE 1GG6B 3LH1A 2IWQA 1DSTA 3ID2A 2BZ6H 1R6JA 2ZFRH 5FCRA 2RRMA 1IQNA 1GJBB 3UUZA 1KXBA 3KZEA 3SQEE 1ZUBA 2KAIB 4FUJA 1B7XB 2EEGA 3ATIA 2J9NA 2JKHA 2PGBB 1X6DA 2EJYA 7GCHF 1ZSJA 4Q2PA 1U37A 1OWEA 7LPRA 5HF4A 4F8KA 2ZQ1A 1P1EA 1RXPA 4KFWA 3JXTA 2A2QH 4DT7B 2AEIH 2LC6A 2J2UA 4KTUA 1QNJA 2A2XH 4GCHF 1O3LA 3V3MA 5B6LA 4RN6A 4OEOA 1TPOA 4O97A 4NG9H 1G9OA 1T8NA 2TGPZ 3GYMA 1OBYA 3PM3A 3UR6A 5EW1H 1L4ZA 2A31A 2F9VA 2VRFA 1WAYB 1N6FA 2KA9A 2K1ZA 1A1RA 4Q80A 2G5VA 1WFGA 1Z8JB 2BLWA 2M10A 2VH0A 3P8NA 1MFGA 2YUYA 3RXSA 2GP9B 3SV2H 2G51A 2V6NA 4CRCA 5GPIB 1RRKA 1SPJA 3UNQA 3UQOA 5HFEA 1C5SA 1RGRA 5J4SA 2OTVA 1O2OA 3EA8A 1T32A 1Y7NA 3OX7U 2W7SA 2C8ZB 1FN6A 1BQYA 1SGDE 2FLBH 4MNXA 4LK4A 1FJSA 1N6EA 1RZXA 2BY9X 1NRRH 4PROA 2ZDVH 2JXOA 1SG8B 1FPHH 2ZFFH 1ELAA 4B71A 2QY0B 3Q3KA 1C5PA 2IWOA 3ATKA 3QTVH 1ID5H 3SZNA 4AZ2B 1YPLH 3MU1A 2ZU4A 2GZ9A 3BEUA 1C5XB 3LONA 1IQJA 1DUEA 3PO1B 3LDXH 1Y5UT 1SMFE 3ODDA 1THSH 2BYAX 1YPGH 3QK1A 1RD3B 3OU0A 2AGEX 2A0QB 3RXMA 1GHXH 1W3CA 5T6GA 1QRWA 3AW0A 3RXEA 4GLYA 2FMJA 1CT0E 3VB5A 2DJTA 1GMHG 3D49H 1MTSA 4REYA 1EOJA 1EXFA 5A0AE 1Q3XA 2CXVA 1C9PA 2YT7A 1PDRA 1O3JA 4NMVA 3ID1A 1D3PB 3CBXA 1Z6JH 4NGAH 4OS2A 3HKJB 1MU6B 4AOQA 2ZC9H 3A88A 2KOMA 2PUXB 5PTPA 2VVUA 1NN6A 3QZRA 4I8GA 6LPRA 4YLQH 3AAVA 1IU2A 3BTQE 5DP7A 7ESTE 4ZKSU 2SGFE 2ZA5A 1C1RA 1NO9H 1AE8H 3O46A 4NMQA 1QJ1B 2FODA 3A8AA 1SB1H 2Y80A 2Q9VA 3DORA 1XUFA 3W95A 3E0NB 1Q31A 3UY9A 5C1UA 2H1UA 2V3OH 2OC7A 3BTTE 4BXSA 1A3EH 1O2VA 2HE4A 1BT7A 1W9EA 1FAKH 2Z9LA 2AFQB 3C1KA 4GVCA 1KXDA 1UK4A 2VSVA 1ELBA 2I04A 1TOMH 2KG2A 3A86A 1TRYA 2EEHA 1E0FD 1N1LA 2BHGA 1NU7B 3PLKA 5ETXA 4D9QA 1A5IA 4AB9A 4Z0KA 3TGKE 3VB3A 1VJAU 3GCHC 4AMHA 2VWLA 5C1XA 2AMDA 1QURH 1F0TA 1MZAA 1YP9A 4Y76A 3UWIA 4ASHA 2FOGA 1SGYE 1S6HA 4X8TH 2A45B 1FY5A 3QTOH 4RKOB 1IU0A 2RCZA 5EQRA 2HPQH 1O38A 1P05A 1QB6A 4K1TA 1UEWA 1AKSA 2GGVB 3ZVEA 2OQUA 1C1QA 4YOJA 2ZTYA 4DW2U 3HKIB 1S0RA 3SHAH 1SSXA 3CYYA 1KDQA 2ANMH 1S6FA 2D8IA 3H5CB 1LKBA 2SGEE 5HMAA 3ZZ6A 4MNYA 1GM1A 1FN8A 1RTKA 5HFFA 4JZFH 4TPIZ 1PPEE 1WI4A 4WF8A 3E17A 4Y71A 4CBOA 1C2EA 2CSJA 1S83A 1NPMA 1C2FA 4FUFA 1CGJE 3OYPA 3MOCA 2Y81A 1O3BA 3HPMA 2V3HH 5HEBA 1AI8H 2P93A 3B23B 5HEDA 2A7HA 3U98H 1MKXH 1DWCH 4IMZA 4K8YA 2QKUA 1W13U 1XVMA 3L4FD 4KELA 1C1NA 4MPWA 4PQWA 2FOBA 2PKSC 1TMTH 2WPLS 3ZVDA 2M0UA 4X6PA 1P10A 1HBTH 2FO9A 1W9OA 3NWUA 3ZZ7A 3EE0B 3VB7A 1C4V2 4I7YH 1Z1IA 3VPKA 5F6MA 2Z7FE 4JOFA 4MDSA 3TSWA 3KIDU 2K1QA 2EGNA 3SUZA 2F9PA 3HPTB 1UVUH 1FDPA 1KIGH 1OZIA 2BD5A 3A85A 4O03A 1VCQA 3SU0A 3MH4A 2BX3A 1A5HA 1N7EA 1HJ8A 1VB7A 1DS2E 1GHVH 1RTFB 4ISNA 1PQ5A 3QGLA 1L1NA 1WHAA 1YPKH 3EGKH 3P8OA 1RGWA 2D92A 1SGTA 3RXTA 2A1DB 3GISB 1FUJA 1C2JA 3QGNB 3WY8A 3M5OA 4XFQA 5HM9A 1SQTA 1O3FA 2QBWA 3FZDA 1U38A 3RC6A 2FX6A 3PMJA 4CBNA 1OXGA 4DIIH 4TWYA 2P8OB 1ZGIA 2LUIA 2P3FH 3P70B 1KEFA 4ABAA 1O39A 3ATLA 1BMMH 2C93B 3QGJA 5DO4H 6ESTA 1DPOA 1XKBC 2CSSA 5HF1A 1YCPM 3BTME 3ZZ3A 4AX9H 2C8WB 4JOEA 3A7VA 5K0HA 2I6SA 2UWLA 2BOKA 2O2TA 2BDBA 2D90A 1TGTA 1SOTA 8GCHF 1ZPCA 3E90B 1GJ7B 3RU4T 1MKWH 2TPIZ 3BEFB 1MAXA 2PKTA 3E1XB 1CHOF 2GMTC 4G69A 1NZQH 5FPSA 1XZ9A 2XCFA 2YUBA 4VGCB 2C3SA 1BUIA 2L97A 2WINI 3SU6A 4AYVB 1P0SH 3T27A 3B8JA 4MQAA 1GBIA 1BA8B 2BD4A 3H7OA 1GI5A 4X8VH 1W8BH 1LHCH 3BSQA 1BRCE 1GVLA 1RTLA 2I6QA 2SNWA 4FXGH 3GCTG 3GY5A 1GG6C 3LNXA 1KLJH 1W2KH 5GCHF 3RXGA 6GCHF 2ANYA 5DK1A 2SNVA 2H9HA 1VJ6A 1Y3XA 2BB4A 3KN2A 5HJ1A 1YLDA 1P2NA 1GPZA 4JK6A 3UOPA 1C1SA 2REYA 1V2UT 3TH2H 3ZZ8A 4CH8B 1QAUA 4KGAA 4JL7A 3KQDA 4Z33A 3M3TA 1ELCA 3U1IB 3LT3A 3BTHE 3ZV9A 1TOCB 1EB2A 2EI8A 1YBWA 1J16A 2XC0A 1WFVA 1DICA 1MQ6A 4IGDA 4Y10E 5F8ZA 1HUTH 1FC9A 2AH4X 3RC4A 4X1NU 1C1UH 5HDYA 1D3QB 3QIKA 1C5RA 3A81A 3PDZA 1BMAA 1YM0A 1DWEH 2AERH 1O2YA 4ZHLU 2EHRA 2ZU1A 1IHSH 1QL7A 1SVPA 2EGOA 2OMJA 1NS3A 2DM8A 1GGDB 1T8MA 2ODYB 2KQFA 1QL8A 4MTBA 2NWNA 3NZIA 2QA9E 1HAVA 1AFEH 3M7UA 1SI5H 3HGPA 3SUEA 2XWBI 1GVZA 2BDYA 1GCDA 1WBGB 4AORA 2BTCE 4D8NA 3IG6B 1A0HB 4ZKRU 3PLBA 4D7GA 4ZUHA 2KPLA 4K5ZA 1A2CH 2CJIA 3U8OH 1Q3OA 3VQGA 4D7FA 5A0BA 1N6DA 1PQAA 5EU8A 1DOJA 3UPEA 1FIWA 4ZH8A 5FPTA 1IAUA 4DCDA 2PSYA 4OGXA 1CA0C 1CT2E 3K6YA 1KLIH 4X6MA 4O06A 2QF3A 5EXNA 4Q7XA 1V2JT 1P3EA 3TK5A 3RXIA 2FZZA 3OTPA 3P17H 4FUCA 1QAVA 5E0HA 3FFGA 2Y7XA 2BY7X 2ENOA 1WJLA 1O2IA 1AGJA 1DUAA 2QG1A 2KPKA 4FU9A 1AQ7A 2GT7A 4HTCH 3GYLB 4NZQA 2ZIQH 2JETC 5F8XA 1BITA 2EDPA 3SJKA 4H42U 2ZTXA 2OS6A 1VR1H 1DWBH 3V0XA 3PTNA 1E37B 2WYGA 3EYDA 2JINA 4XHVA 4H11A 2C90B 1KXAA 4Q2NA 1B0EA 1QB9A 1X5QA 1X5NA 2PUQH 4YESB 2FTMA 1G3BA 3ZYDA 1JRTA 1OBZA 5I7ZA 3VGCC 2O9QA 1QL9A 1LVBA 5EXLA 4CRDA 5C67A 1X45A 1GHBF 1TMBH 1O2XA 4ABIA 2AWUA 3PTBA 1T7CA 2GZVA 1UTPA 5HETA 1MAYA 1GHZA 3IITA 4DGJA 1O31A 1LHGH 5DP8A 3ZZBA 1UITA 1HAGE 4Y0ZE 1FONA 1O5FH 1HPGA 1S81A 1V5LA 2UUFB 2Y5GA 2TGTA 1VA8A 4BOHA 1GI4A 3SUGA 4NMTA 1SLXB 2NU1E 2JIKA 5JXBA 2QIQA 2P59A 2R2MB 3V13A 4N6XA 1LMWB 2OD3B 2PKSB 1B0FA 3KZDA 5HFDA 2SGPE 4RSPA 3SHCH 2A32A 1MQ5A 1GJ4H 4FUHA 2ZECA 3RMLH 1UJ1A 3LGIA 1N7TA 1CQQA 1AVGH 3SOSA 3TH4H 2PR3A 1JOUB 3VEQB 2B9LA 2I4SA 4FU7A 1LTOA 1DY8A 2ZZUH 1VITF 5TCAA 5B6OA 4IMQA 4MPVA 3I4WA 1ORFA 3LJOA 1C2DA 4YDPA 1GMCG 1W0ZU 3TSZA 1YBOA 1UTNA 2WL7A 1EB1H 1ZRBA 1HFDA 4NA7A 4GVUA 1KXFA 1ZJKA 3BIUH 1SGQE 3CBYA 1QFKH 8ESTE 1SL3A 1C5QA 1IQGA 1FNIA 3A87A 3RDZA 1A4WH 1ETTH 1Z1JA 4Y7BA 4FVBA 1MKXK 3LC3A 4JK5A 1P2KA 1UTQA 3PLPA 3SGQE 2P3WA 1BMNH 4AGJA 3T25A 1EAIA 3MU4A 1INCA 2D8WA 1QJ6B 4NXQA 3EDXB 4E35A 1YCPH 3RLYH 2VZ5A 2PFEA 3KNXA 4BAQB 3TH3H 3SI4H 7GCHG 1BJVA 4OS6A 1G3EA 2XXLA 1O3OA 5TJXA 1Z7KA 2L4TA 3KQEA 1BTYA 1PJPA 2JILA 3NCLA 1OWIA 5JDUB 4GCHG 1O2TA 1P2JA 2ZDMA 1N8OC 1SGFG 2ZPMA 1MD7A 1U39A 2GMTB 2Y82A 1O5EH 4E06H 1V1TA 3SFJA 1O3IA 3DT0H 3HATH 4K76A 5GIBA 2GDDA 2H3LA 1GI6A 2BD9A 1F0RA 3RMOH 3SW2B 2TBSA 3MFJA 3RXRA 1TYNA 2WPIS 1DT2A 3Q3XA 2P8OC 1ELFA 1NRSH 1A46H 1XUGA 3SQHE 4R2ZA 2QT5A 4X6OA 1GJAB 4NCYA 2ULLA 3M5NA 1AKSB 5C20A 2BYGA 4GVDA 2R9PA 3R3GB 1WHDA 2ODQA 1W0YH 4BAOB 5E0JA 2PLXA 1HLTH 3GDUA 2WPMS 5D13A 5DKMA 2PSXA 1KDQB 5C1YA 3TJUA 3TPIZ 2SGQE 2QXGA 3SHWA 1O36A 2HNTC 2FIRH 4JZ1A 3SV9A 3HK6B 5DJ7A 4K2YA 4CRAA 1MKWK 4O9VA 1HIAA 3PB1E 4VGCC 1WG6A 1K28D 2ZGBH 1XKAC 2R2WU 1Y8TA 1OWKA 3RL8A 4THNH 2F91A 5A8XA 1O2SA 2C4FH 4X2VA 1UJDA 1IHJA 1OPHB 5FX6A 2VH6A 1ESTA 4WMDA 1O2PA 1HAYB 4CRGA 4WYUA 5EW2H 3SI3H 5JYIA 2UWOA 2Z9IA 2ZPLA 4AFQA 1ACBE 1AFQB 2V90A 3M61U 1P03A 1SGNE 1TNIA 4A92A 1TB6H 2D26C 1ZOKA 2STBE 3VB6A 2TGAA 1BOQA 1ZTKA 5F03A 1RS0A 4I32A 1LHEH 2GV7A 4B73A 3LGUA 5ABWA 1IQHA 3TNTA 2F5YA 1ABJH 3O5NA 1CA0B 1GVKB 1T4UH 2O8TA 5EODA 1EAXA 2CGAA 1GHAF 5T3HA 2DKRA 3CBZA 1GMDF 3CS0A 4FUEA 3PS4A 1TGNA 5HEYA 1W10U 4SGAE 1A3BH 1P8VC 4DIHH 2BD7A 5DP6A 2BVRH 5FHTA 3ZRTA 3KCGH 2PA1A 3UTUH 2BLVA 4K72A 3RL7A 1BDAA 4ZHAA 1UVOA 4AFUA 1GGDC 3RXAA 3U1JB 2IN2A 1TX7A 1LPKB 1CT4E 1F0SA 1SGIB 3G01A 3ZYEA 1V2TT 2JETB 1UK2A 1UTLM 4UONA 1BTUA 1O3NA 2PWXA 3A7TA 3SBKA 1T2MA 1OS8A 3ZV8A 1K1IA 3R0HA 3DHKH 1TAWA 1V2ST 1L2EA 1K2I1 5FCKA 2HVXA 1Z6EA 2XRCA 1BTXA 1C5OH 2RA0A 1P2QA 5JB8S 3R0FA 4E3BA 3WKMA 1I16A 1LPZB 1TA2A 4UD9H 2AYWA 3M36A 3LOXA 5DGJA 1E35B 2WUBA 5EQQA 5C2ZA 1O2UA 5DP5A 1WI2A 1O2WA 3VGCB 1QBVH 3MMGA 1BRUP 1ZR0A 1NU9A 2LA8A 1HDTH 5JBAS 2Y5HA 4Q7ZA 1S82A 3LGWA 4OGYA 1U3BA 4I31A 2ZFQH 5EOKA 1HYLA 1MBQA 5E22A 1SBWA 4E7RG 3GDSA 2BMGB 2ZDAH 2GDEH 1D3DB 2M3MA 1S5SA 2ZTZA 3CH8A 1VAEA 2W4FA 1QR3E 2KV8A 1DE7H 2WPJS 1GBKA 5A09A 5FX5A 1XUKA 2FN5A 4OS1A 4INKA 2ZGHA 1FLEE 3OY6U 4YT7H 4UFGH 1M5ZA 1JWTA 1OP0A 2GCTC 4WXVA 3RMNH 4BXWA 2Z9GA 4B74A 3C27B 1FCFA 5F3XA 4NFEA 2V35A 5I46H 1GQ4A 3A84A 1EATA 5E2PA 1XX9A 3P6ZB 3PV4A 1X5RA 3SO3A 3GDVA 4K60A 4YTAA 3QJNA 1ANEA 3KHFA 2JH5D 2WV4A 1FC7A 1Y3WA 4YT6H 3E16B 2JH0D 3HPKA 1QJ7B 4KTCA 3B9FH 3S7HB 3VXFH 3HGNA 2FCFA 1BE9A 3QJMA 3VFEA 5E11A 1C1VH 3BF6H 2AIQA 4X2XA 1G9IE 5HM2A 4ABGA 1EQ9A 1O3GA 1LQEA 3M3SA 3RXCA 3TNSA 3TGJE 2VINA 2D2DA 1V3XA 4XOJA 1TGSZ 1EX3A 4HZHA 1JMOH 4Y0YE 2HOBA 1UFXA 3EA7A 1CSOE 3NKKA 1OWJA 4NWKA 1N99A 1WF7A 4GUXA 1OX1A 1EPTA 2ZQ2A 3T28A 2GV6A 3DA9B 2ZP0H 1LPGB 1TPAE 2BQWB 1HAVB 1TWXB 4HI3A 1X8SA 5HFCA 1ZMNA 2VGCB 2Y6TA 1DSUA 1NTPA 1LCYA 1X7AC 3BIVH 3ELAH 3URCA 3LPRA 1VGCC 3Q76A 3PYHA 2ZG0H 4Y11E 2W7UA 3K9XB 4Y6DA 1EKBB 2GZ7A 4R8TB 1BZXE 2OCVB 4NNLA 2G81E 3BG4B 2EDZA 1SFIA 2A7JA 1OKXA 2AMQA 1C2MA 2QXHA 2AIPA 2FOCA 1N7FA 2EEIA 2HE2A 3R69A 2JREA 2LNCA 2R0KA 2XBYA 4X6NA 1EOLA 4WVPE 2IJOB 1QAVB 8GCHG 5JBTA 5E2OA 5G1EA 2FE5A 3GY6A 5BPEA 1G37A 1DITH 1QQUA 4AG2A 1BBRE 1O5GH 3K50A 5EXMA 1ELGA 1UTMA 2YOLA 1CHOG 4K8BA 5EPNA 2ZU5A 3M35A 3I29A 1N8OB 4FUDA 2ZU2A 1Q2WA 1V5QA 4NA9H 3AW1A 3SNDA 3PV5A 3LU9B 1FI8A 1EJMA 4X1SU 4XSKU 2HWLB 5L2YH 1UTOA 2A4QA 3STIA 1EZSC 3WKLA 2R0LA 1GL1A 1O2QA 2ZPSA 1BTWA 1BHXB 4UE7H 1NT1A 4OEPA 1TX8A 3DUXH 5GCHG 6GCHG 3K82A 1KYNA 1ARBA 2F9OA 3DFJA 3SNBA 1NESE 2DMZA 5AVDA 2NU4E 4Z8JA 1O5BB 3TU7H 1V2WT 3LH3A 1ELVA 2R3UA 1SGPE 2VWNA 3RXVA 3Q3YA 2OC8A 4O3TA 5DPAA 1OBXA 1UVTH 3UQVA 1YCPK 2EAQA 1O2HA 2NU0E 2WPKS 2FOHA 8LPRA 1PPCE 4CRFA 1QQ4A 2HLCA 1ZSKA 3JZ2B 2MHOA 4KP0A 1ARCA 2FOAA 3KF2A 1MFLA 3RM2H 2ZNKH 4IC5A 3QDOA 1WIFA 1WTHD 1XUHA 4X2WA 5EPYA 1Z8RA 2OC0A 1A0JA 1P06A 2OC1A 1O5AB 1O0DH 1ZLRA 1B5GH 1MTNC 2XBXA 3NGHA 3GY2A 1GBLA 3MHWU 1K1NA 5A2MH 2ANKH 4CRBA 3ZVCA 2YT8A 1TGBA 1HCGA 1RIWC 3A7XA 4IN1A 1C2KA 5GNDA 2ZHQH 1Y3YA 3ESTA 4U01A 1DVAH 3TIUA 2J4IA 4LOYH 1FY8E 2ZCHP 2M5TA 1P3CA 1UTJA 2F0AA 4A5TS 3MNCA 3OSYA 5F67A 1NF3C 1TX6A 3QN7A 3KL6A 5A8ZA 1M9UA 4JORA 2ZGJA 5FPYA 3SV8A 1ZRKA 3M3VA 5CHAC 3A8DA 1ZPZA 1GDUA 1TPPA 1TONA 2CMYA 3PDVA 1NY22 3AVZA 4NMOA 2FX4A 1LKAA 1W12U 1S84A 3MO9A 2OZFA 1H9LB 3A80A 1TRMA 1UF1A 2L4SA 1LDTT 3SNAA 2HRVA 2CS5A 1EPTC 1VZQH 3T62A 3EGHC 5A8YA 3RMMH 2BY5X 3SNCA 1P9SA 4Y8YA 3TITA 2EGKA 4Q2OA 3GSLA 4JYUH 2CHAB 2Q3GA 1C5NH 1GBJA 1HJAB 1V2NT 2FLRH 1JIMA 4YOIA 2BD8A 1H9HE 4AYYB 3F68H 3RXDA 1DY9A 2OUAA 2FTLE 2EV8A 1AFQC 1EASA 1XUIA 2QAAA 2Z94A 4GSOA 4Q2QA 3A7WA 2H2ZA 3I1EA 1V2LT 1ZHMA 1F5LA 2WPHS 4ZXYH 3V7TA 5L6NH 5DG6A 1YKTA 3RXLA 4MG3A 2VIDA 2QV1A 1DFPA 1TNHA 2I0IA 1UCYE 1UO6A 2ZCKP 4INLA 3N7OA 4FVDA 1MH0A 1BB0B 1SLWB 1TP5A 4Q3HA 3PWBA 1Z8GA 2BVXH 1TPSA 4MPAA 1FIZA 2GCHF 4I8KA 1V2PT 2ZGCA 1P12E 2AINA 2BOHB 1GHBG 2B7DH 1CE5A 2AGGX 5FBIA 3RM0H 2PV9B 3S69A 1HRTH 1V2RT 2AMPA 3TMHA 2EC9H 4M7GA 4KKDA 1KLTA 1D4PB 2PKAA 3CENA 1PPBH 2F9UA 3ZZ4A 3T29A 2DB5A 1TQ7B 2PKUA 2ZI2H 2NU3E 1H4WA 3GY8A 3NPSA 5FAHA 1TFXA 1G36A 4TY6A 5K7RA 1NC6A 2O8UA 1QRZA 4XBDA 2PTNA 1WV7H 3F9HA 2Z17A 1OYQA 1NM6A 1YPHC 2GCTB 2VIVA 3DJAA 3LGVA 2M0ZA 1VCPA 2KJPA 3KQBA 3MYWA 2H2BA 3UNSA 2VIPA 1A7SA 1G2LA 4WY3A 2G5MB 3FVFB 3U69H 3OY5U 2EDVA 2ALPA 2DLSA 3RXPA 2PHBA 3MNBA 4U32A 1HGTH 3P95A 2VB0A 4ZKOU 2FS9A 1HXEH 4WMEA 1YPMH 1UHPA 1HIAB 4CREA 1THPB 2B5TB 1P11E 1VITG 1S85A 1SGEE 4CR9A 2QXIA 2XCNA 3UREA 1FQ3A 3SU5A 3ZZDA 1XMNB 3GY7A 4U2WA 2I1NA 3MH6A 3GICB 2H6MA 3K65B 2DC2A 2BLQA 2KJKA 3PMAB 2G2LA 4WH6A 1Z87A 1SOZA 1F0UA 1TQ0B 5HXFA 3EA9A 2C8YB 1AO5A 1P1DA 1VGCB 1W14U 4XBBA 2YNAA 3GOVB 3E6PH 5EGMA 4ZHMU 4A7IB 3ZZ5A 1KSNA 4TPYA 3ITIA 4X1RU 2BY6X 1V6BA 2HGTH 2RCEA 2GVFA 4MNWA 3RXHA 2KOJA 1AIXH 1ZTLA 1GI0A 3ATMA 1GCTC 1WTGH 2EI7A 2FXRA 4Q2KA 1BBRH 4HOPA 3CC0A 2H3MA 1HAZB 2ZHFH 2LPRA 1F92A 4K3JA 1GBFA 1C5WB 4Y8ZA 2STAE 1ANBA 3F9EA 1AUTC 4LZ4B 3T5FH 5J4QA 3DIWA 1ELTA 1KXEA 4X1QU 1XM1A 4E7NA 3ZVAA 1SGFA 1J15A 2VGCC 3MNXA 3TLOA 1VCWA 3Q77A 1BRBE 2ZWLH 1YC0A 2FESH 2W7RA 3A7ZA 1C1TA 1O2JA 5E8EH 6CHAC 2VIOA 4B75A 4AGKA 3TVJB 1GBCA 3SGBE 3SV7A 2FYQA 3BG4C 4BAMB 2EEJA 1O34A 1C2HA 3AAUA 4JZDH 1BHXF 1W9QA 3PMHB 5IYTA 4WWYA 4ABEA 5C3NA 1HNEE 3MO3A 2HNTE 3FP8E 4NFFA 1NRQH 1T8LA 2BLOA 2AS9A 2DE8A 1ETRH 5LGOA 5EYZA 1O32A 4Y7AA 3M7TA 1O3EA 4UU5A 3UOUA 2Q6DA 3NK8A 3PV2A 3S7KB 1KXCA 4INHA 1HAPH 3BEIB 1AUJA 4JOPA 2H9TH 3GCNA 2WYJA 4H6TA 4DOQA 1D3TB 1P02A 4ZMAH 2HGAA 2ZO3H 3GY3A 2GZ8A 2HNTF 2FOEA 2GKVE 4IC6A 2ALVA 1FAXA 1MTNB 1MZDA 1V2KT 3ZVFA 2OSGA 2ZF0H 1K21H 2BXTH 1K22H 4Y8XA 3NXPA 1RIWB 5JBCS 2F3CE 2IPHA 2A5IA 1WQVH 4MLFB 2VSPA 1IQMA 3RLWH 3RXOA 1OWHA 1D6RA 2FI3E 2Q6FA 3BTKE 5FB8C 2QGRA 3DFLA 1T4VH 3BG8A 2TIOA 2EI6A 2ODPA 2IWNA 1ELDE 1Y3UA 4UU6A 4AN7A 3LGTA 4B2BA 3K1RA 2Y7ZA 1GBDA 2UZCA 1P2IA 3RXQA 1CU1A 1GHAG 4Q6HA 3F1SB 4NWLA 5CHAB 1W11U 1GMDG 3I78A 3RU4D 1L1GA 1BCUH 2FM2A 3SGAE 1QLCA 1O30A 4FUGA 3E0PB 3SJIA 5A0CA 1ANCA 2VJ1A 1EPTB 1AZ8A 1K1MA 1F5RA 3KHVA 2QKVA 4K69A 1UJVA 1AWFH 1O33A 5CMXH 1NTEA 3HK3B 1WSSH 1G2MA 5CE1A 2AWXA 2P16A 2SGAA 1DLKB 1RGQA 2KL1A 3A8BA 4ZAEA 4KFVA 8KME2 2ILNA 3UIRA 4NXRA 4OS7A 1P57B 3MNSA 1O2LA 2ASUB 3RLEA 5AFYH 1TE0A 2W5EA 2BDCA 1P04A 1PQ7A 2ZPQA 1C5LH 1UCYH 1TGCA 3FP7E 3ZVGA 4OS5A 1XXDA 3SJOA 4NSYA 1O5DH 4JOGA 2XYAA 1AB9C 4NMSA 1FPCH 4NSVA 1CHGA 3RC5A 5H3JA 3FAOA 1A5GH 1DWDH 3SJ8A 2FPZA 3D23A 3RUOA 1C5YB 1D6WA 1CA8B 3QE1A 1EP6A 2ZGXH 3M7QA 5TCCA 2HALA 2B8OH 4MPXA 1H8DH 3SV6A 1GBTA 2Y5FA 1GHWH 4ZROA 2OQ5A 4NZLA 1WF8A 2CHAC 1DXPA 1O5CB 1C2IA 1HJAC 3O8DA 1H1BA 2VVCA 2RG3A 2JH6D 3D65E 2FOMB 2G5NA 1GJ9B 5GWZA 1OSSA 2EA3A 2J95A 2QCYA 2O8LA 1K9OE 1FXYA 4F49A 1GDNA 5HGGA 1MTVA 1GI7B 2PNTA 2IOTA 5E6PB 1O2KA 4Z6AH 4Y79A 1LO6A 4ABHA 2BDHA 1PPHE 1TNJA 1RY4A 4MVNA 2QXJA 1RJXB 3BV9B 1CGHA 1AVWA 1CBWC 3B76A 3KQCA 4OS4A 2PDZA 2H2CA 3S9CA 2R4HA 3UR9A 3ZVBA 3KGPA 2G4TA 4A1XA 1THRH 1BTHH 1MMJN 3QO6A 1AMHA 2V1WA 3FANA 3TGIE 3I77A 1SFQB 1AWHB 3VQFA 4B2AA 2W26A 1GBMA 5G4BA 3DJ1A 2UUKB 1G3DA 4AG1A 1QGFA 4MPUA 5BRRE 1L6OA 1SHYA 1UEPA 4K75A 1GDQA 1K1PA 1GHYH 1C1WH 3SNEA 2CF9H 1GI1A 1N6YA 4IN2A 1GBHA 2AWWA 1F5KU 5G1DA 4HGCA 4J2YB 2FEQH 4D9RA 4DURA 1J9CH 1VITH 1SHHB 1ZYOA 5DP9A 1YPJH 2M0TA 4XBCA 3MH5A 1V2QT 5EQSA 5LPFA 1SGRE 1CO7E 4UDWH 4JZEH 3K2UA 2Z9KA 3QLPH 2XC5A 2PW8H 3GCOA 2ZCLP 1PPFE 1GWAA 4A1TA 5GJ4B 1H9IE 2BVSH 4IBLH 4TYDA 3D62A 1GMHF 4AFSA 5ESBA 1SR5C 4B1TA 1YYY1 3M5LA 4NMPA 2BQ6B 4BAKB 1EAUA 3S9BA 1ZMLA 1GCTB 5LH8A 1SLVB 3FZZA 1O37A 2PGQB 1F7ZA 3QUMP 4WYTA 1UJUA 1QBOA 1SQAA 4LMMA 1AE5A 3ATWA 4O3UA 1PYTC 1C4Y2 2J38A 3AASA 1ABIH 2DUCA 2GX4A 4D76A 2KAIA 1ZHRA 1QCPA 3LJJA 4YYXA 1C2LA 1A0LA 1KY9A 2WUCA 2QN5T 1TIOA 1E36B 1EZXC 2DAZA 1BRAA 2OLGA 2OGPA 1UEZA 1GI2A 3GY4A 4AB8A 1W7XH 1JBUH 2OQSA 3FY5A 3A83A 2ZHWH 4H6SB 2VVVA 2Z9JA 1O2MA 2QF0A 2WV5A 1UM1A 2ZFTA 3F6UH 6CHAB 3A7YA 5T6DA 1AVXA 1TBRH 2IWPA 3BTGE 4L8NA 1WU1A 2Z3EA 2EEKA 3VXEH 4AFZA 3MI4A 2ZFSA 1GJDB 3RXUA 1LQDB 1J14A 2MX6A 1GBEA 4JZIA 5H4IB 1ZJDA 5E0GA 4CHAB 3K6ZA 4NA8A 1AD8H 1K1LA 3LKWA 4GAWA 4Q6SA 2QKTA 1UMAH 2XC4A 1ZSLA 3MH7A 4BANB 5EG4A 2BD2A 3KEEA 4YO9A 1BBRK 1BTZA 3U8TH 1PPZA 2KBSA 4CH2B 5C5NA 1QA7A 2X7ZA 1J8AA 4EDJA 2PKAB 1C1PA 4WH8A 2OPGA 4JYTA 1FMGA 2ZHDA 1O3HA 1ZGVA 1O3PB 4K1SA 2VNTA 2JOAA 3L33A 2DE9A 2KYLA 1TA6A 3QZQA 2P95A 4ABJA 1C2GA 4KTSA 2KAWA 1BMLA 2H5CA 3ENSB 3BN9A 1C5UA 1HXFH 1WYKA 4P0CA 2Q1JA 4ISIH 1V2VT 2B0FA 2GD4B 1IQKA 2VWOA 4ABBA 3SU1A 1GI3A 3UNRA 1L0ZA 3MU0A 4TWWA 5DP3A 4X1PU 4A1VA 1TRNA 2O8MA 1P01A 2G4UA 2I0LA 4WXIA 1ETSH 2KJDA 1NRPH 2G52A 2ZKSA 3MO6A 3QWCH 5FBEA 1TNGA 4F4OC 1OWDA 4ABDA 3O8CA 3P8GA 4GHQA 1C1OA 2PZDA 2VWRA 3I18A 2ZEBA 4FUBA 4JOJA 2O8WA 1JRSA 1NFXA 1GJ5H 1IOEA 1OP2A 2ZDNA 3UWJH 3QDZB 3ID4A 3F9FA 3UFAA 3W94A 1TMUH 9ESTA 1GBBA 4UFDH 1T8OA 1E34B 2ESTE 1GJ8B 1MTUA 1QRXA 3LGYA 4DJZB 1L4DA 1HV7A 1G32B 2G55A 3L3TA 3TSVA 1F2SE 2BXUH 4SGBE 5FXLA 2QC2A 3E91A 1TLDA 3IWMA 2QYIA 5GXPA 1FY1A 1T31A 2A4RA 3SN8A 1TBQH 4R0IA 4NNMA 2FYRA 3EAJA 2EXGA 4DG4A 1P2OA 1UEQA 1HAIH 1AU8A 1A61H 1DLEA 2G00A 1TBZH 1G3CA 2J94A 2CF8H 3NUMA 4X2YA 4ZKNU 1GI9B 1O35A 1OOKB 1XUJA 5A2PA 4YOGA 1ESBA 2J92A 2DLUA 2D1JA 3SU2A 2PTCE 1AB9B 4HOPB 2GCHG 1C1MA 4NIXA 3LC5A 1OYTH 3TK9A 5AF9H 1UM7A 3SJ9A 3U9AH 3SORA 1O3AA 2FP7B 4B76A 1P2MA 1LVOA 3E3TA 3STJA 4RI0A 2HPPH 2XW9A 4HFPB 1MC7A 1WUNH 3SU4A 2A4OA 1NFUA 1PYTD 1GJ6A 1N6XA 1NFWA 3BPUA 4U30A 1Y5AT 5T6FA 1Y5BT 1FZZA 2FDAA 1UVPA 2THFB 1GQ5A 4JYVH 1YPHE 3ZZAA 2BQ7B 2P3UB 1CVWH 1O3MA 2XBVA 1EZUC 1WOFA 2E7KA 4IW4E 1IHTH 3MTYA 1LHFH 4MNVA 4JMYA 1Z86A 4P2AB 1Y3VA 4I8LA 5E1YA 1Z71A 4YZUA 4K78A 5EZ0A 1EAWA 3EGGC 1BJUA 2BDAA 1EP5A 1O2ZA 3RU4E 4ISLA 2Q6GA 2A7CA 1GJCB 2ZDKA 2LOBA 3L6PA 1UCYK 4ESTE 1PPGE 1U6QA 5JBBS 1CBWB 3RXBA 1SLUB 3GGEA 3GCTF 1SQOA 2RDLA 3PWCA 5L30H 4A6LA 3SOEA 4H4FA 5JB9S 1RFNA
chains in the Genus database with same CATH superfamily
1O3DA 1XXFA 1H8IH 3U8RH 5HFBA 1FY3A 1K1JA 2VU8E 2ZU3A 3A8CA 5SGAE 1ZTJA 4ISOA 4CR5A 5LPRA 1EJNA 4DVAU 2VPHA 4WJG2 1O3KA 1G30B 1XVOA 2YTWA 2XBWA 3QX5H 1LVYA 4BAHB 3URDA 2M0VA 2OCSA 2K20A 1JIRA 2ZDLA 2KRGA 3PO1C 2GT8A 1LVMA 2OBQA 5JPMH 1NFYA 1ESAA 1K1OA 3KYGA 4NIYA 9LPRA 2Z6BD 1NROH 1MCVA 4FUIA 1S0QA 7KMEH 4I33A 1WQSA 2UUYA 3T2NA 2NU2E 1HAOH 3BTWE 3CS7A 2BDGA 1DXWA 1ZZZA 4WMFA 1UHBB 2RDEA 1E1RD 4ISHH 3DJ3A 4X8SH 1O3CA 1DX5M 3F9GA 3JZ1B 3AXAA 1AZZA 2W3IA 1IQEA 3PROA 1C9TA 4OAJA 1UTKA 3GCHB 4BTTB 3V12A 2GTBA 5GLJA 2JWEA 4UEHH 2OP9A 1ZOMA 3SZEA 2FS8A 1MUEB 4UFFH 1PFXC 1ZHPA 1W7GH 2V0BA 3T26A 5CDFE 2XWAA 3RXKA 3NFKA 5LPEA 2FNEA 2BY8X 2FOFA 1BTPA 4QT8C 4TY7A 2J34A 1DM4B 1QY6A 3TJVA 1EZQA 4ZXXH 2H9EH 2F83A 3A89A 2A5KA 1ANDA 1E38B 2F9BH 1P09A 2YNBA 2OXSA 2RA3A 1QBNA 3LIWA 1DDJA 4P02A 3ZZCA 4NXPA 1WH1A 1UK3A 2OBOA 1V2MT 2G8TA 1GI8B 5GDSH 1MCTA 3ZZ9A 2YMSB 1TNKA 3A82A 1L1JA 3NFLA 2J5UA 2ZPRA 1C5TA 3RXFA 4RKJB 1YLCA 3FP6E 1O2GH 4ABFA 3PMBB 1MBMA 1C5MD 1NRNH 3TJOA 3DSOA 3DD2H 5F8TA 2F9NA 1Q7XA 4JJ3A 4GHTA 1I92A 2ZHEH 2TRMA 1IQFA 2BDIA 5E21A 1TP3A 1ZMJA 2BX4A 3VB4A 3HVQC 4E05H 2VIQA 3TJNA 1BFEA 1EJAA 4XRNA 2BM2A 2Z3CA 3S0NA 1HJ9A 2SGDE 2WPDD 1HAXB 1PQ8A 2UUJB 3BTFE 3P8FA 3Q00A 4XDEA 2VWMA 3TK6A 1HB0B 3FOAA 1D5GA 2LC7A 5DTHA 3H7TA 4Q7YA 3GJ9A 4LXBH 1P9UA 2P3TB 2W6ID 1K32A 3O8BA 4YLUA 3EQ0H 3F2HA 3RP2A 1GL0E 1AY6H 1H8ED 3P92A 3M37A 3SU3A 4JOHA 2C8XB 1AN1E 4LZ1H 2SFAA 1MTWA 2FI4E 1TABE 1FC6A 1C4U2 5I25A 1IQIA 4JOKA 2A4GA 1D9IA 1MU8B 1QB1A 1B8QA 2CN0H 1Q3PA 1C5ZB 3MWIU 1UVSH 2ZFPH 1QTFA 4X0WU 2WZQA 1O2RA 3BTEE 1C5VA 1HAHH 3S9AA 4NIWA 1QIXB 2Z3DA 4CHAC 4E34A 1QA0A 2I6VA 2JDID 4UFEH 5IDKA 4K1EA 5C5OA 1DANH 2KM0A 3M5MA 2FWWA 3MU5A 2A5AA 1FV9A 3SUFA 4BTUB 5AHGH 2CV3A 1KWAA 1JXPA 4BTIB 2R3YA 3LNYA 2AGIX 5HYOA 3RXJA 1YGCH 1YPEH 1FY4A 4K6YA 1ZPBA 4B2CA 1J17T 3E8LA 2XTTB 3ODFA 5DP4A 3SHUA 2BZAA 2TGDA 1OP8A 1TNLA 4GPGA 1O2NA 4JCNA 1V2OT 2FI5E 3DSGA 2WSSD 4BNRA 1KTSB 1BIOA 4X8UH 1GBAA 1YF4A 3FKSD 1WCZA 2VIWA 1KTTB 2W3KA 1V62A 4XE4A 1VJ9U 3OTJE 4NIVA 1QHRB 4GHNA 1V6DA 2ANWA 2UWPA 5ESTE 4I8JA 1Y59T 5L2ZH 1GMCF 1CGIE 4NMRA 1EUFA 1TALA 1AHTH 1Z8IB 1IQLA 1LHDH 1UHBA 2P94A 1MD8A 4FU8A 4J1YA 3CP7A 4DY7B 1SGCA 2XNIA 3MU8A 3SUDA 1TQ3A 3R68A 3ID3A 1SC8U 2H5DA 2OINA 4I8HA 2KOHA 2BD3A 3BTDE 3O8RA 4YM9A 4IS5A 2W6JD 4FGMA 5AFZH 1ELEE 1GG6B 3LH1A 2IWQA 1DSTA 3ID2A 2BZ6H 1R6JA 2ZFRH 5FCRA 2RRMA 1IQNA 5KEDA 5DN6D 1GJBB 3UUZA 1KXBA 3KZEA 3SQEE 1ZUBA 4RT1A 2KAIB 4FUJA 1B7XB 2EEGA 3ATIA 2J9NA 2JKHA 2PGBB 1X6DA 2EJYA 7GCHF 1ZSJA 4Q2PA 1U37A 1OWEA 7LPRA 5HF4A 4F8KA 2ZQ1A 1P1EA 1RXPA 4KFWA 3JXTA 2A2QH 4DT7B 2AEIH 2LC6A 2J2UA 4KTUA 1QNJA 2OK5A 2A2XH 4GCHF 1O3LA 3V3MA 5B6LA 4RN6A 4OEOA 1TPOA 3F0OA 4O97A 4NG9H 1G9OA 1T8NA 2TGPZ 3GYMA 1OBYA 1SQRA 3PM3A 3UR6A 1L4ZA 5EW1H 2A31A 2F9VA 2VRFA 1WAYB 1N6FA 2KA9A 2K1ZA 1A1RA 4Q80A 2G5VA 3DSPA 1WFGA 1Z8JB 2BLWA 2M10A 2L6OA 2VH0A 1MFGA 3P8NA 2YUYA 3RXSA 2GP9B 3SV2H 2G51A 2V6NA 3N7EA 4CRCA 5GPIB 1RRKA 1SPJA 3UNQA 3UQOA 5HFEA 1C5SA 1RGRA 5J4SA 2OTVA 1O2OA 3EA8A 1T32A 1Y7NA 3OX7U 2W7SA 2C8ZB 1FN6A 1BQYA 1SGDE 2FLBH 2XOKD 4LK4A 4MNXA 1FJSA 1N6EA 1RZXA 2BY9X 3VG8A 1NRRH 4PROA 2ZDVH 2JXOA 1SG8B 1FPHH 2ZFFH 1ELAA 3KQ5A 4B71A 2QY0B 3Q3KA 1C5PA 2IWOA 3ATKA 3QTVH 1ID5H 3SZNA 2KCOA 4AZ2B 1YPLH 3MU1A 2ZU4A 2GZ9A 3BEUA 1C5XB 3LONA 1IQJA 2QF5A 1DUEA 3PO1B 3LDXH 1Y5UT 1SMFE 3ODDA 1THSH 2BYAX 1YPGH 3QK1A 1RD3B 3OU0A 2AGEX 2A0QB 3RXMA 1GHXH 1W3CA 5T6GA 1QRWA 3AW0A 3OE7D 3RXEA 4GLYA 2FMJA 1CT0E 3VB5A 2DJTA 1GMHG 3D49H 1MTSA 4REYA 1EOJA 1EXFA 5A0AE 1Q3XA 2CXVA 1C9PA 2YT7A 1PDRA 1O3JA 4NMVA 3ID1A 1D3PB 3CBXA 1Z6JH 4NGAH 5CHBA 4OS2A 3HKJB 1MU6B 4AOQA 2ZC9H 3A88A 5EJZA 2KOMA 2KX4A 2PUXB 2VVUA 5PTPA 1NN6A 3QZRA 4I8GA 6LPRA 4YLQH 3KYFA 3AAVA 1IU2A 3BTQE 5DP7A 4TSFD 4ZKSU 7ESTE 2SGFE 2ZA5A 1C1RA 1NO9H 1AE8H 3O46A 4NMQA 1QJ1B 2FODA 3A8AA 1SB1H 2Y80A 2Q9VA 3DORA 1XUFA 3W95A 3E0NB 1Q31A 3UY9A 5C1UA 2H1UA 2V3OH 2OC7A 3BTTE 4BXSA 1A3EH 1O2VA 2HE4A 1BT7A 1W9EA 1FAKH 2Z9LA 2AFQB 3C1KA 1SKYE 4GVCA 1KXDA 1UK4A 2VSVA 1ELBA 2I04A 1TOMH 2KG2A 3A86A 1TRYA 2EEHA 1E0FD 1N1LA 2BHGA 1NU7B 3PLKA 5ETXA 4D9QA 1A5IA 4AB9A 4Z0KA 3TGKE 3VB3A 1VJAU 3GCHC 4AMHA 2VWLA 5C1XA 2AMDA 3NRLA 1QURH 1F0TA 1MZAA 4FOUC 1YP9A 4Y76A 1VKYA 3UWIA 4ASHA 2FOGA 1SGYE 1S6HA 4X8TH 2A45B 1FY5A 3QTOH 4RKOB 1IU0A 2RCZA 5EQRA 2HPQH 1O38A 1P05A 1QB6A 4K1TA 4YXWD 5EJ1A 1UEWA 1AKSA 2GGVB 3ZVEA 2OQUA 1C1QA 4YOJA 2ZTYA 4DW2U 3HKIB 2KR7A 2RFKC 1S0RA 3SHAH 1SSXA 5HIYA 3CYYA 1KDQA 2ANMH 1S6FA 2D8IA 3H5CB 1LKBA 2SGEE 5HMAA 3ZZ6A 4MNYA 1GM1A 1FN8A 1RTKA 5HFFA 4JZFH 4TPIZ 1PPEE 1WI4A 4WF8A 3E17A 4Y71A 4CBOA 1C2EA 2CSJA 1S83A 1NPMA 4FLNA 1C2FA 4FUFA 1CGJE 3OYPA 3MOCA 2Y81A 1O3BA 3HPMA 2V3HH 5HEBA 1AI8H 2P93A 3B23B 5HEDA 2A7HA 3U98H 4F48B 5C0UA 1MKXH 1DWCH 4IMZA 4K8YA 2QKUA 1W13U 1XVMA 3L4FD 4KELA 1C1NA 4MPWA 4PQWA 2FOBA 2PKSC 1TMTH 2WPLS 3ZVDA 2M0UA 4X6PA 1P10A 1HBTH 2FO9A 1W9OA 3NWUA 3ZZ7A 3EE0B 3VB7A 1C4V2 4DT4A 4I7YH 1Z1IA 3VPKA 5F6MA 2Z7FE 4JOFA 4MDSA 3TSWA 3KIDU 2K1QA 2EGNA 3SUZA 2F9PA 3HPTB 1UVUH 1FDPA 1KIGH 1OZIA 2BD5A 3A85A 4O03A 1VCQA 3SU0A 3MH4A 2BX3A 1A5HA 1WXRA 1N7EA 1HJ8A 1VB7A 1DS2E 1GHVH 1RTFB 4ISNA 1PQ5A 3QGLA 1L1NA 1WHAA 1YPKH 3EGKH 3F2FA 3P8OA 1RGWA 2D92A 1SGTA 3RXTA 2A1DB 3GISB 1FUJA 1C2JA 3QGNB 3WY8A 3M5OA 4XFQA 5HM9A 1SQTA 1O3FA 2QBWA 3FZDA 2LELA 1U38A 3RC6A 2FX6A 3PMJA 4CBNA 1OXGA 4DIIH 4TWYA 2P8OB 1ZGIA 2LUIA 2P3FH 3P70B 1KEFA 4ABAA 1O39A 3ATLA 1BMMH 2C93B 3QGJA 5DO4H 6ESTA 1DPOA 1XKBC 2EQNA 2CSSA 5HF1A 1YCPM 3BTME 3ZZ3A 4AX9H 2C8WB 4JOEA 3A7VA 5K0HA 2I6SA 2UWLA 2BOKA 2O2TA 2BDBA 2D90A 1TGTA 1SOTA 8GCHF 1ZPCA 3E90B 1GJ7B 3RU4T 1MKWH 2TPIZ 3BEFB 2AHME 1MAXA 2PKTA 3E1XB 1CHOF 2GMTC 4G69A 1NZQH 5FPSA 1XZ9A 2XCFA 2YUBA 4VGCB 2C3SA 1BUIA 2L97A 2WINI 3SU6A 4AYVB 1P0SH 3T27A 3B8JA 4MQAA 1GBIA 1BA8B 1W0JD 2BD4A 3H7OA 1GI5A 4X8VH 1W8BH 1LHCH 3BSQA 1BRCE 1GVLA 1RTLA 2I6QA 2SNWA 4FXGH 3GCTG 3GY5A 1GG6C 3LNXA 1KLJH 1W2KH 2GEFA 5GCHF 3RXGA 6GCHF 2ANYA 5DK1A 2SNVA 2H9HA 1VJ6A 1Y3XA 2BB4A 3KN2A 5HJ1A 1YLDA 1P2NA 1GPZA 4JK6A 3UAIC 3UOPA 1C1SA 2REYA 1V2UT 3TH2H 3ZZ8A 4CH8B 1WDIA 1QAUA 4KGAA 4JL7A 3KQDA 4Z33A 3M3TA 1ELCA 3U1IB 3LT3A 3BTHE 3ZV9A 1TOCB 1EB2A 2EI8A 1YBWA 1J16A 2XC0A 1WFVA 1DICA 1MQ6A 4IGDA 4Y10E 5F8ZA 1FX0B 1FC9A 2AH4X 1HUTH 3RC4A 4X1NU 1C1UH 5HDYA 1D3QB 3QIKA 1C5RA 3A81A 3PDZA 1BMAA 1YM0A 1DWEH 2AERH 1O2YA 4ZHLU 2EHRA 2ZU1A 1IHSH 1QL7A 1SVPA 2EGOA 2OMJA 1NS3A 1KMHB 2DM8A 1GGDB 1T8MA 2ODYB 2KQFA 1QL8A 4MTBA 2NWNA 3NZIA 2QA9E 1HAVA 1AFEH 3M7UA 1SI5H 3HGPA 3SUEA 2XWBI 1GVZA 2BDYA 1GCDA 1WBGB 4AORA 2BTCE 4D8NA 3IG6B 1A0HB 4ZKRU 3PLBA 4D7GA 4ZUHA 2KPLA 4K5ZA 1A2CH 2CJIA 3U8OH 1Q3OA 3VQGA 4D7FA 5A0BA 1N6DA 1PQAA 5EU8A 1DOJA 3UPEA 1FIWA 4ZH8A 5FPTA 1IAUA 4DCDA 5IK2D 2PSYA 4OGXA 1CA0C 1CT2E 3K6YA 1KLIH 4X6MA 4O06A 2QF3A 5EXNA 4Q7XA 1V2JT 1P3EA 3TK5A 3RXIA 2FZZA 3OTPA 3P17H 5C17A 4FUCA 1QAVA 5E0HA 3FFGA 2Y7XA 2BY7X 3N7DA 2J98A 2ENOA 1WJLA 1O2IA 1BMFD 1AGJA 1UW7A 1DUAA 2QG1A 2KPKA 5KECA 4FU9A 1AQ7A 4AC9A 2GT7A 4HTCH 3GS9A 3GYLB 2ZIQH 2JETC 4NZQA 5F8XA 1BITA 2EDPA 3SJKA 4H42U 2ZTXA 2KCYA 2OS6A 1VR1H 1DWBH 3V0XA 3PTNA 1E37B 2WYGA 3EYDA 2JINA 4XHVA 4H11A 2C90B 1KXAA 4Q2NA 1B0EA 1QB9A 1X5QA 1X5NA 4TT3D 5ILBA 2PUQH 4YESB 2FTMA 1G3BA 3ZYDA 4ZCNA 1JRTA 1OBZA 5I7ZA 3VGCC 2O9QA 1QL9A 1LVBA 5EXLA 4CRDA 5C67A 1X45A 1GHBF 1TMBH 1O2XA 4ABIA 2AWUA 3PTBA 1T7CA 2GZVA 1UTPA 3AK5A 5HETA 1MAYA 1GHZA 3IITA 4DGJA 1O31A 1LHGH 5DP8A 3ZZBA 1UITA 1HAGE 4Y0ZE 1FONA 5T1VA 5FL7D 1O5FH 1HPGA 1S81A 1V5LA 2UUFB 2Y5GA 5DSFA 2TGTA 1VA8A 4BOHA 1GI4A 3SUGA 4NMTA 1SLXB 2NU1E 2JIKA 5JXBA 2QIQA 2P59A 2R2MB 3F3BA 3V13A 4N6XA 1LMWB 2OD3B 2PKSB 1B0FA 3KZDA 5HFDA 2SGPE 4RSPA 3SHCH 2A32A 1MQ5A 1GJ4H 1H8HD 4FUHA 2ZECA 3RMLH 1UJ1A 3LGIA 1N7TA 1CQQA 1AVGH 3SOSA 3TH4H 2PR3A 1JOUB 3VEQB 2B9LA 2I4SA 4FU7A 1LTOA 1DY8A 2ZZUH 1VITF 5TCAA 5B6OA 4IMQA 4MPVA 3I4WA 1ORFA 3LJOA 1C2DA 4YDPA 1GMCG 1W0ZU 3TSZA 1YBOA 1UTNA 2WL7A 1EB1H 1ZRBA 1HFDA 4NA7A 3W1EA 4GVUA 1KXFA 1ZJKA 3BIUH 1SGQE 3CBYA 1QFKH 8ESTE 1SL3A 1C5QA 1IQGA 1FNIA 3A87A 3RDZA 1A4WH 1ETTH 1Z1JA 2HLDD 3GABA 4Y7BA 4FVBA 1MKXK 3LC3A 4JK5A 1P2KA 1UTQA 3PLPA 5F53A 3SGQE 2P3WA 1BMNH 4AGJA 3T25A 4ACBA 1EAIA 3MU4A 1INCA 2D8WA 1QJ6B 4NXQA 2JSNA 4E35A 1YCPH 3EDXB 2VZ5A 3RLYH 2PFEA 1EFRD 3KNXA 4BAQB 3TH3H 3SI4H 7GCHG 1BJVA 4OS6A 1G3EA 2XXLA 1O3OA 5TJXA 1Z7KA 2L4TA 3KQEA 1BTYA 1PJPA 2JILA 3NCLA 1OWIA 5JDUB 4GCHG 1O2TA 1P2JA 2ZDMA 1N8OC 1SGFG 2ZPMA 1MD7A 1U39A 2GMTB 2Y82A 1O5EH 4E06H 1V1TA 3SFJA 1O3IA 3DT0H 3HATH 4K76A 5GIBA 2GDDA 2H3LA 1GI6A 2BD9A 1F0RA 2KCPA 3RMOH 3SW2B 2TBSA 3MFJA 3RXRA 1TYNA 2WPIS 1DT2A 3Q3XA 2P8OC 3NCVA 1ELFA 1NRSH 1A46H 1XUGA 3SQHE 4R2ZA 2QT5A 4X6OA 1GJAB 4NCYA 2ULLA 2F4LA 3M5NA 1AKSB 5C20A 2BYGA 4GVDA 2R9PA 3R3GB 1WHDA 2ODQA 1W0YH 4BAOB 5E0JA 2PLXA 1HLTH 3GDUA 2WPMS 5D13A 5DKMA 2PSXA 1KDQB 5C1YA 3TJUA 3TPIZ 2SGQE 2QXGA 3SHWA 1O36A 2HNTC 2FIRH 4JZ1A 3SV9A 3HK6B 5DJ7A 4K2YA 4CRAA 1MKWK 4O9VA 1HIAA 3PB1E 4VGCC 1WG6A 1K28D 2ZGBH 1XKAC 2R2WU 1Y8TA 1OWKA 3RL8A 4THNH 2F91A 5A8XA 1O2SA 2C4FH 4X2VA 1UJDA 1IHJA 1OPHB 5FX6A 2VH6A 1ESTA 3OAAD 4WMDA 1O2PA 1HAYB 4CRGA 4WYUA 5EW2H 3SI3H 5JYIA 2V7QD 2UWOA 2Z9IA 2ZPLA 4AFQA 1ACBE 1AFQB 2V90A 3M61U 1P03A 1SGNE 1TNIA 4A92A 1TB6H 2D26C 1ZOKA 2STBE 3VB6A 2TGAA 1BOQA 1ZTKA 5F03A 1RS0A 4I32A 1LHEH 2GV7A 2JJ1D 4B73A 3LGUA 5ABWA 1IQHA 3TNTA 2F5YA 1ABJH 3O5NA 1CA0B 1GVKB 1T4UH 2O8TA 5EODA 1EAXA 2CGAA 1GHAF 5T3HA 2DKRA 3CBZA 1GMDF 3CS0A 4FUEA 3PS4A 1TGNA 5HEYA 3OFND 1W10U 4SGAE 5HIZA 1A3BH 1P8VC 4DIHH 2BD7A 5DP6A 2BVRH 5FHTA 3ZRTA 3KCGH 2PA1A 3UTUH 2BLVA 4K72A 3RL7A 1BDAA 4ZHAA 1UVOA 4AFUA 1GGDC 3RXAA 3U1JB 2IN2A 1TX7A 1LPKB 1CT4E 1F0SA 1SGIB 3G01A 3ZYEA 1V2TT 2JETB 1UK2A 1UTLM 4UONA 1BTUA 1O3NA 2PWXA 3A7TA 3SBKA 1T2MA 1OS8A 3ZV8A 1K1IA 3R0HA 3DHKH 1TAWA 1V2ST 1L2EA 1K2I1 5FCKA 3FN8A 2HVXA 1Z6EA 2XRCA 1BTXA 1C5OH 2RA0A 1P2QA 5JB8S 3R0FA 4E3BA 3WKMA 1I16A 1LPZB 1TA2A 4UD9H 2AYWA 3M36A 3LOXA 5DGJA 1E35B 2WUBA 5EQQA 5C2ZA 1O2UA 5DP5A 1WI2A 1O2WA 3VGCB 1QBVH 3MMGA 3PRDA 1BRUP 1ZR0A 5B42A 2LA8A 1HDTH 1NU9A 5JBAS 2Y5HA 4Q63A 4Q7ZA 1S82A 3LGWA 4OGYA 1U3BA 4I31A 2ZFQH 5EOKA 1HYLA 1MBQA 5E22A 1SBWA 2LP6A 4E7RG 3GDSA 2BMGB 2ZDAH 2GDEH 1D3DB 2M3MA 1S5SA 2ZTZA 3CH8A 1VAEA 2W4FA 1QR3E 2KV8A 1DE7H 2WPJS 1GBKA 5A09A 5FX5A 1XUKA 2FN5A 4OS1A 4INKA 2ZGHA 1FLEE 3OY6U 4YT7H 4UFGH 1M5ZA 1JWTA 1OP0A 2CK3D 2GCTC 4WXVA 3RMNH 4BXWA 2Z9GA 4B74A 3C27B 2JIZD 1FCFA 5F3XA 4NFEA 2V35A 5I46H 1GQ4A 3A84A 1EATA 5E2PA 1XX9A 3P6ZB 3PV4A 1X5RA 3SO3A 3GDVA 4K60A 4YTAA 3QJNA 1ANEA 3KHFA 2JH5D 2WV4A 1FC7A 1Y3WA 4YT6H 3E16B 2JH0D 3HPKA 1QJ7B 5C94A 4KTCA 3B9FH 3S7HB 3VXFH 3EE7A 3HGNA 2FCFA 1BE9A 3QJMA 3VFEA 5E11A 1C1VH 3BF6H 2AIQA 4X2XA 1G9IE 5HM2A 4ABGA 1EQ9A 1O3GA 1LQEA 3M3SA 3RXCA 3TNSA 3TGJE 2VINA 2D2DA 1V3XA 4XOJA 1TGSZ 1EX3A 4HZHA 1JMOH 4Y0YE 2HOBA 1UFXA 3EA7A 1CSOE 3NKKA 1OWJA 4NWKA 1N99A 1WF7A 3OEED 4GUXA 1OX1A 1EPTA 2ZQ2A 3T28A 2GV6A 3DA9B 2ZP0H 1LPGB 1TPAE 2BQWB 1HAVB 1TWXB 4HI3A 1X8SA 5HFCA 1ZMNA 2VGCB 2Y6TA 1DSUA 1NTPA 1LCYA 1X7AC 3BIVH 3ELAH 3URCA 3LPRA 1VGCC 4M9FA 3Q76A 1MABB 3PYHA 2ZG0H 4Y11E 2W7UA 3K9XB 4Y6DA 1EKBB 2GZ7A 4R8TB 1BZXE 2OCVB 4NNLA 2G81E 3BG4B 2EDZA 1SFIA 2A7JA 1OKXA 2AMQA 1C2MA 2GJGA 2QXHA 2AIPA 2FOCA 1N7FA 2EEIA 2HE2A 3R69A 2JREA 2LNCA 2R0KA 2XBYA 4X6NA 1EOLA 1E79D 4WVPE 2IJOB 1QAVB 8GCHG 5JBTA 5E2OA 5G1EA 2FE5A 3GY6A 5BPEA 1G37A 2J98B 3PRBA 1DITH 1QQUA 4AG2A 1BBRE 1O5GH 3K50A 5EXMA 1ELGA 1UTMA 2YOLA 1CHOG 4K8BA 5EPNA 2ZU5A 3M35A 3I29A 1N8OB 4FUDA 2ZU2A 1Q2WA 1V5QA 4NA9H 3AW1A 3SNDA 4ASUD 3PV5A 3LU9B 1FI8A 1EJMA 4X1SU 2EY4C 4XSKU 2HWLB 5L2YH 1UTOA 2A4QA 3STIA 1EZSC 3WKLA 2R0LA 1GL1A 1O2QA 2ZPSA 1BTWA 1BHXB 2QF4A 4UE7H 1NT1A 4OEPA 1TX8A 3DUXH 5GCHG 6GCHG 3K82A 1KYNA 1ARBA 2F9OA 1OHHD 3DFJA 3SNBA 1NESE 2DMZA 5AVDA 2NU4E 4Z8JA 1O5BB 2KFWA 2WV9A 3TU7H 1V2WT 3LH3A 1ELVA 2R3UA 1SGPE 2VWNA 3RXVA 3Q3YA 2OC8A 4O3TA 5DPAA 1OBXA 1UVTH 3UQVA 1YCPK 2EAQA 1O2HA 2NU0E 2WPKS 2FOHA 8LPRA 1PPCE 4CRFA 1QQ4A 2HLCA 1ZSKA 3JZ2B 2MHOA 4KP0A 1ARCA 2FOAA 3KF2A 1MFLA 3RM2H 2ZNKH 4IC5A 3QDOA 1WIFA 1WTHD 1YY3A 1XUHA 4X2WA 5EPYA 1Z8RA 2OC0A 1A0JA 1P06A 2OC1A 1O5AB 1O0DH 3ZIAD 1ZLRA 1B5GH 1MTNC 2XBXA 3NGHA 3GY2A 1GBLA 3MHWU 1K1NA 5A2MH 2ANKH 4CRBA 3ZVCA 2YT8A 1TGBA 1HCGA 1RIWC 3A7XA 4IN1A 1C2KA 5GNDA 2ZHQH 1Y3YA 3ESTA 4U01A 1DVAH 3TIUA 2J4IA 4LOYH 1FY8E 2ZCHP 2M5TA 1P3CA 1UTJA 2F0AA 4A5TS 3MNCA 3OSYA 5F67A 1NF3C 1TX6A 3QN7A 3KL6A 5A8ZA 1M9UA 4JORA 2ZGJA 5FPYA 3SV8A 1ZRKA 3M3VA 5CHAC 3A8DA 1ZPZA 1GDUA 1TPPA 1TONA 2CMYA 3PDVA 1NY22 3AVZA 4NMOA 2FX4A 1LKAA 1W12U 1S84A 3MO9A 2OZFA 1H9LB 3A80A 5HKKD 1TRMA 1UF1A 2L4SA 1LDTT 3SNAA 3FO8D 2HRVA 2CS5A 1EPTC 1VZQH 3T62A 3EGHC 5A8YA 3RMMH 2BY5X 3SNCA 1P9SA 4Y8YA 3TITA 2EGKA 4Q2OA 3GSLA 4JYUH 2CHAB 2Q3GA 1C5NH 1GBJA 1HJAB 1V2NT 2FLRH 1JIMA 4YOIA 3SYJA 2BD8A 1H9HE 4AYYB 3F68H 3RXDA 1DY9A 2OUAA 2FTLE 2EV8A 1AFQC 1NBMD 1EASA 1XUIA 2QAAA 2Z94A 4GSOA 4Q2QA 3A7WA 2H2ZA 3I1EA 1V2LT 1ZHMA 1F5LA 2WPHS 4ZXYH 3V7TA 5L6NH 5DG6A 1YKTA 3RXLA 4MG3A 2VIDA 2QV1A 1DFPA 1TNHA 2I0IA 1UCYE 1UO6A 2ZCKP 4INLA 3N7OA 4FVDA 1MH0A 1BB0B 1SLWB 1TP5A 4Q3HA 3PWBA 1Z8GA 2BVXH 1TPSA 4MPAA 1FIZA 2GCHF 4I8KA 1V2PT 2ZGCA 1P12E 2AINA 2BOHB 1GHBG 2B7DH 1CE5A 2AGGX 5FBIA 3RM0H 2PV9B 3S69A 1HRTH 1V2RT 2AMPA 3TMHA 2EC9H 4M7GA 4KKDA 1KLTA 1D4PB 1E1QD 2PKAA 3CENA 1PPBH 2F9UA 3ZZ4A 3T29A 2DB5A 1TQ7B 2PKUA 3CNRA 2ZI2H 2NU3E 1H4WA 3GY8A 3NPSA 5FAHA 1TFXA 1G36A 4TY6A 5K7RA 1NC6A 2O8UA 1QRZA 4XBDA 2PTNA 1WV7H 3F9HA 2Z17A 1OYQA 1NM6A 1YPHC 2GCTB 2VIVA 3DJAA 3LGVA 2M0ZA 1VCPA 2KJPA 3KQBA 3MYWA 2H2BA 3UNSA 2VIPA 1A7SA 1G2LA 4WY3A 2G5MB 2KZ4A 3FVFB 3U69H 3OY5U 2EDVA 2ALPA 2DLSA 3RXPA 2PHBA 3MNBA 4U32A 1HGTH 3P95A 2VB0A 4ZKOU 2FS9A 3WW7A 1HXEH 4WMEA 1YPMH 1UHPA 1HIAB 4CREA 1THPB 2B5TB 1P11E 1VITG 1S85A 1YLNA 1SGEE 1YWUA 4CR9A 2QXIA 2XCNA 3UREA 1FQ3A 3SU5A 3ZZDA 1XMNB 3GY7A 4U2WA 2I1NA 3MH6A 3GICB 2H6MA 3K65B 2DC2A 2BLQA 2KJKA 2XNDD 2G2LA 3PMAB 4WH6A 1Z87A 1SOZA 1F0UA 1TQ0B 5HXFA 3EA9A 2C8YB 1AO5A 1P1DA 1VGCB 1W14U 4XBBA 2YNAA 3GOVB 3E6PH 5EGMA 4ZHMU 4A7IB 3ZZ5A 1KSNA 4TPYA 3ITIA 4X1RU 2BY6X 1V6BA 2HGTH 2RCEA 2GVFA 4MNWA 3RXHA 2KOJA 1AIXH 5KGOA 1ZTLA 1GI0A 3ATMA 1GCTC 1WTGH 2EI7A 2FXRA 4Q2KA 1BBRH 4HOPA 3CC0A 2H3MA 1HAZB 2V3MA 2LPRA 2ZHFH 1F92A 4K3JA 1GBFA 1C5WB 4Y8ZA 3MQKC 2STAE 1ANBA 3F9EA 1AUTC 4LZ4B 3T5FH 5J4QA 4F55A 3DIWA 1ELTA 1KXEA 4X1QU 1XM1A 4E7NA 3ZVAA 1SGFA 1J15A 2VGCC 3MNXA 3TLOA 1VCWA 3Q77A 4B6FA 1BRBE 2ZWLH 1YC0A 2FESH 2WHXA 2W7RA 3A7ZA 1C1TA 4OM9A 1O2JA 5E8EH 6CHAC 2VIOA 4B75A 4AGKA 3TVJB 1GBCA 3U28C 3SGBE 3SV7A 2FYQA 3BG4C 4BAMB 2EEJA 1O34A 1C2HA 3AAUA 4JZDH 1BHXF 1W9QA 3PMHB 5IYTA 4WWYA 4ABEA 5C3NA 1HNEE 3MO3A 2HNTE 3FP8E 4NFFA 1NRQH 1T8LA 2BLOA 2VBCA 2AS9A 2DE8A 1ETRH 5LGOA 5EYZA 1O32A 3OEHD 4Y7AA 3M7TA 1O3EA 4UU5A 3UOUA 2Q6DA 3NK8A 3PV2A 3S7KB 1KXCA 1X9ZA 4INHA 1HAPH 3BEIB 1AUJA 4JOPA 2H9TH 3GCNA 2WYJA 4H6TA 4DOQA 1D3TB 1P02A 4ZMAH 2HGAA 2ZO3H 3GY3A 2GZ8A 2HNTF 2FOEA 2GKVE 4IC6A 2ALVA 1FAXA 1MTNB 1MZDA 1V2KT 3F2GA 3ZVFA 2OSGA 2ZF0H 1W0KD 1K21H 2L74A 2BXTH 1K22H 3KDGA 4Y8XA 3NXPA 1RIWB 5JBCS 2F3CE 2IPHA 2A5IA 1WQVH 4MLFB 2VSPA 1IQMA 3RLWH 3RXOA 1OWHA 1D6RA 2FI3E 2Q6FA 3BTKE 5FB8C 2QGRA 3DFLA 1T4VH 3BG8A 4HG6A 5EJLA 2TIOA 2EI6A 2ODPA 2IWNA 1ELDE 1Y3UA 4UU6A 4AN7A 3LGTA 4B2BA 3K1RA 2Y7ZA 1GBDA 2UZCA 1P2IA 3RXQA 1CU1A 1GHAG 4Q6HA 3F1SB 4NWLA 5CHAB 1W11U 1GMDG 3I78A 3RU4D 1L1GA 1BCUH 2FM2A 3SGAE 2IPQX 1QLCA 1O30A 4FUGA 3E0PB 3SJIA 5A0CA 1ANCA 2VJ1A 1EPTB 1AZ8A 1K1MA 1F5RA 3KHVA 2QKVA 4K69A 1UJVA 1AWFH 1O33A 5CMXH 1NTEA 3HK3B 1WSSH 1G2MA 5CE1A 1S6LA 2JJ2D 2AWXA 2P16A 2SGAA 1DLKB 1RGQA 4I86A 2KL1A 3A8BA 4ZAEA 4KFVA 8KME2 2ILNA 3UIRA 4NXRA 4OS7A 1P57B 3MNSA 1O2LA 2ASUB 4RT0A 3RLEA 5AFYH 1TE0A 2W5EA 2BDCA 5EIYA 1P04A 1PQ7A 2ZPQA 1C5LH 1UCYH 1TGCA 3FP7E 3ZVGA 5IL9A 1XXDA 4OS5A 3SJOA 4NSYA 1O5DH 4JOGA 2XYAA 1AB9C 4FETA 4NMSA 1FPCH 4NSVA 1CHGA 3RC5A 5H3JA 3FAOA 1A5GH 1DWDH 3SJ8A 2FPZA 3D23A 3RUOA 1C5YB 1D6WA 1CA8B 3QE1A 1EP6A 2K0QA 2ZGXH 3M7QA 5TCCA 3WWBA 2HALA 2B8OH 4MPXA 1H8DH 3SV6A 1QZ8A 1GBTA 2Y5FA 1GHWH 4ZROA 2OQ5A 4NZLA 1WF8A 2CHAC 1DXPA 1O5CB 1C2IA 1HJAC 3O8DA 1H1BA 2VVCA 2RG3A 2JH6D 3D65E 2FOMB 2G5NA 1GJ9B 1COWD 5GWZA 1OSSA 2EA3A 2J95A 2QCYA 2O8LA 1K9OE 1FXYA 4F49A 1GDNA 5HGGA 1MTVA 1GI7B 2PNTA 2IOTA 5E6PB 1O2KA 4Z6AH 4Y79A 1LO6A 4ABHA 2BDHA 1PPHE 1TNJA 1RY4A 4MVNA 2QXJA 1RJXB 3BV9B 1CGHA 4P00A 1AVWA 1CBWC 3B76A 3KQCA 4OS4A 2PDZA 2H2CA 3S9CA 2R4HA 3UR9A 3ZVBA 3KGPA 2G4TA 4A1XA 1THRH 1BTHH 1MMJN 3QO6A 1AMHA 2V1WA 3FANA 4XD7D 3TGIE 3I77A 1SFQB 1AWHB 3VQFA 3WWFA 4B2AA 2W26A 3UB0A 1GBMA 4Z1MD 5G4BA 3DJ1A 2UUKB 1G3DA 4AG1A 1NBME 1QGFA 4MPUA 5BRRE 1L6OA 1SHYA 1UEPA 4K75A 1GDQA 1K1PA 1GHYH 1C1WH 3SNEA 2CF9H 1GI1A 1N6YA 4IN2A 1GBHA 2AWWA 1F5KU 5G1DA 4HGCA 4J2YB 2FEQH 4D9RA 4DURA 1J9CH 1VITH 1SHHB 1ZYOA 5DP9A 1YPJH 2M0TA 4XBCA 3MH5A 1V2QT 5EQSA 5LPFA 1SGRE 1CO7E 4UDWH 4JZEH 3K2UA 2Z9KA 3QLPH 2XC5A 2PW8H 3GCOA 2ZCLP 1PPFE 1GWAA 4A1TA 5GJ4B 1H9IE 2BVSH 4IBLH 5C0TA 4TYDA 3D62A 1GMHF 2J97A 4AFSA 5ESBA 1SR5C 4ACAA 4B1TA 1YYY1 3M5LA 4NMPA 2BQ6B 4BAKB 1EAUA 3S9BA 1ZMLA 1GCTB 5LH8A 1SLVB 3FZZA 1O37A 2PGQB 1F7ZA 3QUMP 4WYTA 1UJUA 1QBOA 1SQAA 4LMMA 1AE5A 3ATWA 4O3UA 1PYTC 1C4Y2 2J38A 3AASA 1ABIH 2DUCA 2GX4A 4D76A 2KAIA 1ZHRA 1QCPA 3LJJA 4YYXA 1C2LA 1A0LA 1KY9A 2WUCA 2QN5T 1TIOA 1E36B 1EZXC 2DAZA 1BRAA 2OLGA 2OGPA 1UEZA 1GI2A 3GY4A 4AB8A 1W7XH 1JBUH 2OQSA 3FY5A 3A83A 2ZHWH 4H6SB 2YMSC 2VVVA 2Z9JA 1O2MA 2QF0A 2WV5A 1UM1A 2ZFTA 3F6UH 2PP6A 6CHAB 3A7YA 5T6DA 1AVXA 1TBRH 2IWPA 3BTGE 4L8NA 3N99A 1WU1A 2Z3EA 2EEKA 3VXEH 4AFZA 3MI4A 2ZFSA 1GJDB 3RXUA 1LQDB 1J14A 2MX6A 1GBEA 4JZIA 2IJD1 5H4IB 1ZJDA 4B6EA 5E0GA 4CHAB 3K6ZA 4NA8A 1AD8H 1K1LA 3LKWA 4GAWA 4Q6SA 2QKTA 1UMAH 2XC4A 1ZSLA 3MH7A 4BANB 5EG4A 2BD2A 3KEEA 4YO9A 1BBRK 1BTZA 3U8TH 1PPZA 2KBSA 4CH2B 5C5NA 1QA7A 2X7ZA 1J8AA 4EDJA 2PKAB 1C1PA 4WH8A 2OPGA 4JYTA 1FMGA 2ZHDA 1O3HA 1ZGVA 1O3PB 4K1SA 2VNTA 2JOAA 3L33A 2DE9A 2KYLA 1TA6A 3QZQA 2P95A 4ABJA 1C2GA 4KTSA 2KAWA 1BMLA 2H5CA 3ENSB 3BN9A 1C5UA 1HXFH 1WYKA 4P0CA 3F0PA 2Q1JA 4ISIH 1V2VT 2B0FA 2GD4B 1IQKA 2VWOA 4ABBA 3SU1A 1GI3A 3UNRA 1L0ZA 3MU0A 4TWWA 5DP3A 4X1PU 4A1VA 1K0HA 1TRNA 2O8MA 1P01A 2G4UA 2I0LA 4WXIA 1ETSH 2QE7D 2KJDA 1NRPH 2G52A 2ZKSA 3MO6A 3QWCH 5FBEA 1TNGA 4F4OC 1OWDA 4ABDA 3O8CA 3P8GA 4GHQA 1C1OA 2PZDA 2VWRA 3I18A 2ZEBA 4FUBA 4JOJA 2O8WA 3H09A 1JRSA 1NFXA 1GJ5H 1IOEA 1OP2A 2ZDNA 3UWJH 3QDZB 3ID4A 3F9FA 3UFAA 3W94A 1TMUH 9ESTA 1GBBA 4UFDH 2K8IA 1T8OA 1E34B 2ESTE 4JJ0A 1GJ8B 1MTUA 1QRXA 3LGYA 4DJZB 1L4DA 1HV7A 1G32B 2G55A 3L3TA 3TSVA 1F2SE 2BXUH 4SGBE 5FXLA 2QC2A 3E91A 1TLDA 3KDKA 3IWMA 2QYIA 5GXPA 1FY1A 1T31A 2A4RA 3SN8A 1TBQH 4R0IA 4NNMA 2FYRA 3EAJA 2EXGA 4DG4A 1P2OA 1UEQA 1HAIH 1AU8A 1A61H 1DLEA 2G00A 1TBZH 1G3CA 2J94A 2CF8H 2HVYB 3NUMA 4X2YA 4ZKNU 1GI9B 1O35A 1OOKB 1XUJA 3DCLA 5A2PA 2F43B 4YOGA 1ESBA 2J92A 2DLUA 2D1JA 3SU2A 2PTCE 1AB9B 4HOPB 2GCHG 1C1MA 4NIXA 3LC5A 1OYTH 3TK9A 5AF9H 1UM7A 3SJ9A 3U9AH 2KCAA 1O3AA 3SORA 4Q4LA 2FP7B 4B76A 1P2MA 1LVOA 3E3TA 3STJA 2M2AA 4RI0A 2HPPH 2XW9A 4HFPB 1MC7A 1WUNH 3SU4A 2A4OA 1NFUA 1PYTD 1GJ6A 1N6XA 1NFWA 3BPUA 4U30A 1Y5AT 5T6FA 1Y5BT 1FZZA 2FDAA 1UVPA 2THFB 1GQ5A 4JYVH 1YPHE 3ZZAA 2BQ7B 2P3UB 1CVWH 1O3MA 2XBVA 1EZUC 1WOFA 2E7KA 4IW4E 1IHTH 3MTYA 1LHFH 4MNVA 4JMYA 1Z86A 4P2AB 1Y3VA 4I8LA 5E1YA 1Z71A 4YZUA 4K78A 5EZ0A 1EAWA 3EGGC 2YMSD 1BJUA 2BDAA 1EP5A 1O2ZA 3RU4E 4ISLA 2Q6GA 2A7CA 1GJCB 2ZDKA 2LOBA 3L6PA 1UCYK 4ESTE 1PPGE 1U6QA 5JBBS 1CBWB 3RXBA 1SLUB 3GGEA 3GCTF 1SQOA 2RDLA 3PWCA 5L30H 4A6LA 3SOEA 4H4FA 5JB9S 1RFNA
chains in the Genus database with same CATH topology
1O3DA 1XXFA 1H8IH 3U8RH 5HFBA 1FY3A 1K1JA 2VU8E 2ZU3A 3A8CA 5SGAE 1ZTJA 4ISOA 4CR5A 5LPRA 1EJNA 4DVAU 2VPHA 4WJG2 1O3KA 1G30B 1XVOA 2YTWA 2XBWA 3QX5H 1LVYA 4BAHB 3URDA 2M0VA 2OCSA 2K20A 1JIRA 2ZDLA 2KRGA 3PO1C 2GT8A 1LVMA 2OBQA 5JPMH 1NFYA 1ESAA 1K1OA 4NIYA 9LPRA 2Z6BD 1NROH 1MCVA 4FUIA 1S0QA 7KMEH 4I33A 1WQSA 2UUYA 3T2NA 2NU2E 1HAOH 3BTWE 3CS7A 2BDGA 1DXWA 1ZZZA 4WMFA 1UHBB 4ISHH 3DJ3A 4X8SH 1O3CA 1DX5M 3F9GA 3JZ1B 3AXAA 1AZZA 2W3IA 1IQEA 3PROA 1C9TA 4OAJA 1UTKA 3GCHB 4BTTB 3V12A 2GTBA 5GLJA 2JWEA 4UEHH 2OP9A 1ZOMA 2FS8A 1MUEB 4UFFH 1PFXC 1ZHPA 1W7GH 2V0BA 3T26A 2XWAA 3RXKA 3NFKA 5LPEA 2FNEA 2BY8X 2FOFA 1BTPA 4QT8C 4TY7A 2J34A 1DM4B 1QY6A 3TJVA 1EZQA 4ZXXH 2H9EH 2F83A 3A89A 2A5KA 1ANDA 1E38B 2F9BH 1P09A 2YNBA 2OXSA 2RA3A 1QBNA 3LIWA 1DDJA 3ZZCA 4NXPA 1WH1A 1UK3A 2OBOA 1V2MT 2G8TA 1GI8B 5GDSH 1MCTA 3ZZ9A 1TNKA 3A82A 1L1JA 3NFLA 2ZPRA 1C5TA 3RXFA 4RKJB 1YLCA 3FP6E 1O2GH 4ABFA 3PMBB 1MBMA 1C5MD 1NRNH 3TJOA 3DD2H 5F8TA 2F9NA 1Q7XA 4JJ3A 4GHTA 1I92A 2ZHEH 2TRMA 1IQFA 2BDIA 5E21A 1TP3A 1ZMJA 2BX4A 3VB4A 3HVQC 4E05H 2VIQA 3TJNA 1BFEA 1EJAA 2BM2A 2Z3CA 3S0NA 1HJ9A 2SGDE 1HAXB 1PQ8A 2UUJB 3BTFE 3P8FA 3Q00A 4XDEA 2VWMA 3TK6A 1HB0B 1D5GA 2LC7A 5DTHA 3H7TA 4Q7YA 3GJ9A 4LXBH 1P9UA 2P3TB 3O8BA 1K32A 4YLUA 3EQ0H 3RP2A 1GL0E 1AY6H 3P92A 3M37A 3SU3A 4JOHA 2C8XB 1AN1E 4LZ1H 2SFAA 1MTWA 2FI4E 1TABE 1FC6A 1C4U2 5I25A 1IQIA 4JOKA 2A4GA 1D9IA 1MU8B 1QB1A 1B8QA 2CN0H 1Q3PA 1C5ZB 3MWIU 1UVSH 2ZFPH 1QTFA 4X0WU 1O2RA 3BTEE 1C5VA 1HAHH 3S9AA 4NIWA 1QIXB 2Z3DA 4CHAC 4E34A 1QA0A 2I6VA 4UFEH 5IDKA 4K1EA 5C5OA 1DANH 3M5MA 2FWWA 3MU5A 2A5AA 1FV9A 3SUFA 4BTUB 5AHGH 2CV3A 1KWAA 1JXPA 4BTIB 2R3YA 3LNYA 2AGIX 5HYOA 3RXJA 1YGCH 1YPEH 1FY4A 4K6YA 1ZPBA 4B2CA 1J17T 3E8LA 2XTTB 3ODFA 5DP4A 3SHUA 2BZAA 2TGDA 1OP8A 1TNLA 4GPGA 1O2NA 4JCNA 1V2OT 2FI5E 4BNRA 1KTSB 1BIOA 4X8UH 1GBAA 1YF4A 1WCZA 2VIWA 1KTTB 2W3KA 1V62A 4XE4A 1VJ9U 3OTJE 4NIVA 1QHRB 4GHNA 1V6DA 2ANWA 2UWPA 5ESTE 4I8JA 1Y59T 5L2ZH 1GMCF 1CGIE 4NMRA 1EUFA 1TALA 1AHTH 1Z8IB 1IQLA 1LHDH 1UHBA 2P94A 1MD8A 4FU8A 4J1YA 3CP7A 4DY7B 1SGCA 2XNIA 3MU8A 3SUDA 1TQ3A