1VCWA

Crystal structure of degs after backsoaking the activating peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
312
structure length
291
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 291
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1vcwA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA02
2A32A 5G1DA 2FOCA 1ZGVA 1OP0A 2UUKB 4ABAA 3R68A 3KF2A 1P09A 1B0FA 1GJDB 2G2LA 3UPEA 3CC0A 2QXHA 2Y5HA 4NGAH 2BY8X 5I25A 1PPCE 2ZGCA 1SGTA 3SQHE 1ARCA 6CHAC 1OOKB 2Z9IA 1GHZA 3PTNA 2EEGA 4NSVA 4D9QA 2AMDA 3LC3A 1QTFA 1F5LA 1TMBH 2ZCHP 3LDXH 2TBSA 3AAVA 3O46A 4YM9A 2FESH 2QG1A 2ZO3H 4FUBA 1TP5A 1OSSA 4KTUA 1W2KH 3K82A 3TSWA 1CT0E 1C5QA 3BSQA 2OINA 1K22H 1BIOA 1ELDE 2LNCA 4Y7BA 2OC8A 2IOTA 4ESTE 1NROH 1UVTH 4ABGA 4WH8A 2DE8A 4O3UA 1ZOKA 2P93A 1DWDH 1AI8H 4LOYH 2ZCLP 1RRKA 3ZZ3A 1RIWC 5DG6A 3GY3A 1E36B 3FP6E 1HAIH 1CU1A 1S85A 2Q6GA 1UMAH 4YDPA 2B8OH 1O30A 2WYJA 1ELEE 5ESBA 3DORA 1V2KT 2R3YA 3QJNA 3SORA 1GGDB 1KXCA 3PV2A 3OY6U 4F4OC 1ZYOA 1O2WA 2BDYA 1K1MA 2ZPRA 1V62A 1GBEA 1NTPA 2FP7B 1ETRH 2P59A 4BAKB 4GVUA 3ELAH 4U32A 1O2SA 4E3BA 1C5TA 2BLQA 1EPTB 4AFQA 3RXJA 3O8RA 5T6GA 3MU4A 4RSPA 5J4QA 3VB6A 4NMSA 5SGAE 2F5YA 1K21H 3GJ9A 1N6YA 1YPGH 2FODA 1W14U 1C5VA 1Y3YA 4LZ4B 4OEPA 4Q2PA 2G5NA 4ABHA 4AMHA 1G9OA 1MTSA 3GCTG 1O2ZA 3DHKH 3RXIA 5T6DA 1IQLA 1ANDA 2Z9KA 2J38A 3TIUA 1QRXA 5EW2H 1WHDA 2FOBA 4HTCH 1TPSA 1V6DA 4I8GA 4MDSA 1H4WA 2FS8A 1VAEA 3RP2A 4K1SA 3PLKA 2YTWA 1LHDH 2ILNA 4NA9H 5EXMA 3SUGA 1AE8H 3E6PH 2YOLA 4K72A 4MNXA 5F8TA 1SOTA 1SLWB 1BJUA 1L2EA 1N7EA 3RXTA 5EQSA 3SV8A 4IMQA 2O8MA 4NXRA 3TGKE 1CO7E 4ABDA 3I77A 4ZMAH 5T6FA 1U3BA 1O2GH 1ORFA 2QF3A 1FV9A 2ZPMA 1FY8E 1TFXA 2R0KA 4YT7H 1FCFA 1O3OA 3DJ3A 4FUIA 1QJ1B 1VZQH 1ARBA 3PLBA 4HI3A 5FPTA 5FXLA 3HKJB 1KEFA 1P06A 1YPJH 2H5CA 4IC5A 5I46H 5A8ZA 1RIWB 2G4UA 2EDPA 5DP6A 3GISB 3DIWA 2OQUA 3VB5A 1P2JA 3QX5H 4NG9H 5BPEA 5HFCA 2B7DH 5F67A 5BRRE 1U6QA 2QIQA 2AS9A 2PV9B 1QQ4A 2FI4E 2AYWA 1DWBH 1VCWA 3RXDA 1S6FA 5JBAS 1NRNH 5JB9S 2CGAA 2M0VA 3O8DA 3SGAE 4DT7B 2BY6X 2LA8A 2EA3A 2HLCA 4Y6DA 5I7ZA 1SFQB 3RC4A 2ZCKP 3BF6H 2ZFPH 1C1NA 2F3CE 4H6TA 1HAYB 2CV3A 5HEBA 3SHWA 1VGCC 4K76A 5F3XA 1TX6A 2A4OA 4NFFA 3RU4T 1TALA 1Y3WA 3SU2A 5HEDA 2FM2A 1FC9A 1TQ7B 4XDEA 3A88A 4CRDA 3V12A 1A3BH 1NESE 1MAYA 4AB8A 3LGTA 1HIAB 5TCCA 1GDQA 1P2IA 1P2OA 3KZDA 4Q2NA 5GLJA 1P1DA 1Z8RA 4K2YA 1HXFH 2Z9GA 5EQQA 1HUTH 3TJOA 1FAXA 1XUHA 1LVBA 5F6MA 3QGNB 2KOHA 4MPXA 1HPGA 2XBWA 3KZEA 2BXUH 2AWUA 5D13A 2JH0D 3QO6A 2G81E 4FUEA 2FPZA 4I31A 3RXEA 2PGBB 1CE5A 2PZDA 1PYTD 1SI5H 1OBZA 1Y59T 1O3HA 3MH4A 4NMTA 1AQ7A 4WXIA 5G1EA 2CS5A 2I6VA 4ZKOU 2VIDA 1TNIA 1R6JA 1SQOA 1BE9A 2VWMA 3NZIA 2D2DA 3BTQE 1EAWA 2ASUB 3KIDU 4GCHG 2LC7A 1TRNA 1A7SA 6GCHG 1K2I1 3AVZA 1KWAA 1EQ9A 3SO3A 3HATH 2EJYA 4FU8A 4GVCA 3EYDA 1DFPA 2NU1E 2CF9H 2WPKS 2PTNA 2BY5X 1RGWA 1AFQC 1AUJA 1P0SH 2UZCA 2WYGA 1EOLA 2OCSA 3PO1C 1DT2A 3BTHE 1UCYK 5EU8A 3RM0H 2QXGA 1DXPA 4WYUA 3LOXA 1HGTH 1UJVA 1PPZA 1HV7A 1ANCA 2ODPA 2BTCE 1UJUA 1C5OH 1TGBA 2PTCE 5DTHA 1DSUA 2QCYA 1N1LA 3NCLA 1GHYH 3UNSA 4DOQA 1S0QA 1W9EA 4PROA 1EX3A 2JXOA 2RCEA 2BVSH 4UONA 1VGCB 1F5KU 3HK3B 1WI2A 1OBYA 2ZHEH 1XX9A 3SU1A 5GJ4B 2B0FA 2G51A 4YLUA 2ZFRH 4K1TA 3QN7A 3K50A 4WMDA 2KV8A 1SGFG 1TGSZ 1WOFA 1I16A 1A46H 1G2MA 1GBCA 2A4GA 3GSLA 3FFGA 4CRGA 4HFPB 1ESBA 1G3BA 5EXLA 3ID2A 1C1TA 4NSYA 1VA8A 5FCRA 3IITA 5JBBS 1MD8A 2M10A 2QF0A 1TAWA 3MO6A 3ZVDA 2EI8A 1GI4A 3A7YA 1Y8TA 3TNTA 3PV5A 2M0TA 4MLFB 2RG3A 3RXUA 4Q2KA 1Z86A 1AO5A 3DJ1A 2H2CA 2C8XB 1TX7A 3A8CA 2CHAC 3Q3YA 1H9HE 2AIPA 1T31A 4X1NU 2AWXA 1B7XB 1T8LA 1E0FD 4KFVA 2SGDE 2OS6A 2B5TB 1GMHF 1C1WH 2Q6FA 3UUZA 2BQ6B 4RKOB 4P2AB 2ZU4A 2A7JA 1Q3XA 1A0HB 1INCA 1LCYA 2XWBI 2ZDNA 1BRUP 1Z8GA 4NWLA 4WH6A 4B2CA 2ZU1A 2HNTE 1BRAA 4X1QU 4E35A 2GCHF 2RDLA 2GZ7A 4X6OA 2I04A 1AFQB 1EAXA 1TX8A 1HRTH 1V2UT 2C8YB 3PO1B 4JOKA 3RXSA 2ZA5A 1U39A 5EZ0A 4F8KA 2GZVA 1NN6A 3SUDA 1BZXE 2L4SA 1TNLA 2K1QA 1C5MD 3PMJA 2ZI2H 1T4UH 1YYY1 1J16A 4MNYA 1AE5A 3OTJE 2FIRH 3F9EA 4K5ZA 1MC7A 1C5YB 1GBMA 4MPAA 1O5EH 3SGQE 1Q31A 1WQVH 2AGEX 1X6DA 1GI9B 2QA9E 3ID4A 1CSOE 5ABWA 1E38B 2IN2A 3A82A 1O3AA 2BZAA 3RXBA 1KDQB 1T7CA 1MU6B 3SU4A 2HALA 3Q76A 1PQAA 4JK5A 1RY4A 2G55A 2I6SA 4O3TA 4MPUA 2QBWA 3OX7U 1WSSH 1NRRH 1CGHA 4Y11E 1CT4E 2H3LA 1DPOA 4ZKRU 2OZFA 4JOEA 1NM6A 4NIWA 4XE4A 2ENOA 2KAIB 1WG6A 2OUAA 1UHPA 4UFDH 2DJTA 1N8OC 1BBRH 4A1XA 1KLIH 2AH4X 1AKSA 7LPRA 1MTNC 2V3HH 1ZTLA 4BAOB 2DB5A 1G3CA 1GQ4A 4DCDA 3M7UA 2CSJA 1H9IE 1OPHB 4ISHH 3M37A 3TK6A 2J4IA 1O3PB 1JIRA 1M9UA 3F1SB 1UFXA 1CGJE 3D23A 1ELGA 4IGDA 3U9AH 3BTEE 3SU6A 1EOJA 3U98H 1EXFA 2A7HA 1IOEA 5JYIA 5HM9A 2ZU2A 1YLDA 2ZC9H 1O2YA 1AFEH 5JB8S 3DJAA 1FY1A 1LPZB 4X6MA 2J34A 1QNJA 1C1VH 4HOPA 4BAMB 2DLSA 1ACBE 1CHOF 1YC0A 3LJJA 4ZXYH 3AW1A 1J8AA 1P1EA 2SNVA 1TP3A 3QWCH 4Q2OA 1O2VA 1IU0A 1SR5C 1THSH 1GMCF 4H11A 5EXNA 1TGNA 1W7XH 5L6NH 2LPRA 5HM2A 1QY6A 5IYTA 1GHAG 3T27A 5C5OA 3UQOA 1AZ8A 3EE0B 1WTGH 4A1TA 2BLWA 3NFKA 1C2KA 3EAJA 3MNSA 2ZG0H 1YPKH 1GDNA 5EG4A 3ZZAA 1MCTA 2C90B 3SI4H 2PKSC 3A7VA 2ODQA 4PQWA 4OS7A 1SC8U 1AHTH 4OS2A 5C5NA 1BA8B 3RXFA 2RA0A 1C2MA 1HAVB 2VVVA 1EJAA 1IAUA 2J9NA 2OQSA 3K65B 1QJ7B 2ZFQH 2BX4A 3EA7A 2OGPA 4K8YA 4X2WA 2F9NA 2HRVA 1T4VH 1HBTH 1B0EA 3K1RA 3VEQB 1D3TB 1AD8H 1GL0E 3P70B 1N7FA 2PSYA 2ZP0H 1GBHA 1N8OB 2FE5A 3H5CB 3VXEH 5JXBA 3R69A 1MTNB 3MNBA 2LOBA 2KPLA 3A80A 1C5LH 1FY4A 3RXMA 2BVXH 1VR1H 1C4Y2 2BD5A 1O3LA 4FUCA 4OS5A 1VITG 1WU1A 5C2ZA 2BOKA 1C2EA 1Q7XA 2Q1JA 4NA7A 1GBAA 4O06A 4ZXXH 1DXWA 2PUXB 4BANB 1ZHRA 4U30A 1MH0A 3PWBA 2ZTYA 3K9XB 3NUMA 1TYNA 1AY6H 4AYVB 2W4FA 1UTKA 4FVBA 3OY5U 2UUYA 1UCYH 3P6ZB 3FP8E 1ELTA 1FNIA 5ETXA 4XBDA 1WIFA 1C5UA 4KELA 2EDZA 2BD7A 3HPKA 2ZKSA 4NZLA 3A7ZA 1OWKA 5T3HA 3U1JB 1RTFB 1WI4A 2TGPZ 2W3KA 4NXPA 2I0LA 4Q6SA 3FANA 1EP5A 1WH1A 1SFIA 7ESTE 2OPGA 1ELVA 1LHGH 1NTEA 4X8SH 3TITA 1K9OE 4JOPA 1X8SA 5GCHG 2H6MA 1BMMH 1ZLRA 4ZROA 3URDA 2BDHA 1PPHE 1YBOA 2IWPA 2BDCA 2QAAA 2WPLS 2YNBA 4KP0A 1WYKA 3ATLA 1ANEA 2PKSB 5AFZH 3ESTA 4Y8ZA 4E34A 2BXTH 3ENSB 2P3WA 3LNXA 4UDWH 2DUCA 1SQAA 1BB0B 1NU7B 1SPJA 1UTOA 1P05A 3MU1A 3T62A 1C2IA 3EA8A 3DD2H 3BTDE 3MU8A 1K1LA 1O5CB 1BTUA 2BLOA 1Y3VA 2L4TA 1F0SA 3D62A 1ZSLA 2WL7A 4Z6AH 2BDAA 2ZF0H 2VWRA 5CE1A 2EI7A 1W9OA 1UCYE 1ZPBA 4MPVA 1OZIA 1TWXB 1FC6A 5A2PA 1DM4B 3VB3A 1BDAA 3EQ0H 2RCZA 1SLXB 4TPIZ 4NWKA 4NIYA 3SHUA 2BHGA 1YPHE 3RMOH 3TU7H 5FX6A 4ISOA 2VGCC 4D8NA 3S7HB 3RXCA 6ESTA 3RMMH 2WINI 1V2TT 2GP9B 1WFGA 4DY7B 2ZU5A 3SJOA 3TJUA 2H2ZA 3A81A 1XM1A 1T32A 1HNEE 1TRMA 2XC4A 3CBXA 1HJ9A 2HOBA 5A0BA 2F83A 5C1XA 3S69A 1NU9A 2TGAA 4ABIA 1FUJA 3M3TA 4OEOA 1SLUB 3GDUA 3DT0H 3TH3H 1L0ZA 4IMZA 4NCYA 1NRSH 1DUEA 1T8NA 4YESB 3MI4A 1K32A 2VIWA 3ZYEA 1FJSA 1OYQA 3AASA 1DS2E 2Y80A 2O8WA 1GG6C 1TONA 2BD3A 1EATA 1EASA 1CA8B 5TJXA 5HGGA 1AWHB 1WBGB 1SGCA 3P8NA 4O97A 3F68H 1ELCA 3V13A 1QA7A 3SV7A 1O3MA 3GCHC 4B2BA 3RLEA 3NPSA 2AGGX 2HNTC 4A92A 1Y3UA 3P17H 1JXPA 2CMYA 5L2YH 4XSKU 1ESAA 4JZDH 3UWJH 3VPKA 1QL9A 4FU7A 3QJMA 5HYOA 3TGIE 3ZRTA 1O38A 5A2MH 2LC6A 1MKXK 4IS5A 1A61H 2J94A 2W7RA 1UO6A 2KL1A 1C5SA 1BQYA 2Q6DA 3BG4C 1WQSA 2DKRA 1LHEH 2IWQA 1CVWH 1LVYA 2BY7X 4OGXA 2QYIA 5HF1A 1O31A 1FXYA 3LONA 3CS0A 3O8BA 4ABBA 3KQBA 1SL3A 4Q7YA 1FPCH 1F7ZA 1P3CA 1BT7A 1V1TA 1XXDA 1DSTA 3M3SA 1DWCH 4Y76A 1UTNA 4QT8C 3SJKA 1OWEA 1P12E 3U1IB 3S9AA 1D5GA 1G32B 2VGCB 3E8LA 1FIWA 2OLGA 1D4PB 3PDZA 1GI0A 3VQGA 4Y0YE 2KOJA 4LXBH 2VVUA 1O2NA 2PA1A 3SU0A 2G00A 3HVQC 1GDUA 2PFEA 3RLYH 1Z8JB 1MAXA 2P94A 1W8BH 1V2VT 1D3PB 2VSPA 1ELBA 4JOHA 1ZSKA 2NU3E 4OS6A 1HCGA 5HFEA 3F9HA 2WPJS 3KEEA 6CHAB 1GI7B 3HK6B 5EPNA 1SGEE 1NFWA 1EB2A 2D90A 1KLJH 1AMHA 3C1KA 5A0AE 1IQGA 1EAIA 3LU9B 5HJ1A 4ZHLU 2ZPQA 4AFSA 1IQNA 1GG6B 1UM1A 4Z0KA 3O8CA 3HPMA 5HFDA 3KHVA 5C67A 3A84A 1BBRK 1J15A 3GCHB 1GI5A 2DE9A 5HEYA 1MZDA 4K3JA 1TBZH 3AAUA 4AFUA 5FB8C 4NXQA 1X5RA 3HKIB 3MO3A 2IJOB 1LQDB 2ZGJA 1SGQE 4INHA 3SJ9A 4BTIB 4K78A 2W26A 1K1OA 1RFNA 4B71A 2WPHS 1OWJA 4Z8JA 1SHYA 2V0BA 5FAHA 1H1BA 3BG4B 1JBUH 1OWHA 4YOJA 2AFQB 4G69A 2FNEA 1WAYB 3B8JA 4K60A 3A7XA 3IG6B 3SV9A 2EEKA 1GI2A 1LHFH 3M5OA 1SSXA 7GCHF 4WMFA 5EPYA 1BJVA 1QAVB 3CS7A 1THRH 3STIA 4TPYA 1PYTC 1VITH 1ZJKA 2GDDA 3T26A 1UTPA 2XBVA 1GMDG 1C2HA 4GSOA 1BUIA 3RXGA 3KN2A 3BTFE 1C5ZB 1SHHB 1YPLH 3LH1A 3RC5A 3MH5A 3UR9A 5HF4A 1E37B 2P3UB 1V6BA 1PFXC 1C5PA 2TPIZ 3TJNA 1P3EA 3RXLA 2V1WA 4WVPE 3SNAA 2FOGA 5A8YA 3M3VA 2IWNA 1DUAA 2G8TA 4WXVA 2EC9H 3NXPA 1A2CH 1G30B 3LGUA 1VCPA 1HJ8A 3SHAH 1ABIH 3E3TA 1T8MA 5F03A 2OC7A 2OP9A 3RXQA 1TQ3A 1G2LA 4XBBA 4REYA 3U8RH 5JBCS 3K6YA 4ZUHA 4Y79A 1D6WA 3D65E 4O9VA 4X1RU 1S5SA 1GI3A 3BEIB 1AZZA 1GBKA 1O34A 1UTQA 1UEPA 1Z6JH 1TPOA 2BYGA 1AVWA 3ZVGA 5HMAA 1X5NA 2H9TH 1BHXB 1AGJA 4X8UH 2AINA 1DY9A 3LIWA 3RXKA 1KTTB 3QTOH 1EP6A 1O2TA 5HFFA 2OQ5A 4Y0ZE 5FX5A 2M0ZA 1KTSB 1KLTA 2AWWA 3ZZ6A 2FCFA 2W7SA 4B74A 1NZQH 2TGDA 1A0LA 3E91A 2ZDAH 3QDOA 3T25A 3GYMA 3ID3A 2PDZA 4X2VA 1HAGE 1FIZA 1BFEA 1TMUH 2JOAA 1BMLA 4FXGH 3A86A 3BV9B 3E90B 2VWOA 3TMHA 1F0TA 3EGGC 1Z71A 3L33A 2W5EA 1IHJA 4AORA 5EODA 4BXWA 5LH8A 2FWWA 1TGTA 4RKJB 3RMNH 1N6EA 1YPMH 1GCTC 1W11U 1UK3A 3L6PA 4JZEH 2M0UA 1V2LT 3HPTB 1UK4A 2ALVA 4BOHA 5J4SA 8LPRA 3ZVAA 4XHVA 1EPTA 4FGMA 1N6DA 2XBXA 1J14A 3ATMA 3GY6A 4OAJA 1KXEA 2IPHA 2Y6TA 2AGIX 5AVDA 2BYAX 4WF8A 1ZTJA 4YLQH 4NMVA 1AVGH 1GL1A 1EZXC 1P02A 2YT7A 3GCOA 2UWOA 4JOGA 3LKWA 2D8WA 2JKHA 1K1IA 3GGEA 2O2TA 1YPHC 3RC6A 1WFVA 1Y5UT 1EUFA 3W95A 3KQDA 3FZDA 2W3IA 3GCTF 1GHVH 4X8VH 3TH2H 2EGKA 2OMJA 1QR3E 2PKTA 2OBQA 2KBSA 1WTHD 2V3OH 3F9FA 1ZTKA 1TA6A 3RUOA 5AF9H 1QAUA 4IN1A 3PLPA 3A83A 4MVNA 2V6NA 4A1VA 3SGBE 1EAUA 1MKXH 1XUJA 5E6PB 3OU0A 2PKAB 3ODDA 1KSNA 4CR9A 3ATWA 1A5GH 5HETA 2F9VA 2ESTE 3VB4A 5B6OA 2FOHA 4BTTB 1GJBB 2XW9A 3MNXA 1ZUBA 1ZR0A 1TPPA 4H6SB 1O32A 1TPAE 4EDJA 2XXLA 3A7TA 2ZFFH 3T29A 1FLEE 5IDKA 3H7OA 1F92A 5JDUB 4GPGA 2Z6BD 4Y8XA 1O2RA 1UK2A 2R9PA 1PJPA 1A1RA 2OSGA 1XUGA 1DDJA 4DGJA 1ZMJA 2O9QA 4JZIA 4XBCA 1VJ6A 4BAQB 1Y5AT 1O3BA 3U8OH 1GCTB 3Q00A 4ZH8A 1W9QA 3LT3A 4GAWA 2DM8A 1FONA 2G5MB 1L1GA 1OYTH 2XC5A 2SGQE 4OS4A 1XUKA 2YNAA 5GWZA 4O03A 1C5WB 1WUNH 2GVFA 1B5GH 4IBLH 2I4SA 1TBRH 4AB9A 2VRFA 1TNGA 2PW8H 4IN2A 1LTOA 5AFYH 1RTKA 1GBJA 4FUFA 4WMEA 5GNDA 1CQQA 1V3XA 2VVCA 3KGPA 2FZZA 3A7WA 3NGHA 1FI8A 4ISLA 3KL6A 2HGTH 1Z1IA 1OX1A 1OXGA 1T8OA 3M36A 1WF8A 1BTPA 2CXVA 3ODFA 5FPYA 1HIAA 1O3DA 4JYTA 2GT8A 1BMNH 1NFYA 3UR6A 1NRQH 1P8VC 8GCHG 2FYQA 3C27B 1O3CA 3M35A 3B23B 3MTYA 3GY5A 4Q7XA 1DANH 6LPRA 5E21A 3I4WA 1GHBG 2VSVA 2WV4A 4NMPA 2KJKA 3R0HA 1A5HA 2CHAB 2EGOA 3BTTE 3I78A 5C1UA 2ZNKH 2Z3DA 3B9FH 4CRBA 1UEQA 2I1NA 1FN8A 4NIXA 3T28A 3ZZ9A 4FUJA 4Q6HA 2AMPA 3F6UH 3SUFA 3UQVA 1HLTH 4R0IA 1TQ0B 1V2MT 2NU4E 3SFJA 3RXVA 1YGCH 1NFUA 2GKVE 4U2WA 4YO9A 1UHBB 1UM7A 1CT2E 3SU5A 1V2WT 1MBMA 1LKBA 2NU2E 3TGJE 3UY9A 3TK5A 3OYPA 1N6FA 4GCHF 2M3MA 1V5LA 1IU2A 4MPWA 2VJ1A 2ZDVH 1L6OA 2GZ8A 1LPGB 6GCHF 1MU8B 2KRGA 2UWLA 1A0JA 2BZ6H 3TJVA 2W7UA 2MX6A 3JZ1B 3TK9A 1G3DA 1O2OA 2BB4A 1BBRE 1LDTT 2A45B 2ZHQH 1TOMH 3SUZA 5DP7A 1Y7NA 1TIOA 1CA0C 3MYWA 4YOIA 3ZZ5A 3P8FA 4CH2B 1YLCA 2FOMB 1AWFH 2ZDMA 2VB0A 4ABEA 5C3NA 1QB1A 5FPSA 2BMGB 4JL7A 1ABJH 3ZZ4A 2SNWA 2SGEE 1N7TA 3UNRA 3MU5A 4K8BA 2K1ZA 1HFDA 1K1JA 1AU8A 3M5MA 1QURH 3BTGE 1O5GH 4ZHAA 1O5DH 1QL8A 4I32A 3UOPA 1XKAC 2LUIA 1UJDA 2SGAA 2WPMS 3A85A 4RN6A 2D8IA 1ZPCA 2H9EH 2VPHA 3STJA 2TIOA 2ZHWH 1N6XA 1UTMA 2FOAA 2A1DB 3TVJB 1O3EA 5CHAC 3TH4H 2FXRA 3QZQA 1WCZA 2GCTC 3E16B 2CSSA 1QLCA 5K0HA 4NNLA 1XVOA 4M7GA 4Z33A 3A87A 2BQ7B 1I92A 1ELFA 1L1NA 4ABJA 2VWNA 1DY8A 2IWOA 1RZXA 2I6QA 1ESTA 1ZHMA 1J17T 1AVXA 3NKKA 2QXJA 4L8NA 2WUCA 2ZPSA 2D1JA 1MKWH 4I7YH 1HJAC 3SV6A 1FQ3A 1C1OA 3GCNA 3OTPA 2FX4A 2HPPH 1DWEH 1QBVH 2ZQ1A 3HGNA 2OD3B 2AIQA 3MMGA 3SNEA 2WUBA 3PM3A 3CBYA 3A8BA 4I8KA 3Q3XA 2A4RA 2P3TB 3MHWU 5E0JA 2VIPA 2ZGHA 2J95A 3LPRA 1QBNA 1QJ6B 3GDVA 3LNYA 1F2SE 1C2LA 3ZZ7A 1NY22 2D26C 3BTME 2TRMA 1QA0A 1GBBA 2STAE 5DPAA 2GDEH 5EOKA 3MWIU 5DP3A 1CA0B 1NPMA 1FMGA 4AGKA 3R0FA 1X45A 1MFGA 1EZQA 1IHSH 1GCDA 2JINA 2ZIQH 2A5KA 2K20A 5A09A 4MQAA 3ZV8A 4INLA 3SOSA 1V2PT 1K28D 1UEWA 1EB1H 4FVDA 1D3DB 1QBOA 1KDQA 4AN7A 2BLVA 3SV2H 1UTLM 2STBE 3RXHA 1C5XB 4AYYB 1JMOH 2A2XH 1MTUA 2J92A 4E06H 2UWPA 2HPQH 2BY9X 4NFEA 3SZNA 2FTMA 3ZVEA 1DE7H 4E7RG 4FUGA 4AZ2B 3GOVB 4CBOA 4P0CA 1ZSJA 1GM1A 2KAIA 1GVZA 3UOUA 3VB7A 1EJMA 2BD8A 2R2MB 1P2NA 1UVUH 1LMWB 3BEFB 5CHAB 5PTPA 1O5BB 1PDRA 1QGFA 2GCTB 2Y82A 3RXOA 1SGDE 3A8AA 1BRBE 3P92A 1OWIA 3B76A 3SNDA 2O8TA 3M7TA 3ZZ8A 4YOGA 1F5RA 4LMMA 2CJIA 2BQWB 2ANKH 2CF8H 4AG1A 4BXSA 3QLPH 1ZRBA 1M5ZA 4JZFH 1GJ6A 8GCHF 1CGIE 1H9LB 4A5TS 3DFLA 3UWIA 1HJAB 2KA9A 1O5FH 1OS8A 1W3CA 3D49H 3P8GA 1O2MA 2HE4A 4I8JA 5FBIA 1SB1H 1RGQA 2H3MA 4WJG2 2QV1A 2VH0A 3K6ZA 2ZHFH 5DGJA 1AN1E 1Z6EA 1YKTA 3HGPA 1P2QA 3ZVBA 2ZQ2A 4TWYA 3I1EA 3ZV9A 4DIHH 1C1PA 2G4TA 2BDBA 1FY5A 2G5VA 2BM2A 1C2FA 1FC7A 3CENA 3QDZB 2WPIS 3CP7A 3S9BA 4TY6A 5FHTA 1XKBC 3O5NA 1HDTH 2EV8A 2F9UA 4MG3A 2EEJA 2A31A 2GMTC 2XWAA 4J1YA 3W94A 1P2MA 1TLDA 4DURA 1SGRE 3V3MA 3QK1A 2ZFTA 2GV7A 1S81A 1GHAF 2DC2A 4Q80A 5GXPA 1SGNE 4KTSA 1XUFA 1NC6A 1A3EH 4JORA 5CMXH 1YM0A 1FY3A 1HAVA 1PQ5A 2D92A 4CBNA 3GDSA 1GVKB 1C5RA 1HYLA 1UVPA 3V0XA 2EEHA 1YBWA 1VCQA 1W10U 5K7RA 4NMRA 5GIBA 2GD4B 1O2LA 1ZHPA 1IQFA 2DLUA 4ABFA 2WV5A 1LPKB 3E17A 1GJ8B 2Y5FA 2Y7ZA 3PV4A 4X1PU 1SGPE 2PLXA 3SW2B 2Z94A 3RM2H 4WY3A 1JOUB 3S9CA 1C9TA 3RMLH 4INKA 5DK1A 1MTVA 1O36A 1IQJA 1KXFA 4X2XA 2Z9LA 4NMQA 1YPEH 2P3FH 3VFEA 3AW0A 5G4BA 3VGCC 2FEQH 3ATIA 4TY7A 3IWMA 2EGNA 1NS3A 1ID5H 1F0UA 1OWDA 1VITF 1AB9C 1Z8IB 2FOEA 1P01A 3T2NA 4CREA 2JILA 4AG2A 2FO9A 3BTWE 4D9RA 2FYRA 3VXFH 2F9PA 2PKUA 3F9GA 1NT1A 4NMOA 2ZTZA 4K1EA 1GQ5A 2F0AA 4SGAE 4E7NA 4B73A 1BRCE 2XCNA 2AMQA 2ZPLA 1VJAU 2A4QA 1PQ8A 4YTAA 3URCA 2VIQA 3QE1A 1BOQA 1H8DH 1RJXB 3P95A 3SU3A 2PNTA 2GMTB 3RXPA 1HXEH 3OSYA 1FAKH 1P2KA 1W13U 2C3SA 3NK8A 4X1SU 1W7GH 1YF4A 1O2JA 2NWNA 2BDGA 4JMYA 3CYYA 4SGBE 2R4HA 3MOCA 1GMHG 5GCHF 1GJ9B 1BTHH 1VB7A 2V35A 4ASHA 1L4ZA 1TBQH 3TSZA 2GT7A 2Z3CA 5L2ZH 1HAHH 3ITIA 4I33A 1BCUH 4H4FA 1C9PA 1JWTA 2GCHG 2ZU3A 4CRCA 1AIXH 1O2PA 1P10A 4IW4E 2ANWA 2FN5A 1LVMA 3K2UA 4ISNA 3FAOA 1O5AB 3LGIA 1O35A 5DP9A 1RXPA 2BVRH 2F9OA 2PR3A 2QKVA 4NIVA 2KJPA 1K1NA 3SJ8A 5LPEA 4JOFA 3ATKA 4BTUB 1WF7A 3UFAA 4YZUA 1MD7A 2R2WU 5DJ7A 1V5QA 3GICB 4Q7ZA 1E34B 4NA8A 3SBKA 1PPGE 1NRPH 3SNCA 2FOFA 2TGTA 1IQMA 3VGCB 3TPIZ 1YCPK 1O2HA 1YP9A 4XFQA 3ZYDA 4MNVA 3E1XB 1TMTH 5DP8A 1UITA 1RD3B 1GHXH 1AB9B 1CHGA 1JIMA 1KYNA 2QY0B 1DX5M 1VJ9U 3UREA 2Y5GA 3SNBA 1GBDA 4X6NA 4AOQA 1O2UA 5EQRA 4A7IB 4CHAC 3RXRA 1KXBA 5HXFA 5ESTE 2PHBA 1S82A 2EAQA 1G9IE 1EJNA 2OC1A 1U38A 3Q77A 2JH5D 1HAPH 3FY5A 1TE0A 2PUQH 1Z87A 3DFJA 2PSXA 2HNTF 2YUYA 3ZZCA 1C2JA 1G3EA 1C2DA 1QHRB 2Z9JA 2ZTXA 1AKSB 1A4WH 4X8TH 2QXIA 5LPRA 5E22A 3RL8A 5H4IB 3UNQA 1O37A 5A8XA 1LO6A 2Z3EA 1IQHA 1ZMLA 1T2MA 5C1YA 3BN9A 4K69A 1DOJA 2ZDLA 4CH8B 1O3IA 4TYDA 1MKWK 3MH7A 3VQFA 3CBZA 3PMAB 4GHQA 4MNWA 1D3QB 3M7QA 1CHOG 3LC5A 1DVAH 3QGJA 4H42U 1HAXB 5DP5A 1GI8B 3JZ2B 1GJ7B 4HOPB 1ANBA 1GMCG 1GI6A 1O2XA 1OP2A 1LVOA 3P8OA 1IHTH 1LQEA 4MTBA 1CBWC 2SFAA 2G52A 1Z7KA 4WYTA 3A89A 1QRWA 4X0WU 4FU9A 4UFFH 5F8XA 1BTZA 2JREA 5E11A 3UIRA 1IQIA 4KTCA 2ALPA 4U01A 1D9IA 4BAHB 4ZKSU 1S0RA 1ZGIA 1KY9A 1DICA 2OC0A 1Y5BT 1MTWA 2VU8E 2Z7FE 3SI3H 4K75A 9LPRA 3SQEE 3L4FD 1V2NT 4JK6A 4LK4A 2KPKA 3MU0A 1C4U2 1ZOMA 2B9LA 1OKXA 4K6YA 1W0ZU 3GY2A 3EDXB 3S7KB 1O3GA 2C8WB 2OTVA 2QC2A 3PMBB 1V2QT 2QKTA 3PS4A 3QIKA 2FLRH 1THPB 3I18A 1O2QA 2XNIA 1OBXA 1O3FA 1O3KA 2GTBA 1GBLA 4CHAB 5F8ZA 5HDYA 5E2OA 5A0CA 2Z17A 1JRTA 1Q3OA 1BTWA 3FP7E 4ISIH 3WY8A 1GJ4H 1P04A 1UVSH 4UEHH 5AHGH 1MQ6A 4DG4A 3U8TH 1BHXF 3LGWA 2XC0A 1J9CH 4JZ1A 2XRCA 1EZSC 2ZWLH 2HWLB 5EW1H 3PWCA 1MMJN 5JBTA 3L3TA 3NFLA 2XYAA 4CRAA 1BTXA 1U37A 2GX4A 2MHOA 1V2RT 3BEUA 2DAZA 4R2ZA 4VGCC 1QQUA 2R3UA 3V7TA 2FLBH 7KMEH 5DO4H 2ULLA 1O3JA 2AERH 5LGOA 4YT6H 1P9SA 2I0IA 3LGYA 4CRFA 4X6PA 4Q2QA 2HVXA 1MFLA 2M5TA 1EZUC 3EGKH 2VNTA 1D6RA 1G36A 4Y10E 4JYVH 4R8TB 4UU5A 1XZ9A 1KXAA 2Y81A 5TCAA 2A0QB 1DLKB 1FPHH 2REYA 4J2YB 1GHWH 1H8IH 1O2IA 1QAVA 2CN0H 5FBEA 5E1YA 1CBWB 3PTBA 3PB1E 2UUFB 2ZGXH 3RL7A 1K1PA 2R0LA 3DUXH 2FMJA 1WJLA 2C4FH 1IQKA 1C4V2 3LJOA 1GJ5H 1QRZA 1GBFA 1UTJA 3BG8A 3RU4D 3TLOA 4B75A 3GY4A 3GYLB 1C1QA 4UE7H 2P16A 3GY8A 3WKLA 2A5AA 2BD9A 1GMDF 4LZ1H 1GJAB 3RLWH 4NZQA 3SOEA 2ZDKA 1P57B 1C1UH 1GI1A 1G37A 1SG8B 1KXDA 2A2QH 4UFGH 1UF1A 3PYHA 1RS0A 1QB9A 4GUXA 5B6LA 1YCPM 1UVOA 1IQEA 4KGAA 2VINA 1ETTH 2OCVB 3A8DA 2ZFSA 1UJ1A 4N6XA 1SVPA 2F91A 4Y71A 4I8HA 3MO9A 2HE2A 1O0DH 3BIVH 1NF3C 5DKMA 1ZJDA 2C93B 5E2PA 3QUMP 2FDAA 4OS1A 1ZPZA 4KKDA 2JWEA 2VWLA 2HGAA 1SGIB 2SGPE 3KQEA 2KAWA 3KHFA 4I8LA 3AXAA 2L97A 4VGCB 1BTYA 4FUHA 4AX9H 2Q9VA 2KJDA 2YUBA 2JETC 2H5DA 3FVFB 4GLYA 5E0GA 4NNMA 1X7AC 1C1SA 2GZ9A 1LHCH 1HAOH 4GHTA 1TA2A 1ZZZA 1FZZA 1C1RA 1WV7H 4GVDA 5E0HA 3BIUH 2J2UA 1TNKA 2BDIA 2KG2A 1O3NA 1GBTA 1O2KA 5EYZA 2H9HA 2ZHDA 1SQTA 1PPEE 3KQCA 2ZECA 3SN8A 4JYUH 2P95A 2NU0E 2V90A 3ZZBA 4HZHA 2Q3GA 1S6HA 2ODYB 3QZRA 2EXGA 4GHNA 1GVLA 2OBOA 3DA9B 1HAZB 3RDZA 1GBIA 1XUIA 1YCPH 1QB6A 1A5IA 2XCFA 1TGCA 2P8OC 4F49A 5GDSH 1EKBB 4THNH 3GY7A 3ZVCA 1AUTC 4HGCA 2FTLE 1HB0B 1ZMNA 2THFB 2VH6A 3SJIA 1PQ7A 3WKMA 4B2AA 2BX3A 3ZVFA 3SUEA 1Q3PA 5E8EH 2E7KA 4Y8YA 1XXFA 4Q3HA 2ZEBA 3U69H 3M5LA 4BNRA 1XMNB 2FX6A 4OGYA 1SMFE 5HFBA 3BTKE 1ZRKA 3MNCA 4D7GA 2H2BA 1WHAA 1KIGH 1NFXA 3NWUA 4YYXA 1DLEA 2RA3A 2QGRA 1O39A 2XTTB 1UEZA 5C20A 2QKUA 3PROA 5L30H 2KOMA 2BD4A 1TNJA 2ANYA 3M61U 1B8QA 4B1TA 2A5IA 3TSVA 4CR5A 4DJZB 1C2GA 4WWYA 2ZGBH 1MQ5A 5JPMH 3QGLA 2ANMH 1E35B 2JETB 5H3JA 1P11E 1SGYE 2PKAA 4AGJA 1JRSA 1QCPA 2A7CA 2SGFE 1LKAA 3CH8A 1MZAA 1SBWA 4JCNA 1S83A 2X7ZA 1NO9H 1C1MA 4AFZA 4IC6A 1PPFE 1V2JT 1P03A 3ID1A 2FI3E 2RRMA 1RTLA 2JH6D 2VIOA 4FUDA 2O8LA 3JXTA 3MH6A 5LPFA 1Z1JA 3KCGH 4D76A 3E0PB 3M5NA 1QIXB 3R3GB 2BD2A 4XOJA 2C8ZB 3RXAA 1P9UA 3SHCH 4D7FA 3E0NB 2KYLA 3EGHC 1S84A 2VIVA 4UFEH 4E05H 8KME2 2P8OB 1TOCB 2F9BH 4A6LA 2O8UA 1ETSH 2QT5A 1PPBH 4KFWA 1SOZA 2EHRA 1F0RA 1FN6A 2FI5E 2GV6A 3QTVH 1BMAA 5GPIB 2VZ5A 4TWWA 4RI0A 2XBYA 3EA9A 1L4DA 2FS9A 3MFJA 2KQFA 4DW2U 1TABE 4ZHMU 3KNXA 1QFKH 2DMZA 3PDVA 1GWAA 3G01A 2EDVA 5EGMA 3LH3A 4ZKNU 1RGRA 3ZZDA 4DIIH 7GCHG 1MUEB 4ZAEA 2ZZUH 3FZZA 2Y7XA 1O33A 1Y3XA 1SLVB 1MCVA 1BITA 4X2YA 3N7OA 3BPUA 8ESTE 9ESTA 3LGVA 2JIKA 4Y7AA 3TNSA 3PMHB 1L1JA 4JOJA 1DITH 2OXSA 1SGFA 1V2OT 2PGQB 2AEIH 1MBQA 1GGDC 1V2ST 2EI6A 3H7TA 3Q3KA 4UD9H 1TNHA 1W12U 1TB6H 3S0NA 2YT8A 1ELAA 3UTUH 1N99A 4B76A 1TRYA 1W0YH 5DP4A 2QN5T 2EEIA 3RU4E 1X5QA 1GHBF 2BOHB 4DVAU 1GPZA 4UU6A 1EPTC 1Q2WA 2H1UA 2PWXA 2UUJB 1GJCB 1C5NH 1FDPA 2GGVB 3I29A 1QL7A 3T5FH 1XVMA 1UHBA 1OP8A 5FCKA
chains in the Genus database with same CATH superfamily
2A32A 5G1DA 2FOCA 1ZGVA 1OP0A 2UUKB 4ABAA 3R68A 3KF2A 1P09A 1B0FA 1GJDB 2G2LA 3UPEA 3CC0A 2QXHA 2Y5HA 4NGAH 2BY8X 4ASUD 5I25A 5EIYA 1PPCE 2ZGCA 1SGTA 3SQHE 1ARCA 2CK3D 6CHAC 1OOKB 2Z9IA 1GHZA 3PTNA 2EEGA 4NSVA 4D9QA 2AMDA 3LC3A 1QTFA 1F5LA 1TMBH 2ZCHP 1E79D 2TBSA 3AAVA 3O46A 3LDXH 4YM9A 2FESH 2QG1A 2ZO3H 4FUBA 1TP5A 1OSSA 4KTUA 1K0HA 1W2KH 3K82A 3TSWA 1CT0E 1C5QA 3BSQA 2OINA 1K22H 3EE7A 1BIOA 1ELDE 2LNCA 4Y7BA 2OC8A 2IOTA 4ESTE 1NROH 1UVTH 2RDEA 4ABGA 4WH8A 2DE8A 4O3UA 1ZOKA 2P93A 1DWDH 1AI8H 1SKYE 3SZEA 4LOYH 2ZCLP 3KYFA 1RRKA 3ZZ3A 1RIWC 5DG6A 3GY3A 1E36B 2YMSB 3FP6E 1HAIH 1CU1A 1S85A 2Q6GA 1UMAH 4YDPA 2B8OH 1O30A 3VB7A 2WYJA 1ELEE 5ESBA 3DORA 1V2KT 2R3YA 3QJNA 3SORA 1GGDB 1KXCA 3PV2A 3OY6U 4F4OC 1ZYOA 1O2WA 2BDYA 1K1MA 1NBMD 2ZPRA 1V62A 4B6EA 1GBEA 1NTPA 2FP7B 2K8IA 1ETRH 2P59A 1SQRA 4BAKB 4GVUA 3ELAH 4U32A 1O2SA 4E3BA 1C5TA 2BLQA 1EPTB 4AFQA 3RXJA 3O8RA 5T6GA 3MU4A 4RSPA 5J4QA 3VB6A 4NMSA 5SGAE 2F5YA 1K21H 3GJ9A 1N6YA 1YPGH 2FODA 1W14U 1C5VA 1Y3YA 4LZ4B 4OEPA 4Q2PA 2G5NA 4ABHA 4AMHA 1G9OA 1MTSA 3GCTG 1O2ZA 3DHKH 3RXIA 5T6DA 1IQLA 1ANDA 2Z9KA 2J38A 3TIUA 1QRXA 5EW2H 1WHDA 2FOBA 4HTCH 1TPSA 1V6DA 4I8GA 4MDSA 1H4WA 2FS8A 1VAEA 3RP2A 4K1SA 3PLKA 2YTWA 1LHDH 2ILNA 4NA9H 5EXMA 3SUGA 1AE8H 3E6PH 2YOLA 4K72A 4MNXA 5F8TA 1SOTA 3KQ5A 1SLWB 1BJUA 1L2EA 1N7EA 3RXTA 5EQSA 3SV8A 4IMQA 2O8MA 4NXRA 3TGKE 1CO7E 4ABDA 5EJ1A 3I77A 4ZMAH 5T6FA 1U3BA 1O2GH 1ORFA 2QF3A 1FV9A 2ZPMA 1FY8E 1TFXA 1WDIA 2R0KA 4YT7H 1FCFA 1O3OA 3DJ3A 4FUIA 1QJ1B 1VZQH 1ARBA 3PLBA 4HI3A 5FPTA 5FXLA 3HKJB 1KEFA 1P06A 1YPJH 2H5CA 4IC5A 5I46H 5A8ZA 1RIWB 2G4UA 2EQNA 2EDPA 5DP6A 3GISB 3DIWA 2OQUA 3VB5A 1P2JA 3QX5H 4NG9H 5BPEA 5HFCA 2B7DH 5F67A 2XNDD 5BRRE 1U6QA 2QIQA 2AS9A 2PV9B 1QQ4A 2FI4E 2AYWA 1DWBH 1VCWA 3RXDA 1S6FA 5JBAS 1NRNH 3PRBA 5JB9S 2CGAA 2M0VA 3O8DA 3SGAE 2W6ID 4DT7B 2BY6X 3OE7D 2LA8A 2EA3A 2HLCA 4Y6DA 5I7ZA 1SFQB 3RC4A 2ZCKP 3BF6H 2ZFPH 1C1NA 2F3CE 4H6TA 1HAYB 2CV3A 5HEBA 3SHWA 1VGCC 4K76A 5F3XA 1TX6A 2A4OA 4NFFA 3RU4T 1TALA 1Y3WA 3SU2A 5HEDA 2FM2A 1FC9A 1TQ7B 4XDEA 3A88A 3KDGA 4CRDA 3V12A 3WW7A 1A3BH 1NESE 1MAYA 4AB8A 3LGTA 1HIAB 5TCCA 1GDQA 1P2IA 1P2OA 3KZDA 4Q2NA 5GLJA 3F2GA 1P1DA 1Z8RA 4K2YA 1HXFH 2Z9GA 5EQQA 1HUTH 3TJOA 1FAXA 1XUHA 1LVBA 5F6MA 3QGNB 2KOHA 4MPXA 1HPGA 2XBWA 3KZEA 2BXUH 2AWUA 5D13A 3CNRA 2JH0D 3QO6A 2G81E 4FUEA 2FPZA 4I31A 3RXEA 2PGBB 1CE5A 2PZDA 1PYTD 1SI5H 1OBZA 1Y59T 1O3HA 3MH4A 4NMTA 1AQ7A 4WXIA 5G1EA 2CS5A 2I6VA 4ZKOU 2VIDA 1TNIA 1R6JA 1SQOA 1BE9A 2VWMA 3NZIA 2D2DA 3BTQE 1EAWA 2ASUB 3KIDU 4GCHG 5KEDA 2LC7A 1TRNA 1A7SA 6GCHG 1K2I1 3AVZA 1KWAA 2L74A 1EQ9A 3SO3A 3HATH 2EJYA 4FU8A 4GVCA 3EYDA 1DFPA 2NU1E 2CF9H 2WPKS 2PTNA 1OHHD 2BY5X 1RGWA 1AFQC 1AUJA 1P0SH 2UZCA 2WYGA 1EOLA 2OCSA 3PO1C 1DT2A 1H8ED 3BTHE 1UCYK 5EU8A 3RM0H 2QXGA 1DXPA 4WYUA 1W0KD 3LOXA 1HGTH 1UJVA 1PPZA 1HV7A 1ANCA 2ODPA 2BTCE 1UJUA 1C5OH 1TGBA 2PTCE 5DTHA 1DSUA 2QCYA 1N1LA 3NCLA 1GHYH 3UNSA 4DOQA 1S0QA 1W9EA 4PROA 1EX3A 2JXOA 2RCEA 2BVSH 4UONA 1VGCB 1F5KU 3HK3B 1WI2A 1OBYA 2ZHEH 1XX9A 3SU1A 5GJ4B 2B0FA 2G51A 4YLUA 2ZFRH 4K1TA 3QN7A 3K50A 4WMDA 2KV8A 1SGFG 1TGSZ 1WOFA 1I16A 1A46H 1G2MA 1GBCA 2A4GA 3GSLA 3FFGA 4CRGA 4HFPB 1ESBA 1G3BA 5EXLA 3ID2A 1C1TA 4NSYA 1VA8A 5FCRA 3IITA 5JBBS 1MD8A 2M10A 2QF0A 1TAWA 3MO6A 3ZVDA 2EI8A 1GI4A 3A7YA 1Y8TA 3TNTA 3PV5A 2M0TA 4MLFB 2RG3A 3RXUA 4Q2KA 1Z86A 1NBME 1AO5A 3DJ1A 2H2CA 2C8XB 1TX7A 3A8CA 2CHAC 3Q3YA 1H9HE 2AIPA 1T31A 4X1NU 2AWXA 1B7XB 1T8LA 1E0FD 4KFVA 2SGDE 2OS6A 2B5TB 1GMHF 1C1WH 2Q6FA 3UUZA 2BQ6B 4RKOB 4P2AB 2ZU4A 5HIYA 2A7JA 1Q3XA 1A0HB 1INCA 1LCYA 2XWBI 2ZDNA 1BRUP 1Z8GA 4NWLA 4WH6A 4B2CA 2ZU1A 2HNTE 1BRAA 4X1QU 4E35A 2GCHF 2RDLA 2GZ7A 4X6OA 2I04A 1AFQB 1EAXA 1TX8A 1HRTH 1V2UT 2C8YB 3PO1B 4JOKA 2QF5A 3RXSA 2ZA5A 1U39A 5EZ0A 4F8KA 2GZVA 1NN6A 3SUDA 1BZXE 2L4SA 1TNLA 2K1QA 1C5MD 3PMJA 2ZI2H 1T4UH 1YYY1 1J16A 4MNYA 1AE5A 3OTJE 2FIRH 3F9EA 4K5ZA 1MC7A 1C5YB 1GBMA 4MPAA 1O5EH 3SGQE 1Q31A 1WQVH 2AGEX 1QZ8A 1X6DA 4I86A 1GI9B 4RT1A 2QA9E 3ID4A 1CSOE 5ABWA 1E38B 2IN2A 3A82A 1O3AA 2BZAA 3RXBA 1KDQB 1T7CA 1MU6B 4TSFD 3SU4A 1MABB 2HALA 3Q76A 1PQAA 4JK5A 1RY4A 2G55A 2I6SA 4O3TA 4MPUA 2QBWA 3OX7U 1WSSH 1NRRH 1CGHA 4Y11E 1CT4E 2H3LA 1DPOA 4ZKRU 2OZFA 1YWUA 4JOEA 1NM6A 4NIWA 4XE4A 2ENOA 2KAIB 1WG6A 2OUAA 1UHPA 4UFDH 2DJTA 3UAIC 1N8OC 1BBRH 4A1XA 1KLIH 2AH4X 1AKSA 7LPRA 1MTNC 2V3HH 1ZTLA 4BAOB 2DB5A 1G3CA 1GQ4A 4DCDA 3M7UA 2CSJA 1H9IE 1OPHB 4ISHH 3M37A 3TK6A 2J4IA 1O3PB 1JIRA 1M9UA 3F1SB 1UFXA 1CGJE 3D23A 1ELGA 4IGDA 3U9AH 3BTEE 3SU6A 1EOJA 3U98H 1EXFA 2A7HA 1IOEA 5JYIA 5HM9A 2ZU2A 1YLDA 2ZC9H 1O2YA 1AFEH 5JB8S 3DJAA 1FY1A 1LPZB 5T1VA 4X6MA 2J34A 2J98A 1QNJA 1C1VH 4HOPA 4BAMB 2DLSA 1ACBE 1CHOF 1YC0A 3LJJA 4ZXYH 3AW1A 1J8AA 1P1EA 2SNVA 1TP3A 3QWCH 4Q2OA 1O2VA 1IU0A 1SR5C 1THSH 1GMCF 4H11A 5EXNA 1TGNA 1W7XH 5L6NH 2LPRA 5HM2A 1QY6A 3F3BA 1GHAG 5IYTA 3T27A 5C5OA 3UQOA 1AZ8A 3EE0B 1WTGH 4A1TA 2BLWA 3NFKA 1C2KA 3EAJA 3MNSA 2ZG0H 1YPKH 1GDNA 5EG4A 3ZZAA 1MCTA 2C90B 3SI4H 2PKSC 3A7VA 2ODQA 4PQWA 4OS7A 1SC8U 1AHTH 2HLDD 4OS2A 5CHBA 5C5NA 1BA8B 3RXFA 2RA0A 1C2MA 1HAVB 2VVVA 1EJAA 1IAUA 2J9NA 2OQSA 3K65B 1QJ7B 2ZFQH 2BX4A 3EA7A 2OGPA 4K8YA 4X2WA 2F9NA 2HRVA 1T4VH 1HBTH 1B0EA 3K1RA 1COWD 3VEQB 1D3TB 1AD8H 1GL0E 3P70B 1N7FA 2PSYA 4Z1MD 2ZP0H 1GBHA 1N8OB 2FE5A 2IPQX 3H5CB 3VXEH 5JXBA 3R69A 1MTNB 3MNBA 2LOBA 2KPLA 5F53A 4ACAA 3AK5A 3A80A 1C5LH 1FY4A 3RXMA 2BVXH 1VR1H 1C4Y2 2BD5A 1O3LA 4FUCA 4OS5A 1VITG 1WU1A 5C2ZA 2BOKA 1C2EA 1Q7XA 2Q1JA 4NA7A 1GBAA 3KDKA 4O06A 4ZXXH 1DXWA 2PUXB 4BANB 1ZHRA 4U30A 1MH0A 4TT3D 3PWBA 2ZTYA 3K9XB 3NUMA 1TYNA 1AY6H 4AYVB 2W4FA 1UTKA 2GJGA 3OY5U 4FVBA 2UUYA 1UCYH 3P6ZB 3FP8E 1ELTA 1FNIA 5ETXA 4XBDA 1WIFA 1C5UA 4KELA 2EDZA 2BD7A 3HPKA 2ZKSA 4NZLA 3A7ZA 1OWKA 5T3HA 3U1JB 1RTFB 1WI4A 2TGPZ 2W3KA 4NXPA 2I0LA 4Q6SA 3FANA 1EP5A 1WH1A 1SFIA 7ESTE 2OPGA 1ELVA 1LHGH 2WZQA 1NTEA 4X8SH 3TITA 1K9OE 4JOPA 1X8SA 5GCHG 2H6MA 1BMMH 1ZLRA 4ZROA 3URDA 3ZIAD 2BDHA 1PPHE 1YBOA 2IWPA 2BDCA 2QAAA 2WPLS 2YNBA 4KP0A 1WYKA 3ATLA 1ANEA 2PKSB 5AFZH 3ESTA 4Y8ZA 4E34A 2BXTH 3ENSB 2P3WA 3LNXA 2GEFA 4UDWH 2DUCA 1SQAA 1BB0B 1NU7B 1SPJA 1UTOA 1P05A 3MU1A 3T62A 1C2IA 3EA8A 3DD2H 3BTDE 3MU8A 1K1LA 1O5CB 1BTUA 2BLOA 1Y3VA 2L4TA 1F0SA 3D62A 1ZSLA 2WL7A 4Z6AH 5CDFE 2BDAA 2ZF0H 2VWRA 5CE1A 3FKSD 3KYGA 2EI7A 1W9OA 1UCYE 1ZPBA 4MPVA 1OZIA 1TWXB 1FC6A 2WHXA 5A2PA 1DM4B 3VB3A 1BDAA 2V7QD 3EQ0H 2RCZA 1SLXB 4TPIZ 4NWKA 4NIYA 3SHUA 2BHGA 1YPHE 3RMOH 3TU7H 5FX6A 4ISOA 2VGCC 4D8NA 3S7HB 3RXCA 6ESTA 3RMMH 2WINI 1V2TT 2GP9B 1WFGA 4DY7B 2ZU5A 3SJOA 3TJUA 2H2ZA 3A81A 1XM1A 1T32A 1HNEE 1TRMA 2XC4A 3CBXA 1HJ9A 2HOBA 5A0BA 2F83A 5C1XA 3S69A 1NU9A 2TGAA 4ABIA 1FUJA 3M3TA 4OEOA 1SLUB 3GDUA 3DT0H 3TH3H 1L0ZA 4IMZA 4NCYA 1NRSH 1DUEA 1T8NA 4YESB 3MI4A 1K32A 2VIWA 3ZYEA 1FJSA 1OYQA 3AASA 1DS2E 2Y80A 2O8WA 1GG6C 1TONA 2BD3A 1EATA 1EASA 1CA8B 5TJXA 5HGGA 1AWHB 1WBGB 1SGCA 3P8NA 4O97A 3F68H 1ELCA 3V13A 1QA7A 3SV7A 1O3MA 3GCHC 4B2BA 3RLEA 3NPSA 2AGGX 2HNTC 4A92A 1Y3UA 1BMFD 3P17H 1JXPA 2CMYA 5L2YH 4XSKU 1ESAA 4JZDH 3UWJH 4F48B 3VPKA 1QL9A 4FU7A 3QJMA 5HYOA 3TGIE 3ZRTA 1O38A 5A2MH 2LC6A 1MKXK 4IS5A 1A61H 2J94A 2W7RA 1UO6A 2KL1A 1C5SA 1BQYA 2Q6DA 3BG4C 3NRLA 1WQSA 2DKRA 1LHEH 2IWQA 1CVWH 1LVYA 2BY7X 4OGXA 2QYIA 5HF1A 1O31A 1FXYA 3LONA 4P02A 3CS0A 3O8BA 4ABBA 3KQBA 1SL3A 4Q7YA 1FPCH 1F7ZA 1P3CA 1BT7A 3H09A 1V1TA 1XXDA 1DSTA 3M3SA 1DWCH 4M9FA 4Y76A 1UTNA 4QT8C 3SJKA 1OWEA 1P12E 3U1IB 3F0PA 3S9AA 1D5GA 1G32B 2VGCB 3E8LA 1FIWA 2OLGA 1D4PB 3PDZA 1GI0A 3VQGA 4Y0YE 2KOJA 4LXBH 5B42A 2VVUA 1O2NA 2PA1A 3SU0A 2G00A 3HVQC 1GDUA 2PFEA 3RLYH 1Z8JB 1MAXA 2P94A 1W8BH 1V2VT 1D3PB 2VSPA 1ELBA 4JOHA 1ZSKA 2NU3E 4OS6A 1HCGA 5HFEA 3F9HA 2WPJS 3KEEA 6CHAB 1GI7B 3HK6B 5EPNA 1SGEE 1NFWA 1EB2A 2D90A 1KLJH 1AMHA 3C1KA 5A0AE 1IQGA 1EAIA 3LU9B 5HJ1A 4ZHLU 2ZPQA 4AFSA 1IQNA 1GG6B 1UM1A 4Z0KA 3O8CA 3HPMA 5HFDA 3KHVA 5C67A 3A84A 1BBRK 1EFRD 1J15A 4FETA 3GCHB 1GI5A 2DE9A 5HEYA 1MZDA 4K3JA 1TBZH 3AAUA 2JJ2D 5FB8C 3WWFA 4AFUA 4NXQA 1X5RA 3HKIB 3MO3A 2IJOB 1LQDB 5EJLA 3PRDA 2ZGJA 1SGQE 4INHA 3SJ9A 4BTIB 4K78A 2W26A 1K1OA 1RFNA 4B71A 2WPHS 5HKKD 1OWJA 4Z8JA 1SHYA 2V0BA 5FAHA 1H1BA 3BG4B 1JBUH 1OWHA 4YOJA 2AFQB 4G69A 2FNEA 1WAYB 3B8JA 4K60A 4ACBA 3A7XA 3IG6B 3SV9A 2EEKA 1GI2A 1LHFH 3M5OA 1SSXA 7GCHF 4WMFA 5EPYA 1BJVA 1QAVB 3CS7A 1THRH 3STIA 5ILBA 4TPYA 1PYTC 1VITH 1ZJKA 2GDDA 3T26A 1UTPA 2XBVA 1GMDG 1C2HA 4GSOA 1BUIA 3RXGA 3KN2A 3BTFE 1C5ZB 1SHHB 1YPLH 3LH1A 3RC5A 3MH5A 3UR9A 5HF4A 1E37B 2P3UB 1V6BA 1PFXC 2AHME 1C5PA 2TPIZ 3TJNA 1P3EA 3RXLA 2V1WA 5C94A 4WVPE 3SNAA 2FOGA 5A8YA 3M3VA 2IWNA 1DUAA 2G8TA 4WXVA 2EC9H 3NXPA 1A2CH 1G30B 3LGUA 1VCPA 1HJ8A 3SHAH 1ABIH 3E3TA 1T8MA 5F03A 2OC7A 2OP9A 3RXQA 1TQ3A 1G2LA 4XBBA 4REYA 3U8RH 5JBCS 3K6YA 4ZUHA 4Y79A 1D6WA 3D65E 4O9VA 4X1RU 4XRNA 3SYJA 1S5SA 1GI3A 3BEIB 1AZZA 1GBKA 4RT0A 1O34A 1UTQA 1UEPA 1Z6JH 1TPOA 2BYGA 1AVWA 3ZVGA 4FOUC 5HMAA 1X5NA 2H9TH 1BHXB 1AGJA 4X8UH 2AINA 1DY9A 3LIWA 3RXKA 1KTTB 3N7DA 1EP6A 1O2TA 3QTOH 5HFFA 2KZ4A 2OQ5A 4Y0ZE 5FX5A 2M0ZA 1KTSB 1KLTA 2AWWA 3N99A 2FCFA 2W7SA 3ZZ6A 4B74A 1NZQH 2TGDA 1A0LA 3E91A 2ZDAH 3QDOA 2QF4A 3T25A 3GYMA 3ID3A 2PDZA 4X2VA 1HAGE 1FIZA 1BFEA 1TMUH 2JOAA 1BMLA 4FXGH 3A86A 3BV9B 3E90B 2VWOA 3TMHA 1F0TA 3EGGC 1Z71A 3L33A 2W5EA 1IHJA 4AORA 5EODA 4BXWA 5LH8A 2FWWA 1TGTA 4RKJB 3RMNH 1N6EA 3F0OA 4HG6A 1YPMH 1GCTC 1W11U 1UK3A 3L6PA 4JZEH 2M0UA 1V2LT 3HPTB 1UK4A 2ALVA 4BOHA 5J4SA 8LPRA 3ZVAA 4XHVA 2F4LA 1EPTA 4FGMA 1N6DA 2XBXA 1J14A 2LELA 3ATMA 4OAJA 3GY6A 1KXEA 2IPHA 2Y6TA 2AGIX 5AVDA 2BYAX 4WF8A 1ZTJA 4YLQH 4NMVA 1AVGH 1GL1A 1EZXC 1P02A 2YT7A 3GCOA 2UWOA 4JOGA 3LKWA 2D8WA 2JKHA 1K1IA 3GGEA 2O2TA 1YPHC 1VKYA 3RC6A 1WFVA 1Y5UT 1EUFA 3W95A 3KQDA 3FZDA 2W3IA 3GCTF 1GHVH 4X8VH 3TH2H 2EGKA 2OMJA 1QR3E 2PKTA 2OBQA 2KBSA 1WTHD 2V3OH 3F9FA 1ZTKA 1TA6A 3RUOA 5AF9H 1QAUA 4IN1A 3PLPA 3A83A 4MVNA 2V6NA 4A1VA 3SGBE 1EAUA 1MKXH 1XUJA 5E6PB 3OU0A 4OM9A 2PKAB 3ODDA 1KSNA 4CR9A 3ATWA 1A5GH 5HETA 2F9VA 2ESTE 2WSSD 3VB4A 5B6OA 2FOHA 4BTTB 1GJBB 2XW9A 3MNXA 1ZUBA 1ZR0A 1TPPA 3DSPA 4H6SB 1O32A 1TPAE 4EDJA 2XXLA 3A7TA 2ZFFH 3T29A 1FLEE 5IDKA 3H7OA 1F92A 5JDUB 4GPGA 2Z6BD 4Y8XA 1O2RA 1UK2A 2R9PA 1PJPA 1A1RA 2OSGA 1XUGA 1DDJA 4DGJA 1ZMJA 2O9QA 4JZIA 4XBCA 1VJ6A 4BAQB 1Y5AT 1O3BA 3U8OH 1GCTB 3Q00A 4ZH8A 1W9QA 3LT3A 5C0UA 4GAWA 2DM8A 1FONA 2G5MB 1L1GA 1OYTH 2XC5A 2SGQE 4OS4A 1XUKA 2YNAA 5GWZA 4O03A 1C5WB 1WUNH 2GVFA 1YY3A 1B5GH 4IBLH 2I4SA 1TBRH 4AB9A 2VRFA 1TNGA 2PW8H 4IN2A 1LTOA 2L6OA 5AFYH 1RTKA 1GBJA 4FUFA 4WMEA 5GNDA 1CQQA 1V3XA 2VVCA 3KGPA 2FZZA 3A7WA 3NGHA 1FI8A 4ISLA 2OK5A 3FOAA 2HGTH 3KL6A 1Z1IA 1OX1A 1OXGA 1T8OA 3M36A 1WF8A 1BTPA 2CXVA 3ODFA 5FPYA 1HIAA 3U28C 1O3DA 4JYTA 2GT8A 1BMNH 1NFYA 3UR6A 1NRQH 1P8VC 8GCHG 2FYQA 3C27B 1O3CA 3M35A 3B23B 3MTYA 3GY5A 4Q7XA 1DANH 6LPRA 5E21A 3I4WA 1GHBG 2VSVA 2WV4A 4NMPA 2KJKA 3R0HA 1A5HA 2CHAB 2EGOA 3BTTE 3I78A 5C1UA 5DSFA 2ZNKH 2Z3DA 3B9FH 4CRBA 1UEQA 2I1NA 1FN8A 4NIXA 3T28A 3ZZ9A 4FUJA 4Q6HA 2AMPA 3F6UH 3SUFA 3UQVA 1HLTH 3DCLA 4R0IA 1TQ0B 1V2MT 2NU4E 3SFJA 3RXVA 1YGCH 1NFUA 2GKVE 4U2WA 4YO9A 2QE7D 1UHBB 1UM7A 1CT2E 3SU5A 1V2WT 1MBMA 1LKBA 2NU2E 3TGJE 3UY9A 3TK5A 3OYPA 1N6FA 4GCHF 3OEED 2M3MA 1V5LA 1IU2A 4MPWA 2VJ1A 2ZDVH 1L6OA 2GZ8A 1LPGB 6GCHF 1MU8B 2KRGA 2UWLA 1A0JA 2BZ6H 3TJVA 2W7UA 2MX6A 3JZ1B 3TK9A 1G3DA 1O2OA 2BB4A 1BBRE 1LDTT 2A45B 2ZHQH 1TOMH 3SUZA 5DP7A 1Y7NA 1TIOA 1CA0C 3MYWA 4YOIA 3ZZ5A 3P8FA 4CH2B 1YLCA 2FOMB 1AWFH 2ZDMA 2VB0A 4ABEA 5C3NA 1QB1A 5FPSA 2BMGB 4JL7A 1ABJH 3ZZ4A 2SNWA 2SGEE 1N7TA 3UNRA 3MU5A 4K8BA 2K1ZA 1HFDA 1K1JA 1AU8A 3M5MA 1QURH 3BTGE 1O5GH 4ZHAA 1O5DH 1QL8A 4I32A 3UOPA 1XKAC 2LUIA 1UJDA 2SGAA 2WPMS 3A85A 4RN6A 2D8IA 1ZPCA 2H9EH 2VPHA 3STJA 2TIOA 2ZHWH 1N6XA 1UTMA 2FOAA 2A1DB 3TVJB 1O3EA 5CHAC 3TH4H 2FXRA 3QZQA 1WCZA 2JJ1D 2GCTC 3E16B 2CSSA 1QLCA 5K0HA 4NNLA 1XVOA 4M7GA 4Z33A 3A87A 2BQ7B 1I92A 1ELFA 1L1NA 4ABJA 2VWNA 1DY8A 2IWOA 1RZXA 2I6QA 1ESTA 1ZHMA 1J17T 1AVXA 3NKKA 2QXJA 4L8NA 2WUCA 2ZPSA 2D1JA 1MKWH 4I7YH 1HJAC 3SV6A 1FQ3A 1C1OA 3GCNA 3OTPA 2FX4A 2HPPH 1DWEH 1QBVH 2ZQ1A 3HGNA 2JDID 2OD3B 2WPDD 2AIQA 3MMGA 3SNEA 2WUBA 3PM3A 3CBYA 3A8BA 4I8KA 3Q3XA 2A4RA 2P3TB 3MHWU 5E0JA 2VIPA 2ZGHA 2J95A 4ZCNA 3LPRA 5FL7D 1QBNA 1QJ6B 3GDVA 3LNYA 1F2SE 1C2LA 3ZZ7A 1NY22 2D26C 3BTME 2TRMA 1QA0A 1GBBA 3WWBA 2STAE 5DPAA 2PP6A 2GDEH 5EOKA 3MWIU 5DP3A 1CA0B 1NPMA 1FMGA 4AGKA 3R0FA 1X45A 1MFGA 1EZQA 1IHSH 1GCDA 2JINA 2ZIQH 2A5KA 2K20A 5DN6D 5A09A 4MQAA 3ZV8A 4INLA 3SOSA 1V2PT 1K28D 1UEWA 1EB1H 4FVDA 1D3DB 1QBOA 1KDQA 4AN7A 2BLVA 3SV2H 1UTLM 2STBE 3RXHA 1C5XB 4AYYB 1JMOH 2A2XH 1MTUA 2J92A 4E06H 2UWPA 3FN8A 2HPQH 2BY9X 4NFEA 3SZNA 2FTMA 3ZVEA 1DE7H 4E7RG 4FUGA 4AZ2B 3GOVB 4CBOA 4P0CA 1ZSJA 1GM1A 2KAIA 1GVZA 3UOUA 4JJ0A 1EJMA 2BD8A 2R2MB 1P2NA 1UVUH 1LMWB 3BEFB 5CHAB 5PTPA 1O5BB 1PDRA 1QGFA 5IL9A 2GCTB 2Y82A 3RXOA 1SGDE 3A8AA 1BRBE 3P92A 1OWIA 3B76A 3SNDA 1FX0B 2O8TA 3M7TA 3ZZ8A 4YOGA 1F5RA 4LMMA 2CJIA 2BQWB 2ANKH 2CF8H 4AG1A 4BXSA 3QLPH 1S6LA 1ZRBA 1M5ZA 4JZFH 1GJ6A 5KECA 8GCHF 1CGIE 1H9LB 4A5TS 3DFLA 3UWIA 1HJAB 2KA9A 1O5FH 1OS8A 1W3CA 3D49H 3P8GA 3GABA 1O2MA 2HE4A 4I8JA 5FBIA 2J5UA 1SB1H 1RGQA 2H3MA 4WJG2 2QV1A 2VH0A 2JSNA 3K6ZA 2ZHFH 5DGJA 4DT4A 1AN1E 1Z6EA 1YKTA 3HGPA 1P2QA 3ZVBA 2ZQ2A 4TWYA 3I1EA 3ZV9A 4DIHH 1C1PA 2G4TA 2BDBA 1FY5A 2G5VA 2BM2A 2EY4C 1C2FA 1FC7A 4YXWD 3CENA 3QDZB 2WPIS 3CP7A 3S9BA 4TY6A 5FHTA 1XKBC 4FLNA 3O5NA 1HDTH 2EV8A 2F9UA 2KFWA 4MG3A 2EEJA 2A31A 2GMTC 2YMSD 2XWAA 4J1YA 3W94A 1P2MA 1TLDA 4DURA 1SGRE 3V3MA 3QK1A 2ZFTA 2GV7A 1S81A 1GHAF 2DC2A 4Q80A 5GXPA 1SGNE 4KTSA 1XUFA 1NC6A 1A3EH 4JORA 5CMXH 1YM0A 1FY3A 1HAVA 1PQ5A 2D92A 4CBNA 3GDSA 1GVKB 1C5RA 1HYLA 1UVPA 3V0XA 2EEHA 1YBWA 1VCQA 1W10U 5K7RA 4NMRA 5GIBA 2GD4B 1O2LA 1ZHPA 1H8HD 1IQFA 2DLUA 4ABFA 2WV5A 1LPKB 3E17A 1GJ8B 2Y5FA 2Y7ZA 3PV4A 2J97A 4X1PU 1SGPE 2PLXA 3SW2B 2Z94A 3RM2H 3FO8D 4WY3A 1JOUB 3S9CA 1C9TA 3RMLH 1E1RD 4INKA 5DK1A 1MTVA 1O36A 1IQJA 1KXFA 4X2XA 2Z9LA 4NMQA 1YPEH 1W0JD 2P3FH 3VFEA 3AW0A 5G4BA 3VGCC 2FEQH 3ATIA 4TY7A 3IWMA 2EGNA 2LP6A 1NS3A 3W1EA 1ID5H 1F0UA 1OWDA 1VITF 1AB9C 1Z8IB 2FOEA 3F2HA 1P01A 3T2NA 4CREA 2JILA 4AG2A 2FO9A 3BTWE 4D9RA 2FYRA 3N7EA 3VXFH 2F9PA 2PKUA 3F9GA 1NT1A 2JIZD 4NMOA 2ZTZA 4K1EA 1GQ5A 2IJD1 2F0AA 4SGAE 4E7NA 4B73A 1BRCE 2XCNA 2AMQA 2ZPLA 1VJAU 2A4QA 1PQ8A 4YTAA 3URCA 2VIQA 3QE1A 1BOQA 1H8DH 1RJXB 3P95A 3SU3A 2PNTA 2GMTB 3RXPA 1HXEH 3OSYA 1FAKH 1P2KA 1W13U 2C3SA 3NK8A 4X1SU 1W7GH 1YF4A 1O2JA 2NWNA 2BDGA 4JMYA 3CYYA 4SGBE 2R4HA 3MOCA 1GMHG 5GCHF 1GJ9B 1BTHH 1VB7A 2V35A 4ASHA 1L4ZA 1TBQH 3TSZA 2GT7A 2Z3CA 5L2ZH 1HAHH 3ITIA 4I33A 1BCUH 4H4FA 1C9PA 1JWTA 2GCHG 2ZU3A 4CRCA 1AIXH 1O2PA 1P10A 4IW4E 2ANWA 2FN5A 1LVMA 3K2UA 4ISNA 3FAOA 1O5AB 3LGIA 1O35A 5DP9A 1RXPA 2BVRH 2F9OA 2PR3A 2QKVA 4NIVA 2KJPA 1K1NA 3SJ8A 5LPEA 4JOFA 3ATKA 4BTUB 1WF7A 3UFAA 4YZUA 1MD7A 2R2WU 5DJ7A 1V5QA 2WV9A 3GICB 4Q7ZA 1E34B 4NA8A 3SBKA 1PPGE 2RFKC 1NRPH 3DSOA 3SNCA 2FOFA 2TGTA 1IQMA 3VGCB 3TPIZ 1YCPK 1O2HA 1YP9A 4XFQA 3ZYDA 4MNVA 3E1XB 1TMTH 5DP8A 5EJZA 1UITA 1RD3B 1GHXH 1AB9B 1CHGA 4XD7D 1JIMA 1KYNA 2QY0B 1DX5M 1VJ9U 3UREA 2Y5GA 3SNBA 1GBDA 4X6NA 4AOQA 1O2UA 5EQRA 4A7IB 4CHAC 1WXRA 3RXRA 1KXBA 5HXFA 5ESTE 2PHBA 1S82A 2EAQA 1G9IE 1EJNA 2OC1A 1U38A 3Q77A 2JH5D 1HAPH 3FY5A 1TE0A 2PUQH 1Z87A 3DFJA 2PSXA 2HNTF 2YUYA 3ZZCA 1C2JA 1G3EA 1C2DA 1QHRB 2Z9JA 2ZTXA 1AKSB 1A4WH 4X8TH 2QXIA 5LPRA 5E22A 3RL8A 5H4IB 3UNQA 1O37A 5A8XA 1LO6A 2Z3EA 1IQHA 2KCPA 1ZMLA 1T2MA 5C1YA 3BN9A 4K69A 1DOJA 2ZDLA 4CH8B 1O3IA 4TYDA 1MKWK 3MH7A 3VQFA 3CBZA 3PMAB 4GHQA 4MNWA 1D3QB 3M7QA 1CHOG 3LC5A 1E1QD 1DVAH 3QGJA 4H42U 1HAXB 5DP5A 2J98B 1GI8B 3JZ2B 1GJ7B 4HOPB 1ANBA 1GMCG 1GI6A 1O2XA 1OP2A 1LVOA 4AC9A 3P8OA 1IHTH 1LQEA 4MTBA 1CBWC 2SFAA 2G52A 1Z7KA 4WYTA 3A89A 1QRWA 4X0WU 4FU9A 4UFFH 2KCAA 1BTZA 2JREA 5E11A 5F8XA 3UIRA 1IQIA 4KTCA 2ALPA 4U01A 1D9IA 4BAHB 4ZKSU 1S0RA 1ZGIA 1KY9A 1DICA 2OC0A 1Y5BT 1MTWA 2VU8E 2Z7FE 3SI3H 4K75A 2KX4A 3SQEE 9LPRA 3L4FD 1V2NT 4JK6A 4LK4A 2KPKA 3MU0A 1C4U2 1ZOMA 2B9LA 1OKXA 4K6YA 1W0ZU 3GY2A 5C0TA 3EDXB 3S7KB 1O3GA 2C8WB 2OTVA 2QC2A 3PMBB 1V2QT 2QKTA 3PS4A 3QIKA 2FLRH 4JJ3A 1THPB 3I18A 1O2QA 2XNIA 1OBXA 1O3FA 1O3KA 2GTBA 1GBLA 4CHAB 5F8ZA 1UW7A 5HDYA 5HIZA 5E2OA 5A0CA 2Z17A 1JRTA 1Q3OA 1BTWA 3FP7E 4ISIH 3WY8A 1GJ4H 1P04A 1UVSH 4UEHH 5AHGH 1MQ6A 4DG4A 3U8TH 1BHXF 3LGWA 3OAAD 2XC0A 1J9CH 4JZ1A 2XRCA 1EZSC 2ZWLH 2HWLB 5EW1H 3PWCA 1MMJN 5JBTA 3L3TA 3NFLA 2XYAA 4CRAA 1BTXA 1U37A 2GX4A 2MHOA 1V2RT 3BEUA 2DAZA 4R2ZA 4VGCC 1QQUA 2R3UA 3V7TA 2FLBH 7KMEH 5DO4H 2ULLA 1O3JA 2AERH 3OEHD 5LGOA 4YT6H 1P9SA 2I0IA 3LGYA 4CRFA 4X6PA 4Q2QA 2HVXA 1MFLA 2M5TA 1EZUC 3EGKH 2VNTA 1D6RA 1G36A 4Y10E 4JYVH 4R8TB 4UU5A 1XZ9A 1KXAA 2Y81A 5TCAA 2A0QB 1DLKB 1FPHH 2REYA 4J2YB 1GHWH 1H8IH 1O2IA 1QAVA 2CN0H 5FBEA 5E1YA 1CBWB 3PTBA 3PB1E 2UUFB 2ZGXH 3RL7A 1K1PA 2R0LA 3DUXH 2FMJA 1WJLA 2C4FH 1IQKA 3F2FA 1C4V2 3LJOA 1GJ5H 1QRZA 1GBFA 1UTJA 3BG8A 3RU4D 3TLOA 4B75A 3GY4A 3GYLB 1C1QA 4UE7H 2P16A 3GY8A 3WKLA 2A5AA 2BD9A 1GMDF 4LZ1H 1GJAB 3RLWH 4NZQA 3SOEA 3OFND 2ZDKA 1P57B 5KGOA 1C1UH 1GI1A 1G37A 1SG8B 1KXDA 2A2QH 4UFGH 1UF1A 3PYHA 1RS0A 1QB9A 4GUXA 3DSGA 5B6LA 1YCPM 1UVOA 1IQEA 4KGAA 2VINA 1ETTH 2OCVB 3A8DA 1X9ZA 2ZFSA 1UJ1A 4N6XA 1SVPA 2F91A 4Y71A 4I8HA 3MO9A 2HE2A 1O0DH 3BIVH 1NF3C 5DKMA 1ZJDA 2C93B 5E2PA 3QUMP 2FDAA 4OS1A 1ZPZA 4KKDA 2JWEA 2VWLA 2HGAA 1SGIB 2SGPE 3KQEA 2KAWA 3KHFA 4I8LA 3AXAA 2L97A 2W6JD 4VGCB 1BTYA 4FUHA 4AX9H 2Q9VA 2KJDA 2YUBA 2JETC 2H5DA 3FVFB 4GLYA 5E0GA 4NNMA 1X7AC 1C1SA 2GZ9A 1LHCH 1HAOH 4GHTA 1KMHB 1TA2A 1ZZZA 1FZZA 2KM0A 1C1RA 1WV7H 4GVDA 5E0HA 4P00A 3BIUH 2J2UA 1TNKA 2BDIA 2KG2A 1O3NA 1GBTA 1O2KA 5EYZA 2H9HA 2ZHDA 1SQTA 1PPEE 3KQCA 2ZECA 3SN8A 4JYUH 2P95A 2NU0E 2V90A 3ZZBA 4HZHA 2Q3GA 1S6HA 2ODYB 3QZRA 2EXGA 4GHNA 1GVLA 2OBOA 3DA9B 1HAZB 3RDZA 1GBIA 1XUIA 1YCPH 1QB6A 1A5IA 2XCFA 1TGCA 2P8OC 4F49A 5GDSH 1EKBB 4THNH 3GY7A 3ZVCA 1AUTC 2K0QA 2FTLE 1HB0B 1ZMNA 4HGCA 2THFB 2VH6A 3SJIA 1PQ7A 3WKMA 4B2AA 2BX3A 2F43B 3ZVFA 3SUEA 1Q3PA 5E8EH 2E7KA 4Y8YA 1XXFA 4Q3HA 5C17A 2ZEBA 3U69H 3M5LA 4BNRA 1XMNB 2FX6A 3VG8A 4OGYA 1SMFE 3NCVA 5HFBA 3BTKE 1ZRKA 3MNCA 4D7GA 2H2BA 1WHAA 1KIGH 1NFXA 3NWUA 4YYXA 1DLEA 2RA3A 2QGRA 1O39A 2XTTB 1UEZA 5C20A 2KCOA 2QKUA 3PROA 5L30H 2KOMA 2BD4A 1TNJA 2ANYA 3M61U 1B8QA 4B1TA 2A5IA 3TSVA 4CR5A 4DJZB 1C2GA 4WWYA 2ZGBH 3UB0A 1MQ5A 2KCYA 5JPMH 3QGLA 2ANMH 1E35B 2JETB 5H3JA 1P11E 1SGYE 2PKAA 4AGJA 1JRSA 1QCPA 2A7CA 2SGFE 1LKAA 3CH8A 1MZAA 1SBWA 4B6FA 4JCNA 1S83A 2X7ZA 1NO9H 4F55A 1C1MA 4AFZA 2XOKD 4IC6A 1PPFE 1V2JT 1P03A 3ID1A 2FI3E 2RRMA 1RTLA 1YLNA 2JH6D 2VIOA 4FUDA 2O8LA 3JXTA 3MH6A 5LPFA 1Z1JA 2VBCA 3KCGH 4D76A 3E0PB 3M5NA 1QIXB 3R3GB 2BD2A 4XOJA 2C8ZB 3RXAA 1P9UA 3SHCH 4D7FA 3E0NB 2KYLA 3EGHC 1S84A 2VIVA 4UFEH 3GS9A 2V3MA 4Q63A 4E05H 8KME2 2P8OB 1TOCB 2F9BH 4A6LA 2O8UA 1ETSH 2QT5A 1PPBH 4KFWA 1SOZA 2EHRA 1F0RA 1FN6A 2FI5E 2GV6A 3QTVH 1BMAA 5GPIB 2VZ5A 4TWWA 4RI0A 2XBYA 3EA9A 1L4DA 2FS9A 3MFJA 2KQFA 4DW2U 1TABE 4ZHMU 3KNXA 1QFKH 2DMZA 3PDVA 1GWAA 3G01A 2EDVA 5EGMA 3LH3A 4ZKNU 1RGRA 3ZZDA 4DIIH 7GCHG 1MUEB 4ZAEA 2ZZUH 3FZZA 2Y7XA 1O33A 1Y3XA 1SLVB 1MCVA 1BITA 4X2YA 3N7OA 3BPUA 8ESTE 2YMSC 9ESTA 3LGVA 2JIKA 4Y7AA 3TNSA 3PMHB 1L1JA 4JOJA 1DITH 2OXSA 2M2AA 1SGFA 1V2OT 2PGQB 2AEIH 1MBQA 5IK2D 1GGDC 1V2ST 2EI6A 3H7TA 3Q3KA 4UD9H 3MQKC 1TNHA 1W12U 1TB6H 3S0NA 2YT8A 1ELAA 3UTUH 1N99A 2KR7A 1TRYA 1W0YH 5DP4A 2QN5T 4B76A 2HVYB 2EEIA 4Q4LA 3RU4E 1X5QA 1GHBF 2BOHB 4DVAU 1GPZA 4UU6A 1EPTC 1Q2WA 2H1UA 2PWXA 2UUJB 1GJCB 1C5NH 1FDPA 2GGVB 3I29A 1QL7A 3T5FH 1XVMA 1UHBA 1OP8A 5FCKA
chains in the Genus database with same CATH topology
2A32A 5G1DA 2FOCA 1ZGVA 1OP0A 2UUKB 4ABAA 3R68A 3KF2A 1P09A 1B0FA 1GJDB 2G2LA 3UPEA 3CC0A 2QXHA 2Y5HA 4NGAH 2BY8X 5I25A 1PPCE 2ZGCA 1SGTA 3SQHE 1ARCA 6CHAC 1OOKB 2Z9IA 1GHZA 3PTNA 2EEGA 4NSVA 4D9QA 2AMDA 3LC3A 1QTFA 1F5LA 1TMBH 2ZCHP 3LDXH 2TBSA 3AAVA 3O46A 4YM9A 2FESH 2QG1A 2ZO3H 4FUBA 1TP5A 1OSSA 4KTUA 1W2KH 3K82A 3TSWA 1CT0E 1C5QA 3BSQA 2OINA 1K22H 1BIOA 1ELDE 2LNCA 4Y7BA 2OC8A 2IOTA 4ESTE 1NROH 1UVTH 4ABGA 4WH8A 2DE8A 4O3UA 1ZOKA 2P93A 1DWDH 1AI8H 4LOYH 2ZCLP 1RRKA 3ZZ3A 1RIWC 5DG6A 3GY3A 1E36B 3FP6E 1HAIH 1CU1A 1S85A 2Q6GA 1UMAH 4YDPA 2B8OH 1O30A 3VB7A 2WYJA 1ELEE 5ESBA 3DORA 1V2KT 2R3YA 3QJNA 3SORA 1GGDB 1KXCA 3PV2A 3OY6U 4F4OC 1ZYOA 1O2WA 2BDYA 1K1MA 2ZPRA 1V62A 1GBEA 1NTPA 2FP7B 1ETRH 2P59A 4BAKB 4GVUA 3ELAH 4U32A 1O2SA 4E3BA 1C5TA 2BLQA 1EPTB 4AFQA 3RXJA 3O8RA 5T6GA 3MU4A 4RSPA 5J4QA 3VB6A 4NMSA 5SGAE 2F5YA 1K21H 3GJ9A 1N6YA 1YPGH 2FODA 1W14U 1C5VA 1Y3YA 4LZ4B 4OEPA 4Q2PA 2G5NA 4ABHA 4AMHA 1G9OA 1MTSA 3GCTG 1O2ZA 3DHKH 3RXIA 5T6DA 1IQLA 1ANDA 2Z9KA 2J38A 3TIUA 1QRXA 5EW2H 1WHDA 2FOBA 4HTCH 1TPSA 1V6DA 4I8GA 4MDSA 1H4WA 2FS8A 1VAEA 3RP2A 4K1SA 3PLKA 2YTWA 1LHDH 2ILNA 4NA9H 5EXMA 3SUGA 1AE8H 3E6PH 2YOLA 4K72A 4MNXA 5F8TA 1SOTA 1SLWB 1BJUA 1L2EA 1N7EA 3RXTA 5EQSA 3SV8A 4IMQA 2O8MA 4NXRA 3TGKE 1CO7E 4ABDA 3I77A 4ZMAH 5T6FA 1U3BA 1O2GH 1ORFA 2QF3A 1FV9A 2ZPMA 1FY8E 1TFXA 2R0KA 4YT7H 1FCFA 1O3OA 3DJ3A 4FUIA 1QJ1B 1VZQH 1ARBA 3PLBA 4HI3A 5FPTA 5FXLA 3HKJB 1KEFA 1P06A 1YPJH 2H5CA 4IC5A 5I46H 5A8ZA 1RIWB 2G4UA 2EDPA 5DP6A 3GISB 3DIWA 2OQUA 3VB5A 1P2JA 3QX5H 4NG9H 5BPEA 5HFCA 2B7DH 5F67A 5BRRE 1U6QA 2QIQA 2AS9A 2PV9B 1QQ4A 2FI4E 2AYWA 1DWBH 1VCWA 3RXDA 1S6FA 5JBAS 1NRNH 5JB9S 2CGAA 2M0VA 3O8DA 3SGAE 4DT7B 2BY6X 2LA8A 2EA3A 2HLCA 4Y6DA 5I7ZA 1SFQB 3RC4A 2ZCKP 3BF6H 2ZFPH 1C1NA 2F3CE 4H6TA 1HAYB 2CV3A 5HEBA 3SHWA 1VGCC 4K76A 5F3XA 1TX6A 2A4OA 4NFFA 3RU4T 1TALA 1Y3WA 3SU2A 5HEDA 2FM2A 1FC9A 1TQ7B 4XDEA 3A88A 3KDGA 4CRDA 3V12A 1A3BH 1NESE 1MAYA 4AB8A 3LGTA 1HIAB 5TCCA 1GDQA 1P2IA 1P2OA 3KZDA 4Q2NA 5GLJA 1P1DA 1Z8RA 4K2YA 1HXFH 2Z9GA 5EQQA 1HUTH 3TJOA 1FAXA 1XUHA 1LVBA 5F6MA 3QGNB