1VCWA

Crystal structure of degs after backsoaking the activating peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
312
structure length
291
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 56
structure length 291
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1vcwA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA02
1BTUA 3AAUA 2BQ6B 1GVKB 4ABFA 4CRGA 4TY6A 3O46A 1SLVB 5LPEA 3K6ZA 2C4FH 3PV5A 1GBEA 1QR3E 4ZKSU 3FZZA 3QGNB 3QJMA 1C2IA 1HAIH 4XE4A 1G9OA 2BQ7B 3STIA 1QGFA 1O3DA 3ZVFA 3A8DA 2FYRA 3GY5A 3A8AA 1ELDE 3PO1B 4JMYA 2VJ1A 5ETXA 4E05H 4GCHF 3RXAA 1UK3A 2A2XH 2VINA 2NU4E 2O8WA 3M35A 1QQUA 4NMSA 1P03A 1TALA 1RD3B 1TIOA 3QGJA 1O37A 4BANB 1F0TA 5AHGH 1WQSA 4UDWH 3VPKA 1UO6A 1ZPCA 2A7CA 1FCFA 1GG6C 3LPRA 4ZHMU 2ZF0H 2YT7A 1C9PA 2UUKB 4X2YA 4X2WA 1J9CH 1WYKA 1ANDA 1XUHA 1GL1A 1KY9A 1X5QA 3GJ9A 1YKTA 2V3OH 1P09A 3V3MA 3ZZ5A 4B1TA 1A5GH 3VGCC 5C1UA 5I25A 2KYLA 1EB2A 1TQ3A 2ZU1A 2L4SA 2VSPA 1O31A 2IJOB 1DITH 2BZ6H 2J92A 1C1VH 2WL7A 5ABWA 1OBXA 5GJ4B 4ABHA 2M10A 1MFLA 1SGIB 1ZTLA 2OCVB 1TE0A 2BVSH 1LCYA 1TP5A 1C2JA 1MAXA 1PPCE 2AGEX 2WPJS 2PSYA 3T29A 3UR9A 4H11A 5E0HA 4O3TA 3MO3A 3UPEA 3CH8A 3SU4A 1PPFE 3L33A 1RGWA 3BTGE 5HEBA 1WTHD 1GDQA 3QUMP 2KV8A 2GKVE 1QRZA 2VGCB 2ANYA 1FONA 1P9UA 4FUEA 1PQ7A 1XUIA 3NFLA 2ANWA 2WPHS 3LOXA 1SHYA 3E0NB 4CRFA 3O8BA 1GI9B 1UJ1A 4X1NU 1F92A 4ABIA 5LPRA 3RXMA 3RXHA 3AW1A 4Z8JA 2V0BA 2ZGXH 1GBDA 1CGHA 4TWYA 3HK3B 2ZDMA 3JXTA 2FZZA 2MHOA 1H8DH 1O32A 1OXGA 1CA0B 1HB0B 1CT2E 2V6NA 1P2JA 2HPPH 4K1EA 2JH5D 1JRTA 3NK8A 1TPSA 4X1QU 4YOJA 1D6WA 4FU9A 3RMLH 1UCYK 3SNCA 1VJAU 1FN8A 1EKBB 3TGJE 2Z3EA 4K6YA 4NZLA 3RU4D 1T8MA 2ODYB 1ETRH 1S0QA 3GOVB 4L8NA 1Y3XA 1ANEA 3NUMA 1V2QT 3GICB 5CE1A 1D3TB 2VIQA 3DA9B 3MH6A 2Q3GA 3UR6A 4H6TA 4AFQA 4BAQB 2SGDE 5G1DA 2AS9A 2UWLA 1EXFA 2VRFA 2W3KA 1U38A 3ODFA 2TBSA 3ZZ4A 3TITA 4JZDH 1TNKA 2AIPA 4X6PA 2OP9A 1HDTH 1AZ8A 1P01A 2ZTYA 2BY6X 3GGEA 1C1RA 2EEKA 2DKRA 1TWXB 1Z71A 3U8TH 2VZ5A 1C1QA 3H5CB 1MKXH 3TSVA 1K1OA 8ESTE 1MTVA 4IW4E 3RC4A 2BDGA 3MNXA 3MWIU 2D92A 1MTWA 1OSSA 1GGDC 3NPSA 2O8MA 1FY1A 4BAKB 4B2BA 2P95A 1PQ5A 1VCWA 5BRRE 1F2SE 4ZXXH 5FAHA 1ZHRA 1KLTA 2CXVA 1VZQH 5FBIA 4I33A 2HWLB 1ANCA 1SLWB 3U8RH 3STJA 1P57B 2VH6A 3U69H 3MMGA 1W7XH 2TRMA 1JRSA 1DLKB 3DD2H 4H42U 3HKJB 6CHAC 1C4U2 1C5NH 1GPZA 1OWKA 2F3CE 2XYAA 4UD9H 1O3JA 4NZQA 3RUOA 2AEIH 1P12E 1GBHA 1P2KA 3BTKE 3F68H 1O5BB 2KQFA 2X7ZA 5FXLA 1SLXB 1C5VA 2W7SA 1Y3VA 1P05A 2OQUA 1AVGH 2BY7X 4YYXA 3UWJH 1PQ8A 2SGPE 3HGNA 4WY3A 2NU3E 3UTUH 5HF1A 2JH6D 1GVLA 1O3KA 2IN2A 1IQJA 1WSSH 1Z8JB 2XBYA 2KAIB 2FOMB 1HAXB 1G2MA 1V2NT 1WFVA 4FUBA 2A4RA 2P8OC 1HIAA 4CH8B 2NU2E 4DW2U 1C9TA 2J9NA 1GHXH 1SQTA 2FI5E 2BY5X 1O38A 2ZDAH 3RXTA 1UVTH 1KXCA 3MTYA 4GPGA 4M7GA 3MHWU 1Z7KA 4DIHH 1EPTA 3RXSA 2SNWA 1AGJA 3QJNA 1AUTC 2VVCA 1N7FA 2EI8A 1J15A 1DSTA 4D9RA 3K82A 4MPWA 2ZDKA 1UJVA 1DWDH 1LHFH 4BAMB 4YO9A 1CO7E 3VQGA 1GBAA 3A80A 1UTPA 4XHVA 2I4SA 1J8AA 1DUAA 2G81E 3D62A 3GY6A 3T28A 3ZYDA 4K1SA 2BLOA 2PKSB 1ZSKA 4Y0YE 4Y8YA 3RXUA 3QLPH 3SZNA 2K1ZA 5F3XA 3MH4A 3GCHB 3JZ1B 3ODDA 4WH6A 5C5NA 1C5RA 3ID2A 5I7ZA 1NRRH 2GGVB 1XZ9A 3A86A 1O34A 1TFXA 2BD4A 3ELAH 3D23A 1C2KA 3QN7A 5AF9H 1ARBA 2VH0A 4JYVH 4FUDA 1GJ4H 1AN1E 2G55A 1XVOA 3GCTF 2L97A 2FLBH 1T7CA 1TBQH 3FP6E 1SVPA 1RFNA 5HFEA 2BYGA 1NTPA 3I77A 2W3IA 2ZFQH 2Y7ZA 1DPOA 4MLFB 1DWCH 2BYAX 2CF9H 2QXGA 2IOTA 5I46H 2ANMH 1L4DA 2DC2A 4OEOA 2A7JA 2H5DA 1O5CB 3KQEA 2EI7A 3KL6A 2QY0B 2OBQA 2BQWB 2OLGA 4X8SH 2KOHA 4IMQA 1Z1JA 2QGRA 3V12A 3FY5A 1PYTC 2GMTB 2ZU3A 4FVBA 3SGQE 3RXCA 1ZHMA 1LTOA 2GZ7A 1RTKA 2QXHA 3M3SA 4DCDA 4DIIH 1LVBA 2G00A 3ZZ6A 1Q7XA 1ZTKA 1FNIA 1QAVB 3E16B 2QA9E 5G1EA 3FFGA 4FUCA 7ESTE 3T26A 3KIDU 4UFFH 2W5EA 4CR9A 3M37A 1OP2A 4JOHA 1GBLA 1W9EA 1UCYE 1FDPA 2Z17A 3CYYA 3OTPA 4BXSA 1LDTT 1HAHH 1WV7H 1S81A 2ODPA 2FWWA 2BD7A 2JINA 1EZQA 1KXAA 4P0CA 1YYY1 3TVJB 2VU8E 4FU8A 2FDAA 3LKWA 2ZDNA 1K32A 1LVYA 3BTDE 1NT1A 1EAUA 1F0RA 2GX4A 3KN2A 1CHOG 1O36A 2I04A 1SHHB 4B2CA 1HUTH 1OS8A 1CBWC 3BEFB 5HFBA 4FUFA 4CRCA 4DJZB 1Z6EA 4CRBA 4NCYA 1QRXA 2WUCA 1MC7A 2PDZA 4OGYA 3KCGH 1TLDA 1AO5A 1GJBB 1SB1H 4SGBE 1X5NA 1GM1A 1L1NA 1MQ5A 2XC5A 1HAZB 1CA0C 2BD2A 1C5XB 1VCPA 5GLJA 2RCZA 2WPKS 1SBWA 4LXBH 1V2OT 4K8YA 3D65E 1FXYA 2VIVA 2A32A 2Z9LA 2C90B 5DJ7A 5EG4A 1C1OA 1TYNA 2BTCE 1G3DA 2R2WU 1HAOH 2VGCC 2CS5A 2PKAB 2XC0A 4F4OC 3QGLA 1BZXE 1P0SH 1PDRA 1F5LA 1UTKA 2EI6A 3M5NA 1DWBH 5FHTA 4B73A 2BB4A 4X8UH 2GV7A 3ZVCA 2VB0A 1K22H 1O2KA 5F03A 1Z8RA 4NFEA 1GJ5H 3RXJA 2GT8A 2TGDA 2UZCA 5HJ1A 4VGCC 3SJKA 1KTTB 1YPJH 2FMJA 4BTIB 3PLPA 3KF2A 1EUFA 2B7DH 1UHPA 2STAE 2WPMS 2XW9A 4CR5A 3MU1A 1QURH 5DP9A 3G01A 1SGQE 2AGGX 2SGQE 2ZGCA 4TPYA 2V1WA 1YPGH 4B75A 1NS3A 1WI4A 3M61U 2BXTH 2NU1E 1BT7A 3SV2H 1DM4B 1DS2E 1BIOA 1IQEA 1C5UA 1V2WT 3SI4H 3T62A 1K1MA 4AFSA 2PUQH 2GCHG 4Q3HA 1GDUA 2OZFA 1GHYH 1FAKH 1LPKB 1EATA 1MQ6A 3GY8A 4Y11E 2A31A 2ZKSA 3QZRA 4D76A 1YLDA 4YLUA 2SGEE 2FOFA 3S9CA 3SORA 3TU7H 2KOMA 3QTVH 1MH0A 1EJNA 1UTOA 1EP5A 3SUEA 4JZIA 1AIXH 5HFDA 4CBOA 4BTUB 3RXEA 1Y5BT 1BA8B 1TOCB 5D13A 3NCLA 1GBTA 3Q3XA 3A7YA 1NU7B 5EGMA 2QKTA 3ZRTA 1VITH 4TYDA 5EYZA 2HNTE 4DG4A 1O2QA 1V2LT 4NA7A 1O2WA 1V3XA 4ISLA 1TMBH 3ZV8A 3N7OA 2K20A 2V90A 1K1IA 2HOBA 2E7KA 5LH8A 2KAIA 1Z86A 1O2RA 1AWHB 5EXNA 3T27A 1RS0A 1B0FA 1G3EA 4ISOA 1MCTA 2DLUA 4GVCA 2BLQA 1MBQA 1RGRA 1XUFA 2R2MB 1ZZZA 3KNXA 1SC8U 3RM0H 1OZIA 5JBBS 1ABIH 3SJ9A 2KJDA 4NSVA 1MZDA 1BHXF 5A8XA 3SUDA 5A2MH 1GCTB 4BOHA 1LVOA 1UVPA 2KJPA 3ZZBA 1ABJH 2Z9GA 3P95A 5HMAA 1ELBA 4NGAH 5DP6A 1V1TA 2DM8A 1GHBF 2XTTB 3Q77A 3RXBA 4AFZA 1EX3A 3CENA 1TAWA 1XUGA 4YT7H 3RXLA 3V0XA 4DVAU 3RU4T 2FI3E 3FAOA 1MTNC 3ATKA 1BCUH 1D3PB 1GJ7B 4K1TA 3NKKA 3SGAE 1EQ9A 3A7TA 3O8DA 4THNH 5K7RA 3DFLA 5HEYA 1QAUA 1GI3A 1BTHH 1SR5C 3UFAA 5DTHA 4X1RU 1ZPBA 3EGHC 2BD8A 4WF8A 3PV2A 2Z9IA 1LQEA 1SGRE 5JBAS 1GCTC 3KEEA 5EOKA 1FN6A 2G8TA 1P2OA 1V2TT 2V35A 2YUBA 1RZXA 4X6OA 2Q9VA 2YTWA 3SNAA 4KELA 3PS4A 2BLVA 3RL7A 4KGAA 2ILNA 4FUIA 5EPYA 1P2MA 3GYLB 4JYTA 2LUIA 4A5TS 5T6DA 4N6XA 4O3UA 1S5SA 1N6FA 4Z6AH 2Q1JA 1O5AB 1P8VC 2ZI2H 1QY6A 1FI8A 2PKSC 1HBTH 1PYTD 5DO4H 1UF1A 5FB8C 1IQGA 2PKAA 1TA2A 1BQYA 1W7GH 2ZPLA 3ZZAA 2H1UA 2EXGA 2PTCE 3ATMA 2GP9B 1SGPE 2TGPZ 3VFEA 1KLIH 3B23B 5T6GA 1UCYH 2ZFSA 1O39A 3EGGC 1Q31A 3FP7E 4BXWA 3TSZA 2ZDVH 1HJAB 4K3JA 3OYPA 2XC4A 1CT0E 1O3AA 1Y59T 2XNIA 3URDA 4IGDA 2LC6A 4FUJA 3LGYA 2EV8A 4AOQA 5DP7A 6LPRA 4MDSA 1W11U 2BDYA 2PSXA 1C5ZB 1SGEE 2XRCA 2FE5A 3UUZA 3B9FH 5GCHF 2ZU4A 5B6OA 1B5GH 1QA7A 1BTPA 2ZHDA 3E6PH 3B8JA 2FPZA 1O33A 2EGNA 4AG2A 4B76A 3GY4A 2FCFA 2QBWA 1GBBA 2L4TA 2PKTA 1AVXA 2R4HA 4E7NA 2A5AA 4ABGA 3RLEA 4R0IA 3DJ3A 3GDVA 1HAGE 1T8OA 3LIWA 1O3BA 1O3FA 2B9LA 3RXOA 1ZYOA 5LPFA 1RXPA 4K60A 2F0AA 1K2I1 3R0FA 2VVUA 2J38A 1GG6B 4INKA 3GISB 3P8FA 1X6DA 1BRBE 2FO9A 2V3HH 2Y82A 3VB7A 1BBRE 4JOKA 5E1YA 2BOHB 1L0ZA 2PW8H 2QCYA 2JKHA 3PLBA 2PTNA 1EZSC 2WINI 2LNCA 1TNIA 4D7GA 3BPUA 2GDDA 1QRWA 1QJ7B 5GWZA 2F9OA 1TRMA 2IPHA 1HLTH 1GMCG 1L2EA 4HZHA 4MPUA 1Y3UA 3S9BA 5E22A 2Q6DA 3RXVA 1U37A 1L1GA 3SV6A 1OOKB 5GDSH 1AUJA 2G5VA 4ISHH 1RIWC 2ZA5A 1MZAA 1O0DH 1BBRK 2GCHF 3BTHE 1O3MA 4Y7BA 1T2MA 2GZVA 4DY7B 2KPLA 1GJ8B 4OGXA 3CBZA 4XBBA 1OWEA 3A8CA 2FESH 3T25A 2Y7XA 2Y81A 3CP7A 1CBWB 4Z0KA 1CQQA 3HATH 4NWLA 7KMEH 2PKUA 4Q7ZA 1S83A 5FX6A 3ATLA 3SGBE 1NN6A 3U8OH 4ZROA 4DURA 2G52A 1UEWA 3EAJA 1AI8H 3AW0A 1ELGA 3PMHB 1N6DA 1BFEA 2CHAB 1WAYB 2EEGA 5HGGA 1GBFA 1THPB 3ZYEA 2XBVA 3RMMH 1TRYA 2QXJA 5EW2H 2ZO3H 4UFDH 4ABJA 1ESBA 4D8NA 2AINA 2KBSA 1QBNA 1YCPH 1BTYA 2ZU2A 3A87A 3U98H 1GDNA 4BTTB 1JOUB 2H3LA 3A7WA 4UFGH 2YOLA 2BD5A 1ZMJA 1ZPZA 2Q6FA 1O2ZA 1P2NA 1GI1A 1HGTH 4F49A 2W26A 2YUYA 1RTFB 1GI6A 2P93A 3H7OA 1ESTA 1XM1A 1EOJA 2VPHA 2RRMA 1QB9A 3SO3A 2D1JA 1C2FA 4H4FA 2STBE 5HM2A 3QZQA 3C27B 1O2LA 1QCPA 3SBKA 1HV7A 2PLXA 3TH3H 1O5FH 2F9UA 2OC7A 1HYLA 4K2YA 3M7UA 2F9PA 1ACBE 2F5YA 5HDYA 1UMAH 1AZZA 4NXRA 3KZEA 5EU8A 2FEQH 3MI4A 1C5WB 2IWQA 5E0GA 1EJMA 1NRNH 3OSYA 4ZKRU 2B0FA 2BVXH 2WV5A 2D2DA 1DXWA 3NWUA 1G30B 1CGJE 5JYIA 2ZHWH 3SHUA 2UWOA 1DY9A 4Q2KA 4E3BA 1G3CA 3RMNH 1GJDB 2PFEA 3A89A 1O30A 1BHXB 1C5MD 3DUXH 3LJOA 1CHGA 2GCTC 3LGTA 4GSOA 3TH4H 3SU6A 5JB8S 1IQHA 5L2YH 2EHRA 2ULLA 4QT8C 3ATIA 1VB7A 1YPLH 1SGFG 1O2MA 4P2AB 1QNJA 4UFEH 5AFYH 4Q7XA 3EDXB 1C1SA 5L2ZH 3P8OA 3TK6A 1EPTB 1O5GH 2HALA 5A0BA 2I6SA 4J2YB 2ZPMA 4KFVA 2BDAA 1D5GA 3BG4C 4JOJA 1KXEA 4Q2PA 1C1MA 1MTSA 1YC0A 2ASUB 4Y79A 4NFFA 5ESBA 1GBJA 1YPHC 3GDSA 2JWEA 4JK6A 3RLWH 1HJ8A 1MTUA 1FY4A 1DDJA 3RXQA 3UNSA 2H2CA 3GY7A 3RXFA 1AQ7A 2SNVA 5A8YA 3L3TA 4MTBA 5HETA 1HAVA 1ZRBA 2WYJA 1A2CH 1OWHA 1X5RA 1KEFA 1TX8A 2A4OA 1TQ7B 1WF8A 3WKLA 3KQDA 1WHDA 2QG1A 4NNLA 4MNXA 3TK5A 1D6RA 1GHAF 5FCKA 3HPKA 1SGNE 1NESE 3Q76A 1H9IE 2GZ8A 1Q3XA 3MO9A 3Q3YA 3A7XA 1QL9A 5FCRA 1H1BA 1P9SA 3F9HA 1P06A 1TPAE 1KXFA 2ZP0H 2H2ZA 2YNBA 6CHAB 3OY6U 4DGJA 2QAAA 1QQ4A 4NMQA 3O5NA 1AKSB 2FODA 3LC5A 5E2PA 2CSSA 1BITA 1PFXC 4E34A 2Y80A 5EODA 1OYQA 4FGMA 1IQMA 3S69A 2FIRH 1V2MT 3PV4A 1UEZA 4YESB 5F8ZA 2FM2A 3D49H 3K2UA 5EQQA 1XUKA 1UVSH 2BDBA 3A81A 2AWUA 4LZ1H 1P11E 2ZTXA 1S84A 1T32A 3UIRA 1EAIA 2JETC 5CHAC 5E0JA 2Z9JA 3JZ2B 4AX9H 2G5NA 3BF6H 1M5ZA 1O2OA 2H9TH 4A92A 3M3TA 2BY9X 4OEPA 2BD9A 2PWXA 3E91A 2DB5A 1WCZA 1NU9A 2J2UA 1TA6A 1S6FA 1ZGVA 2ALPA 3PB1E 3MU0A 1IHJA 1A46H 2ZHFH 5F6MA 3DT0H 1UVUH 2ANKH 2AMQA 4O06A 2ZFFH 2HE4A 1AB9B 3DIWA 3KQBA 1SGFA 2OINA 1CGIE 2I6VA 1S6HA 2XCFA 5DKMA 1F0SA 1BRCE 5DP5A 4NMTA 1K21H 5FPSA 1V2VT 3RXIA 1V2RT 1TNHA 1WUNH 5A2PA 1YPEH 3BSQA 2IWNA 1P02A 1SSXA 2A4GA 5DPAA 3P17H 5DK1A 1LHDH 2RA0A 2H5CA 2C8WB 4NSYA 4GHNA 3PTNA 2REYA 1ELCA 2CJIA 1NROH 3SQEE 8LPRA 3TH2H 5HYOA 3QK1A 4YOGA 1QJ1B 3QDOA 4FUHA 1ZUBA 4ABAA 4NA9H 3MNCA 1BTZA 1N99A 3BV9B 1AKSA 4Y7AA 3SNBA 3TJVA 1I16A 1O3OA 4MNWA 2A0QB 1SMFE 3S7HB 1A0JA 3SNEA 3LONA 4ZKNU 1C2GA 4B71A 1T8NA 5F8XA 1C5YB 2M5TA 2WYGA 1A7SA 4NIXA 2FP7B 2ZFPH 1FC6A 4AYYB 1LPGB 1DY8A 3BIVH 4ABBA 4WMDA 2KG2A 1QBVH 2P16A 2M0UA 5EQSA 1F5KU 2FYQA 3LH3A 4MPAA 1C5OH 3H7TA 4FUGA 2O8UA 1CHOF 2W7UA 2O2TA 4MPXA 1O2YA 2FOBA 3A83A 5TJXA 1UVOA 3BEIB 1FPHH 1OPHB 1BUIA 1H8IH 1N6XA 4XFQA 4AMHA 3OX7U 4R2ZA 3L6PA 1AE8H 4K69A 3E17A 1GHBG 3KGPA 2RG3A 1BRAA 1A3BH 1E36B 1XMNB 2FOGA 3VXEH 1YPHE 2ZHEH 4AB8A 1GI4A 4BNRA 2JH0D 1PPEE 1ETSH 1PJPA 4YLQH 1N8OB 5HM9A 2M3MA 1D9IA 5DGJA 5AFZH 3WY8A 1LQDB 1GI0A 1LVMA 4INLA 1C1PA 4CBNA 2ZPRA 1EZXC 1GHVH 1TGSZ 3OY5U 3ITIA 1FY5A 4I31A 1UHBA 1FC9A 2EDZA 1JMOH 1LKAA 2TGTA 2PGQB 2GTBA 4ZKOU 2GVFA 7GCHF 3R0HA 4XBDA 1L4ZA 3UWIA 1KXBA 4X6MA 4LK4A 1AD8H 3UREA 4U01A 4G69A 3ZZ9A 1HRTH 1BB0B 1EB1H 4K8BA 2IWOA 1TNGA 1AB9C 2ZDLA 4Y10E 1Y7NA 2XWAA 3GCTG 1CSOE 1KTSB 1QJ6B 2P3WA 2FI4E 2QXIA 1ESAA 4A1VA 2BY8X 3ID4A 1Z1IA 1TGCA 3RXKA 4AGKA 1D3QB 3NGHA 1CA8B 2A4QA 5PTPA 1U39A 1G9IE 3LDXH 1MUEB 1LKBA 2ZCLP 1O2NA 1MD7A 3ID3A 1CVWH 4WXIA 3SJ8A 3SV7A 1WFGA 1W13U 4OS1A 1WIFA 1ZJDA 3F9EA 2OQSA 3V13A 3SJOA 5K0HA 1S0RA 1O2IA 2CN0H 5HFCA 2BVRH 2EC9H 2ENOA 3SU5A 5L6NH 1VAEA 1A0HB 3HPMA 3I4WA 1GJCB 1BOQA 1QB1A 2HLCA 2XXLA 5T3HA 1N6EA 1C2HA 2KOJA 1RTLA 2GT7A 1EAXA 1RJXB 2OTVA 1MFGA 1AE5A 3UNRA 1G36A 4JOFA 4NIYA 3TGKE 2OS6A 3SOEA 1UTJA 4Y71A 1NTEA 4K78A 4HTCH 3SU2A 2EAQA 1KWAA 2Y5HA 3TNSA 1AVWA 1DICA 2AMPA 1GBMA 3T2NA 3LT3A 1DUEA 1UEPA 2WV4A 4NIVA 4PQWA 2AYWA 1ELTA 4HFPB 1NFUA 1JXPA 1WTGH 1NFYA 1O3GA 2C93B 3DFJA 3I1EA 5C2ZA 5AVDA 3LNXA 5IDKA 4Q6HA 5JPMH 1DWEH 4IC6A 2DJTA 1PPGE 2PR3A 3UOUA 3EA8A 1E0FD 1GI2A 2ZHQH 4KTUA 2GV6A 2F9BH 1NC6A 1W3CA 1TNJA 3RMOH 3CBXA 4OS2A 2RA3A 1O35A 2VIPA 1AFQC 1BMAA 1B0EA 2VWRA 3GCHC 3ZVDA 1BTWA 1ZOMA 2A5KA 4HI3A 2ESTE 3MNBA 1V2JT 4EDJA 3PYHA 1VGCB 1DE7H 3GY3A 2W7RA 3SJIA 1BBRH 1UEQA 2R0LA 1FV9A 3I29A 1TX7A 3SU0A 1GVZA 1FAXA 1SQOA 3PMJA 1QAVA 1EPTC 1CU1A 2QKVA 2ZCKP 1XXDA 4JOEA 2FXRA 1FQ3A 4XBCA 2QYIA 3ZVAA 3MOCA 3PWCA 5DP4A 2CV3A 1UTNA 1SOTA 3F6UH 3HVQC 2A7HA 4X2VA 5BPEA 3A82A 1QLCA 2SGFE 2ZPSA 5LGOA 1TGBA 2GCTB 4J1YA 1Z6JH 4CRDA 2OSGA 1F0UA 4CH2B 5HXFA 3TJNA 3P70B 3A7ZA 2TPIZ 2FNEA 3MH7A 1V2KT 1NZQH 3LGVA 1GCDA 1O5DH 3P6ZB 4GVUA 8GCHF 2OQ5A 6GCHF 1ID5H 1O2UA 2LA8A 3OU0A 3R69A 1YP9A 2ZECA 1YCPK 3U9AH 2PV9B 1TABE 1ZR0A 2FS9A 4VGCB 3BTEE 1SFIA 1GMHG 3HK6B 4CRAA 1MD8A 9ESTA 4MNVA 1D3DB 1YPKH 1A1RA 3QTOH 4LZ4B 5JDUB 1O2JA 4AZ2B 5HF4A 2Z3CA 1VJ9U 3P92A 1QHRB 3PM3A 2ZGHA 3A8BA 4XDEA 2C8YB 2ZC9H 3IITA 8GCHG 1JBUH 4KTSA 1GGDB 2QF0A 2ZNKH 3I78A 2EEHA 1QB6A 1EOLA 3MU8A 1ANBA 4ZUHA 4AGJA 3SUFA 4I32A 4WJG2 3RL8A 1DVAH 2BZAA 1DOJA 4IN1A 5CMXH 3A7VA 3PLKA 1C1UH 3AAVA 1C5PA 5IYTA 1VITG 2P94A 4X1SU 1THRH 4I8JA 4ESTE 2BD3A 1W12U 2QIQA 2WPLS 4ASHA 4BAHB 1W14U 4Q2QA 1L6OA 5H4IB 1AFEH 1HFDA 1P04A 1G37A 1WQVH 1SGYE 2BDHA 4I8KA 3FP8E 3SU1A 3ID1A 3GY2A 1UM7A 1FUJA 1I92A 4KP0A 5GIBA 2IWPA 2C8ZB 1QL8A 2O8LA 3MU4A 5HEDA 1WG6A 3KQCA 1C5TA 1BTXA 1P1EA 2D90A 2VWLA 1C2LA 3RC5A 3AASA 3A85A 4SGAE 3VXFH 5FPYA 5E6PB 1WHAA 1ZMLA 3TJOA 3PDVA 2SFAA 2GZ9A 4WWYA 3BIUH 1FJSA 5C67A 5C3NA 4JZ1A 1GQ4A 4RN6A 3RLYH 3MU5A 2HPQH 2PHBA 3PMAB 4U30A 1KYNA 3NFKA 2MX6A 1AMHA 4GHTA 3ZZ7A 3S0NA 3BN9A 1N7EA 1Y5UT 1V6DA 1C1TA 2ZU5A 2VWNA 2RCEA 5C1YA 1HAPH 1UJDA 4NMRA 2P3TB 1YBOA 2Y5GA 1P3EA 1HCGA 3P8NA 5GNDA 2D8WA 3DORA 5F67A 1E35B 4E7RG 3CC0A 3RDZA 1TP3A 1FMGA 1ZTJA 3KHVA 4ABEA 1GBIA 1DT2A 2FOEA 3TIUA 1EP6A 4XSKU 4U2WA 1HPGA 4ZMAH 4ZXYH 2B8OH 1IHTH 1TPPA 1XX9A 3M3VA 4MNYA 1PPHE 5L30H 4YM9A 2VIWA 1BMMH 2R3YA 1YM0A 2C3SA 5A0AE 4YTAA 4UU5A 3GYMA 1O3EA 2FS8A 3ZV9A 3AXAA 4KTCA 1TONA 1BMLA 1GI5A 4RKJB 2EGOA 1C4V2 1FPCH 1C2MA 1V62A 2O8TA 3SHWA 3M5MA 2H9HA 1XKAC 3QDZB 4NXPA 2Z7FE 1LO6A 3SNDA 1ZLRA 3W95A 1HJAC 1Q3PA 1BJUA 1NRQH 1BE9A 2VNTA 4FU7A 2VVVA 4NIWA 3E0PB 1O2SA 2Y5FA 1C5QA 4XOJA 2ZGBH 1T8LA 1X8SA 1V2PT 2BM2A 3HKIB 3F1SB 3PMBB 2BOKA 4JCNA 1P1DA 1UFXA 1VGCC 4CHAB 5A0CA 4RKOB 5HFFA 4I8GA 2H9EH 3PO1C 1ORFA 3ATWA 2BX3A 1SOZA 1O3IA 1IOEA 5T6FA 3TGIE 1GMHF 5FBEA 4O97A 2KA9A 5DP3A 2AWWA 1KLJH 4HGCA 2PZDA 1SQAA 2XBXA 1NRPH 5GPIB 1JIRA 2WUBA 3ZVBA 1TQ0B 2VIOA 4RSPA 1PPBH 2CSJA 2Z3DA 2W4FA 3ZZCA 2P59A 2F91A 2JREA 1VJ6A 1N7TA 3TSWA 1DXPA 4A1TA 1W10U 1UITA 1V5QA 1OP0A 1F5RA 1QFKH 3IG6B 3I18A 1C1NA 3TMHA 5E2OA 3TPIZ 3M5OA 3QE1A 1W8BH 2ZFTA 1O3CA 1AY6H 1O3LA 1MKWH 3R3GB 4OS4A 1TBZH 4Y6DA 4MVNA 1TMTH 1NPMA 1R6JA 1K1JA 5C5OA 3NZIA 2QN5T 3A88A 2BLWA 2AERH 2JETB 5CHAB 3VEQB 4JORA 2O9QA 1U6QA 2SGAA 1SGDE 3PROA 5EPNA 3M36A 1UHBB 1WH1A 1Z87A 1TGNA 2J94A 4I8LA 2UUJB 2D26C 4X8VH 3PDZA 1O2GH 3RM2H 3EQ0H 4RI0A 3QX5H 2TIOA 2P3UB 2PUXB 2KL1A 1DLEA 4H6SB 2G4UA 2ZZUH 5DP8A 3MH5A 1WU1A 3VB4A 1OBYA 3BTFE 4D9QA 1K1PA 4IMZA 1C1WH 4Q80A 1LHCH 4R8TB 3EYDA 3K65B 4A7IB 1TNLA 1FLEE 2LOBA 1K1LA 1IU0A 3SV8A 3UQVA 1OWDA 1TMUH 1J17T 4Q2NA 1A0LA 5E11A 1JWTA 1SFQB 3EE0B 2BMGB 1QBOA 4NMPA 1TGTA 3ZZDA 1B8QA 3AVZA 1GHZA 1VCQA 2LPRA 3BTTE 1MKWK 1NO9H 2VWOA 3VB3A 4UONA 4ZH8A 2CF8H 3HGPA 3U1JB 2AWXA 1B7XB 1FIZA 1M9UA 2Z9KA 3C1KA 3URCA 3RXDA 1LHGH 6ESTA 3UOPA 2VWMA 4TPIZ 1OX1A 1X7AC 2VIDA 3RC6A 5E21A 1WF7A 4YZUA 1AU8A 3MO6A 1FY3A 2HGTH 1GJAB 1O2PA 2KAWA 3M5LA 1KDQA 4Y76A 2OMJA 4WH8A 3ZZ8A 5EW1H 4Q2OA 4A1XA 2ZFRH 3SOSA 1GHWH 4NMVA 2DLSA 1FZZA 2FTMA 4CHAC 1Q2WA 1ZSLA 4Q7YA 3BEUA 3U1IB 2XBWA 3LNYA 4O9VA 1MCVA 2A5IA 1L1JA 4X2XA 5J4QA 1IQKA 1SPJA 2ZTZA 5GXPA 3WKMA 3DJ1A 1Y8TA 3RXRA 3TK9A 1C4Y2 3BTQE 1ZRKA 3GSLA 1HAVB 4I7YH 1A61H 5EXLA 2FX4A 5JXBA 1QTFA 1H9HE 2UWPA 1O5EH 4JZEH 4GUXA 1MKXK 3KZDA 2H2BA 1VITF 1TBRH 3LH1A 4ISNA 4HOPB 2BHGA 1DX5M 3SI3H 2JILA 4OAJA 1XUJA 1SG8B 4A6LA 2H6MA 2P8OB 2Z94A 4FXGH 2G51A 1O3HA 4E35A 2OCSA 4UE7H 4JOPA 3S7KB 5FX5A 2BX4A 1P2QA 4ZHLU 3FVFB 1Z8GA 4ABDA 2GDEH 3GCNA 8KME2 5EXMA 3RXPA 1GJ6A 2UUYA 5G4BA 3W94A 1OKXA 4MQAA 3MFJA 1P2IA 4U32A 3VGCB 1V6BA 3LC3A 1W0ZU 4NG9H 2J4IA 1O2VA 2PNTA 4KFWA 1C2EA 1LMWB 7GCHG 4GHQA 2AH4X 1VA8A 2RDLA 1E38B 1AHTH 1GI7B 1NM6A 4AORA 2ZPQA 2M0ZA 4DOQA 1O2XA 2ZWLH 1A5IA 1DSUA 1H4WA 2I6QA 4YOIA 4KKDA 1EZUC 1FC7A 2JIKA 1T31A 1V2UT 2Q6GA 1Y3WA 2DUCA 4X1PU 3UNQA 5GCHG 4JZFH 2AFQB 1P3CA 2XCNA 2HE2A 1IHSH 3A84A 3SN8A 2R9PA 4IS5A 3R68A 4ISIH 2A2QH 2EGKA 1XKBC 2A45B 2AGIX 4X0WU 1HIAB 1E34B 2NU0E 1V2ST 1J14A 5JBCS 1XXFA 1CT4E 4YDPA 5DG6A 1SGCA 5H3JA 2CMYA 2NWNA 2TGAA 4JK5A 3ZVEA 1BRUP 3GDUA 1W9OA 1EAWA 2FOCA 1YLCA 1C5SA 1IQFA 2DE9A 1LPZB 2YT8A 1TB6H 1T4VH 1T4UH 2ZGJA 4BAOB 3O8CA 2ZIQH 2F9NA 2BXUH 1YBWA 3EA7A 1ZOKA 3MNSA 4ZHAA 5JBTA 1HAYB 4E06H 3BG8A 3FANA 4AB9A 2KJKA 2EJYA 1C2DA 1ETTH 2FN5A 1AWFH 1PPZA 1YGCH 2HNTC 2J34A 3CS7A 5EZ0A 1Y5AT 4UU6A 1ELFA 2AIQA 4IBLH 2QV1A 3NXPA 3TLOA 3F9FA 4NWKA 5F8TA 2QT5A 1Y3YA 1RIWB 3PTBA 3S9AA 3FZDA 2G4TA 1S85A 1G2LA 4AFUA 2YNAA 3SW2B 2AMDA 2FLRH 2BDCA 2F83A 2OBOA 1V5LA 4ZAEA 3MYWA 5EQRA 1EJAA 3Q3KA 1UTMA 4UEHH 5C1XA 3LGIA 1THSH 4WVPE 4GLYA 2GMTC 1E37B 1CE5A 1ARCA 1N8OC 1OYTH 1W0YH 1ZMNA 2THFB 1MMJN 2M0VA 1JIMA 1HXEH 3ESTA 4JYUH 3V7TA 1WI2A 5TCCA 2QC2A 4PROA 3UY9A 1HXFH 1MU8B 4B2AA 1DFPA 2VSVA 4GCHG 7LPRA 1W9QA 1FIWA 3M7QA 4JL7A 4GAWA 3VB5A 1XVMA 1ELEE 3E90B 3TNTA 2EDVA 3LGUA 1TOMH 3SUGA 1OWJA 3EA9A 9LPRA 3DHKH 1WBGB 3SFJA 3K9XB 3E1XB 3SHAH 3K1RA 1BMNH 3SU3A 2OPGA 1P10A 3QWCH 4OS5A 3K50A 4JOGA 4K72A 1UTLM 1K28D 3KHFA 2I0IA 1H9LB 1KXDA 2G2LA 1IU2A 1HJ9A 2DE8A 2KPKA 1BDAA 2Z6BD 1U3BA 4AYVB 2LC7A 3Q00A 2Y6TA 4MG3A 2I0LA 4NNMA 1Z8IB 5J4SA 2I1NA 1GMDF 1GBCA 5ESTE 1FY8E 1NRSH 2B5TB 1LHEH 1N1LA 1YPMH 4AN7A 1ELAA 4HOPA 2EEIA 3GCOA 4WMFA 1D4PB 2ZQ1A 5A8ZA 3BG4B 2OXSA 1GBKA 3OTJE 2R0KA 5JB9S 2OC0A 3CS0A 1PQAA 5TCAA 2M0TA 2XWBI 4LOYH 5FPTA 3B76A 3SV9A 1QIXB 1QL7A 3LJJA 1TX6A 2HNTF 2DMZA 3VB6A 1K1NA 1EASA 1OBZA 1A4WH 1RY4A 3PWBA 3SUZA 1TPOA 2JOAA 4Q6SA 3T5FH 4GVDA 1YCPM 4FVDA 1WOFA 1SI5H 2ZCHP 2FOHA 1RGQA 1MAYA 4TWWA 4D7FA 1ZJKA 2QF3A 1GJ9B 3LGWA 2H3MA 3O8RA 4INHA 1F7ZA 4X6NA 1AFQB 1GI8B 5C20A 1DANH 1IAUA 2J95A 2FTLE 4WMEA 1NF3C 1GMCF 1GHAG 1O3NA 2CGAA 4CREA 1OP8A 2ODQA 4WYTA 2R3UA 4X8TH 2A1DB 3RXGA 4TY7A 1ZSJA 2OGPA 1KSNA 1NY22 2ALVA 2UUFB 3QO6A 2EEJA 2HVXA 1A3EH 1O2HA 3L4FD 1X45A 1SL3A 2HRVA 1WJLA 1IQNA 1MBMA 3HPTB 1BJVA 2HGAA 4WXVA 4Y8ZA 1UJUA 4IN2A 1SLUB 1YF4A 4OS7A 5B6LA 4NMOA 1VR1H 3TJUA 5SGAE 4NXQA 3DJAA 3ENSB 2OD3B 1RRKA 1UK2A 4IC5A 2EA3A 1GL0E 4MPVA 3QIKA 3F9GA 1ELVA 1G32B 4LMMA 2PA1A 2QKUA 4K5ZA 1UM1A 1G3BA 1TRNA 1GQ5A 2K1QA 1UK4A 2BDIA 1IQIA 2OUAA 3VQFA 1UTQA 1KIGH 3BTWE 1HNEE 3ZVGA 3P8GA 1Q3OA 2C8XB 4AG1A 4K75A 2F9VA 3E3TA 4NA8A 1SGTA 3RP2A 1ZHPA 2P3FH 6GCHG 4WYUA 1MTNB 4REYA 2GD4B 3RU4E 3CBYA 1IQLA 3SQHE 3UQOA 1OWIA 4Y8XA 2PGBB 3IWMA 1S82A 1ZGIA 1O3PB 1MU6B 1NFWA 3ZZ3A 1A5HA 4YT6H 1NFXA 4O03A 4I8HA 2KRGA 4F8KA 1GWAA 4OS6A 2FOAA 5E8EH 1KDQB 2CHAC 5A09A 2FX6A 3SHCH 1GMDG 1QA0A 2EDPA 2D8IA 2ZEBA 2ZG0H 4B74A 1W2KH 4DT7B 4Z33A 3EGKH 2OC8A 1J16A 2ZQ2A 1K9OE 2JXOA 1INCA 3LU9B 3BTME 3K6YA 1C5LH 2DAZA 1N6YA 2OC1A 4K76A 1O2TA 2G5MB 2WPIS 3E8LA 3M7TA 4Y0ZE
chains in the Genus database with same CATH superfamily
1BTUA 3AAUA 2BQ6B 1GVKB 4ABFA 4CRGA 4TY6A 3O46A 1SLVB 5LPEA 3K6ZA 2C4FH 3PV5A 1GBEA 1QR3E 4ZKSU 3FZZA 3QGNB 3QJMA 1C2IA 1HAIH 4XE4A 1G9OA 2BQ7B 3STIA 1QGFA 1O3DA 1SQRA 3ZVFA 3A8DA 2FYRA 3GY5A 3A8AA 1ELDE 3PO1B 4JMYA 3F0OA 2VJ1A 5ETXA 4E05H 4GCHF 3RXAA 1UK3A 2A2XH 2VINA 2NU4E 2O8WA 3M35A 1QQUA 4NMSA 1P03A 1TALA 1RD3B 1TIOA 3QGJA 1O37A 4BANB 1F0TA 5AHGH 1WQSA 4UDWH 3VPKA 1UO6A 1ZPCA 2A7CA 1FCFA 1GG6C 3LPRA 4ZHMU 2ZF0H 2YT7A 1C9PA 2UUKB 4X2YA 4X2WA 1J9CH 1WYKA 1ANDA 3N7DA 1XUHA 1GL1A 1KY9A 1X5QA 4FLNA 3GJ9A 1YKTA 2V3OH 1P09A 3V3MA 3ZZ5A 4B1TA 1A5GH 3SZEA 3VGCC 5C1UA 5I25A 2KYLA 2J5UA 1EB2A 1TQ3A 2ZU1A 2L4SA 2VSPA 1O31A 2IJOB 1DITH 2BZ6H 2J92A 1C1VH 2WL7A 5ABWA 1OBXA 5GJ4B 4ABHA 2YMSD 2M10A 1MFLA 1SGIB 1ZTLA 2OCVB 1TE0A 2BVSH 3DCLA 1LCYA 2QF4A 1TP5A 1C2JA 1MAXA 1PPCE 2AGEX 2WPJS 2PSYA 3T29A 3UR9A 4H11A 5E0HA 4O3TA 3MO3A 3UPEA 3CH8A 3SU4A 1PPFE 3L33A 4ZCNA 1RGWA 3BTGE 5HEBA 1WTHD 1GDQA 3QUMP 2KV8A 2GKVE 1QRZA 2VGCB 2ANYA 1FONA 1P9UA 4FUEA 1PQ7A 1XUIA 3NFLA 2ANWA 2WPHS 3LOXA 1SHYA 3E0NB 4CRFA 3O8BA 2XNDD 1GI9B 1UJ1A 4X1NU 1F92A 4ABIA 5LPRA 3RXMA 3RXHA 3AW1A 4Z8JA 2GJGA 2V0BA 2ZGXH 1GBDA 1CGHA 4TWYA 3HK3B 2ZDMA 3JXTA 2FZZA 2MHOA 1H8DH 1O32A 1OXGA 1CA0B 1HB0B 1CT2E 2V6NA 4JJ0A 1P2JA 2HPPH 4K1EA 2JH5D 1JRTA 3NK8A 1TPSA 4X1QU 4YOJA 1D6WA 4FU9A 3RMLH 1UCYK 3SNCA 1VJAU 1FN8A 2L74A 2K0QA 1EKBB 4JJ3A 3TGJE 2Z3EA 4K6YA 4NZLA 3RU4D 1T8MA 2ODYB 1ETRH 1S0QA 3GOVB 4L8NA 1Y3XA 1ANEA 3NUMA 1V2QT 3GICB 5CE1A 1D3TB 2VIQA 3DA9B 3MH6A 2Q3GA 5HIYA 3UR6A 4H6TA 4AFQA 4BAQB 2SGDE 5G1DA 2AS9A 2UWLA 1EXFA 2VRFA 2W3KA 2KCOA 1U38A 3ODFA 2TBSA 3ZZ4A 3TITA 4JZDH 4AC9A 1TNKA 2AIPA 4X6PA 2OP9A 1HDTH 1AZ8A 1P01A 2ZTYA 2BY6X 3GGEA 1C1RA 4FETA 2EEKA 2DKRA 1TWXB 1Z71A 3U8TH 2VZ5A 1C1QA 3H5CB 1MKXH 1BMFD 3TSVA 1K1OA 8ESTE 1MTVA 4IW4E 3RC4A 2BDGA 3MNXA 3MWIU 2D92A 1MTWA 1OSSA 1GGDC 3NPSA 2O8MA 1FY1A 4BAKB 4B2BA 2P95A 1PQ5A 1VCWA 5BRRE 1F2SE 4ZXXH 5FAHA 1ZHRA 1KLTA 2CXVA 1VZQH 5FBIA 4I33A 2HWLB 1ANCA 1SLWB 3U8RH 3STJA 1P57B 2VH6A 3U69H 2WPDD 3MMGA 1W7XH 2TRMA 5EJLA 1JRSA 1DLKB 3DD2H 4H42U 3HKJB 6CHAC 1C4U2 1C5NH 1GPZA 1OWKA 2F3CE 2HLDD 2XYAA 4UD9H 1O3JA 2RFKC 4NZQA 3RUOA 2AEIH 2KCYA 1P12E 1GBHA 1P2KA 3BTKE 3F68H 1O5BB 2KQFA 2X7ZA 5FXLA 1SLXB 1C5VA 2W7SA 1Y3VA 1P05A 2OQUA 1AVGH 2BY7X 4YYXA 3UWJH 1PQ8A 2SGPE 3HGNA 4WY3A 2NU3E 3UTUH 5HF1A 2JH6D 1GVLA 1O3KA 2IN2A 1IQJA 1WSSH 1Z8JB 2XBYA 2KAIB 2FOMB 1HAXB 1G2MA 1V2NT 1WFVA 4FUBA 2A4RA 2P8OC 1HIAA 4CH8B 2NU2E 4DW2U 1C9TA 2J9NA 1GHXH 1SQTA 2FI5E 2BY5X 2IJD1 1O38A 2ZDAH 3RXTA 1UVTH 1KXCA 3MTYA 4GPGA 4M7GA 3MHWU 1Z7KA 4DIHH 1EPTA 3RXSA 2SNWA 1AGJA 3QJNA 2HVYB 1AUTC 2VVCA 1N7FA 2EI8A 1J15A 1DSTA 4D9RA 3K82A 4MPWA 2ZDKA 1UJVA 1DWDH 1LHFH 4BAMB 4YO9A 1CO7E 3VQGA 1GBAA 3A80A 4DT4A 1UTPA 4XHVA 2I4SA 1J8AA 1DUAA 2G81E 3D62A 3GY6A 3T28A 2YMSC 3ZYDA 2KFWA 4K1SA 2BLOA 2PKSB 1ZSKA 4Y0YE 4Y8YA 3RXUA 3QLPH 3SZNA 2K1ZA 5F3XA 3MH4A 3GCHB 3JZ1B 3ODDA 4WH6A 5C5NA 1C5RA 3ID2A 5I7ZA 1NRRH 2GGVB 1XZ9A 3A86A 1O34A 1TFXA 2BD4A 3ELAH 3D23A 1C2KA 3QN7A 5AF9H 1ARBA 2VH0A 4JYVH 4FUDA 1GJ4H 1AN1E 2G55A 1XVOA 3GCTF 2L97A 2FLBH 1T7CA 1TBQH 3FP6E 1SVPA 1RFNA 5HFEA 2BYGA 1NTPA 3I77A 2W3IA 2ZFQH 2Y7ZA 1DPOA 4MLFB 1DWCH 2BYAX 2CF9H 2QXGA 2IOTA 5I46H 2ANMH 1L4DA 2DC2A 4OEOA 2A7JA 2H5DA 1O5CB 3KQEA 2EI7A 3KL6A 1X9ZA 2QY0B 2OBQA 2BQWB 2OLGA 4X8SH 2KOHA 4IMQA 1Z1JA 2QGRA 3V12A 3FY5A 1PYTC 2GMTB 2ZU3A 4FVBA 3SGQE 3RXCA 1ZHMA 2QE7D 1LTOA 2GZ7A 1RTKA 2QXHA 3M3SA 4DCDA 4DIIH 5FL7D 1LVBA 2G00A 3ZZ6A 1Q7XA 1ZTKA 1FNIA 1QAVB 3E16B 2QA9E 5G1EA 3FFGA 4FUCA 7ESTE 3T26A 3KIDU 4UFFH 2W5EA 3PRBA 4CR9A 3M37A 1OP2A 4JOHA 1GBLA 1W9EA 1UCYE 1FDPA 2Z17A 3KYFA 3CYYA 3OTPA 4BXSA 1LDTT 1HAHH 1WV7H 1S81A 2ODPA 2FWWA 2BD7A 2JINA 1EZQA 1KXAA 4P0CA 1YYY1 3TVJB 2VU8E 4FU8A 2FDAA 3LKWA 2F4LA 1K32A 2ZDNA 1LVYA 3BTDE 1QZ8A 2JSNA 1NT1A 1EAUA 1F0RA 2GX4A 3KN2A 1CHOG 1O36A 2I04A 1SHHB 4B2CA 1HUTH 1OS8A 1CBWC 4F55A 3BEFB 5HFBA 4FUFA 4CRCA 4DJZB 1Z6EA 4CRBA 4NCYA 1QRXA 2WUCA 1MC7A 2PDZA 4OGYA 3KCGH 1TLDA 1AO5A 1GJBB 1SB1H 3PRDA 4SGBE 1X5NA 1GM1A 1L1NA 1MQ5A 2EQNA 2XC5A 1HAZB 1CA0C 3WWBA 2BD2A 1C5XB 1VCPA 5GLJA 2RCZA 2WPKS 1SBWA 4LXBH 1V2OT 4K8YA 2IPQX 3D65E 1FXYA 2VIVA 2A32A 2Z9LA 2C90B 5DJ7A 5EG4A 1C1OA 1TYNA 2BTCE 1G3DA 2R2WU 1HAOH 2VGCC 2CS5A 2PKAB 2XC0A 3WWFA 3QGLA 4F4OC 1BZXE 1P0SH 1PDRA 1F5LA 1UTKA 2EI6A 3M5NA 1DWBH 5FHTA 4B73A 2BB4A 4X8UH 2GV7A 3ZVCA 2VB0A 1K22H 1O2KA 5F03A 1Z8RA 4NFEA 1GJ5H 3DSPA 3RXJA 2GT8A 2TGDA 2UZCA 5HJ1A 4VGCC 3SJKA 1KTTB 1YPJH 2FMJA 4BTIB 3PLPA 3KF2A 1EUFA 2B7DH 1UHPA 2STAE 2WPMS 2XW9A 4CR5A 3MU1A 1QURH 5DP9A 3G01A 1SGQE 2AGGX 2SGQE 2ZGCA 4TPYA 2V1WA 1YPGH 4B75A 1NS3A 1WI4A 3M61U 2BXTH 2NU1E 1BT7A 3SV2H 1DM4B 1DS2E 1BIOA 1IQEA 1C5UA 1V2WT 3SI4H 3T62A 1K1MA 4AFSA 2PUQH 2GCHG 4Q3HA 1GDUA 2OZFA 1GHYH 1FAKH 1LPKB 1EATA 1MQ6A 3GY8A 4Y11E 2A31A 2ZKSA 3QZRA 3UB0A 4D76A 1YLDA 4YLUA 2SGEE 2FOFA 3S9CA 3SORA 3TU7H 2KOMA 3QTVH 1MH0A 1EJNA 1UTOA 1EP5A 3SUEA 4JZIA 1AIXH 5HFDA 4CBOA 4BTUB 3RXEA 1Y5BT 1H8ED 1BA8B 1TOCB 2OK5A 5D13A 3NCLA 1GBTA 3Q3XA 3A7YA 1NU7B 5EGMA 2QKTA 3ZRTA 1VITH 4TYDA 5EYZA 2HNTE 4DG4A 1O2QA 1V2LT 4NA7A 2WZQA 1O2WA 1V3XA 4ISLA 1TMBH 3ZV8A 3N7OA 2K20A 2V90A 1K1IA 2HOBA 2KCAA 2E7KA 5LH8A 2KAIA 1Z86A 1O2RA 1AWHB 5EXNA 3T27A 3AK5A 1RS0A 1B0FA 1G3EA 4ISOA 1KMHB 1MCTA 1YLNA 2DLUA 4GVCA 2BLQA 1MBQA 1RGRA 1XUFA 2R2MB 1ZZZA 3KNXA 1SC8U 3RM0H 1OZIA 5JBBS 1ABIH 3SJ9A 2KJDA 4NSVA 1MZDA 1BHXF 3SYJA 5A8XA 2J97A 3SUDA 5A2MH 1GCTB 4BOHA 1LVOA 1UVPA 2KJPA 3ZZBA 1ABJH 2Z9GA 3P95A 5KECA 5HMAA 1ELBA 4NGAH 5DP6A 1V1TA 2DM8A 1GHBF 2XTTB 3Q77A 3RXBA 4AFZA 1EX3A 3CENA 1TAWA 1XUGA 4YT7H 3RXLA 3V0XA 4DVAU 3RU4T 2FI3E 3FAOA 1MTNC 3ATKA 1BCUH 1D3PB 1GJ7B 4K1TA 2GEFA 3NKKA 3SGAE 1EQ9A 3A7TA 3O8DA 3MQKC 4THNH 5K7RA 3DFLA 5HEYA 1QAUA 1GI3A 1BTHH 1SR5C 3UFAA 5DTHA 4X1RU 1ZPBA 3EGHC 2BD8A 4WF8A 3PV2A 2Z9IA 1LQEA 1SGRE 5JBAS 1GCTC 3F0PA 3KEEA 5EOKA 1FN6A 2G8TA 1P2OA 1V2TT 2V35A 3GABA 2YUBA 1RZXA 4X6OA 2Q9VA 2YTWA 3SNAA 4KELA 3PS4A 1S6LA 2BLVA 3RL7A 4KGAA 2ILNA 4FUIA 5EPYA 1P2MA 3GYLB 4JYTA 2LUIA 4A5TS 5T6DA 4N6XA 4O3UA 1S5SA 1N6FA 4Z6AH 2Q1JA 1O5AB 1P8VC 2ZI2H 1QY6A 1FI8A 2PKSC 1HBTH 1PYTD 5DO4H 1UF1A 5FB8C 1IQGA 2PKAA 1TA2A 1BQYA 1W7GH 2ZPLA 3ZZAA 2H1UA 2EXGA 2PTCE 3ATMA 2GP9B 1SGPE 2TGPZ 3VFEA 1KLIH 3B23B 5T6GA 2KX4A 1UCYH 2ZFSA 1O39A 3EGGC 1Q31A 3FP7E 4BXWA 3TSZA 2ZDVH 1HJAB 4K3JA 3OYPA 2XC4A 1CT0E 1O3AA 1MABB 1Y59T 2XNIA 3URDA 4IGDA 2LC6A 4FUJA 3LGYA 2EV8A 4AOQA 5DP7A 6LPRA 4MDSA 1W11U 2BDYA 3F2FA 2PSXA 1C5ZB 1SGEE 2XRCA 2FE5A 3UUZA 3B9FH 5GCHF 2ZU4A 5B6OA 1B5GH 1QA7A 1BTPA 2ZHDA 3E6PH 3B8JA 2FPZA 1O33A 2EGNA 4AG2A 4B76A 3GY4A 2FCFA 2QBWA 1GBBA 2L4TA 2PKTA 1AVXA 2R4HA 4E7NA 2A5AA 4ABGA 3RLEA 4R0IA 3DJ3A 3GDVA 1HAGE 1T8OA 3LIWA 1O3BA 1O3FA 2B9LA 3RXOA 1ZYOA 5LPFA 1RXPA 4K60A 2F0AA 1K2I1 3R0FA 2VVUA 2J38A 1GG6B 4INKA 3GISB 3P8FA 1X6DA 1BRBE 2FO9A 2V3HH 2Y82A 3VB7A 1BBRE 4JOKA 5E1YA 2BOHB 2J98B 1L0ZA 2PW8H 2QCYA 2JKHA 3PLBA 2PTNA 1EZSC 2WINI 2LNCA 1TNIA 4D7GA 3BPUA 2GDDA 1QRWA 1QJ7B 5GWZA 2F9OA 1TRMA 2WSSD 2IPHA 1HLTH 3DSOA 1GMCG 1L2EA 2QF5A 4HZHA 1Y3UA 4MPUA 5E22A 2Q6DA 3S9BA 3RXVA 1U37A 1L1GA 3SV6A 1OOKB 5GDSH 1AUJA 2G5VA 4ISHH 1RIWC 2ZA5A 3NRLA 1MZAA 1O0DH 1BBRK 5IL9A 2GCHF 1O3MA 3BTHE 4Y7BA 1T2MA 2GZVA 4DY7B 2KPLA 1GJ8B 4OGXA 3CBZA 4XBBA 1OWEA 3A8CA 2FESH 3T25A 2Y7XA 2Y81A 3CP7A 3DSGA 1CBWB 4Z0KA 1CQQA 3HATH 4NWLA 7KMEH 2PKUA 4Q7ZA 1S83A 5FX6A 3ATLA 3SGBE 1NN6A 3U8OH 4ZROA 4DURA 3F3BA 5HKKD 2W6JD 4HG6A 2G52A 1UEWA 4M9FA 3EAJA 1AI8H 3AW0A 1ELGA 3PMHB 1N6DA 1BFEA 2CHAB 1WAYB 2EEGA 5HGGA 1GBFA 1THPB 3ZYEA 2XBVA 3RMMH 1TRYA 2QXJA 5EW2H 2ZO3H 4UFDH 4ABJA 1ESBA 5C17A 4D8NA 2AINA 2KBSA 1QBNA 4Q63A 1YCPH 1BTYA 2ZU2A 3A87A 3U98H 1GDNA 4BTTB 1JOUB 2H3LA 3A7WA 4UFGH 4Z1MD 2YOLA 2BD5A 1ZMJA 1ZPZA 2Q6FA 1O2ZA 1P2NA 1GI1A 1HGTH 4F49A 2W26A 2YUYA 1OHHD 1RTFB 1GI6A 2P93A 3H7OA 1ESTA 1XM1A 1EOJA 2VPHA 2RRMA 1QB9A 3SO3A 2D1JA 1C2FA 4H4FA 2STBE 5HM2A 3QZQA 3C27B 1O2LA 1QCPA 3SBKA 4B6FA 2JJ1D 1HV7A 2PLXA 3TH3H 1O5FH 2F9UA 2OC7A 1HYLA 4K2YA 3M7UA 2F9PA 1ACBE 2F5YA 5HDYA 1UMAH 1AZZA 4NXRA 3KZEA 5EU8A 2FEQH 3MI4A 1C5WB 2IWQA 5E0GA 1SKYE 1EJMA 1NRNH 3OSYA 4ZKRU 2B0FA 2BVXH 2WV5A 5CDFE 2D2DA 1DXWA 3NWUA 1G30B 1CGJE 4TT3D 5JYIA 2ZHWH 3SHUA 2UWOA 1DY9A 4Q2KA 4E3BA 1G3CA 3RMNH 1GJDB 2PFEA 3A89A 1O30A 1BHXB 1C5MD 5B42A 1YWUA 3DUXH 3LJOA 1CHGA 3WW7A 2GCTC 3LGTA 4GSOA 3TH4H 3SU6A 5JB8S 1IQHA 5L2YH 2EHRA 2ULLA 4QT8C 3ATIA 1VB7A 1YPLH 1SGFG 1O2MA 4P2AB 1QNJA 4UFEH 5AFYH 4Q7XA 3EDXB 1C1SA 5L2ZH 3P8OA 4Q4LA 3TK6A 1EPTB 1O5GH 2HALA 5A0BA 2I6SA 4J2YB 2XOKD 2ZPMA 4KFVA 2F43B 2BDAA 1D5GA 3BG4C 4JOJA 1KXEA 4Q2PA 1C1MA 1MTSA 1YC0A 2ASUB 4Y79A 2LP6A 4NFFA 1GBJA 1YPHC 3GDSA 3KDKA 5ESBA 2JWEA 4JK6A 3RLWH 1HJ8A 1MTUA 1FY4A 1DDJA 3RXQA 3UNSA 2H2CA 3GY7A 3RXFA 1AQ7A 2SNVA 5A8YA 3L3TA 4MTBA 3NCVA 5HETA 1HAVA 1ZRBA 2WYJA 1A2CH 1OWHA 3VG8A 1X5RA 1KEFA 1TX8A 2A4OA 1TQ7B 1WF8A 3WKLA 3KQDA 1WHDA 2QG1A 4NNLA 4MNXA 3TK5A 1D6RA 1GHAF 5FCKA 3HPKA 1SGNE 1NESE 3Q76A 1H9IE 2GZ8A 1Q3XA 3MO9A 1E1RD 3Q3YA 3A7XA 1QL9A 5FCRA 1H1BA 1P9SA 3F9HA 1P06A 1TPAE 1KXFA 2ZP0H 2H2ZA 2YNBA 6CHAB 3OY6U 4DGJA 2QAAA 1QQ4A 4NMQA 3KQ5A 3O5NA 1AKSB 2FODA 3LC5A 5E2PA 2CSSA 1BITA 1PFXC 4E34A 2Y80A 5EODA 1OYQA 4FGMA 1IQMA 3S69A 2FIRH 1V2MT 3PV4A 1UEZA 4YESB 5F8ZA 5KGOA 2FM2A 3D49H 3K2UA 5EQQA 1XUKA 1UVSH 2BDBA 3A81A 2AWUA 4LZ1H 1P11E 2ZTXA 1S84A 1T32A 3UIRA 1EAIA 2JETC 5CHAC 5E0JA 2Z9JA 3JZ2B 4AX9H 2G5NA 3BF6H 1M5ZA 1E1QD 1O2OA 2H9TH 4A92A 3M3TA 2BY9X 4OEPA 2BD9A 2PWXA 3E91A 2DB5A 1WCZA 1NU9A 2J2UA 1TA6A 1S6FA 1ZGVA 2ALPA 3PB1E 3MU0A 1IHJA 1A46H 2ZHFH 5F6MA 3DT0H 3CNRA 1UVUH 2ANKH 2AMQA 4O06A 2ZFFH 2HE4A 1AB9B 3FN8A 3DIWA 3KQBA 1SGFA 2OINA 1CGIE 2I6VA 1S6HA 2XCFA 5DKMA 1F0SA 1BRCE 5DP5A 4NMTA 1K21H 5FPSA 1V2VT 3RXIA 1V2RT 1TNHA 1WUNH 5A2PA 1YPEH 3BSQA 2IWNA 1P02A 1SSXA 2A4GA 5DPAA 3P17H 5DK1A 1LHDH 2RA0A 2H5CA 2C8WB 4NSYA 4GHNA 3PTNA 2REYA 1ELCA 2CJIA 1NROH 3SQEE 8LPRA 3TH2H 5HYOA 3QK1A 4YOGA 1QJ1B 3QDOA 4FUHA 1ZUBA 4ABAA 4NA9H 3MNCA 1BTZA 1N99A 3BV9B 1AKSA 4Y7AA 3SNBA 3TJVA 1I16A 1O3OA 4MNWA 2A0QB 1SMFE 3S7HB 1A0JA 3SNEA 3LONA 4ZKNU 1C2GA 4B71A 1T8NA 3OFND 5F8XA 1C5YB 2M5TA 2WYGA 1A7SA 4NIXA 2FP7B 2ZFPH 1FC6A 4AYYB 1LPGB 5EJ1A 4ACBA 1DY8A 3BIVH 3F2GA 4ABBA 4WMDA 5IK2D 2KG2A 1QBVH 2P16A 2M0UA 5EQSA 1F5KU 2FYQA 3LH3A 4MPAA 1C5OH 3H7TA 4FUGA 2O8UA 1CHOF 2W7UA 2O2TA 4MPXA 1O2YA 2FOBA 3A83A 5TJXA 1UVOA 3BEIB 1FPHH 1OPHB 1BUIA 1H8IH 1N6XA 4XFQA 4AMHA 3OX7U 4R2ZA 3L6PA 1AE8H 4K69A 3E17A 1GHBG 3KGPA 2RG3A 1BRAA 1A3BH 1E36B 4TSFD 1XMNB 2FOGA 3VXEH 1YPHE 2ZHEH 4AB8A 5HIZA 5KEDA 1GI4A 4BNRA 4RT0A 2JH0D 1PPEE 1ETSH 1PJPA 4YLQH 1N8OB 5HM9A 2M3MA 1D9IA 1W0KD 5AFZH 5DGJA 3WY8A 1LQDB 1GI0A 1LVMA 4INLA 1C1PA 4CBNA 2ZPRA 1EZXC 1GHVH 1TGSZ 3OY5U 3ITIA 1FY5A 4I31A 1UHBA 1FC9A 2EDZA 1JMOH 1LKAA 2TGTA 2PGQB 2GTBA 4ZKOU 1NBMD 2GVFA 7GCHF 3R0HA 4XBDA 1L4ZA 3UWIA 1KXBA 5C94A 4X6MA 4LK4A 1AD8H 3UREA 4U01A 2CK3D 4G69A 3ZZ9A 1HRTH 1BB0B 1EB1H 4K8BA 2IWOA 1TNGA 1AB9C 2ZDLA 4Y10E 1Y7NA 2XWAA 3GCTG 1CSOE 1KTSB 1QJ6B 2P3WA 2FI4E 2QXIA 1ESAA 4A1VA 2BY8X 5C0TA 3ID4A 1Z1IA 1TGCA 3RXKA 4AGKA 1D3QB 4ACAA 3NGHA 1CA8B 2A4QA 5PTPA 1U39A 1G9IE 3LDXH 1MUEB 1LKBA 2ZCLP 1O2NA 1MD7A 3ID3A 1CVWH 4WXIA 3SJ8A 3SV7A 1WFGA 1W13U 4OS1A 1WIFA 1ZJDA 3F9EA 2OQSA 3V13A 3SJOA 5K0HA 1S0RA 3ZIAD 1O2IA 2CN0H 3W1EA 5HFCA 2BVRH 2EC9H 3EE7A 2ENOA 3SU5A 5L6NH 1VAEA 1A0HB 3HPMA 3I4WA 1GJCB 1BOQA 1QB1A 2HLCA 2XXLA 5T3HA 1N6EA 1C2HA 2KOJA 1RTLA 2GT7A 1EAXA 1RJXB 2OTVA 1MFGA 1AE5A 3UNRA 1G36A 4JOFA 4NIYA 3TGKE 2OS6A 3SOEA 1UTJA 4Y71A 1NTEA 4K78A 4HTCH 3SU2A 4F48B 2EAQA 1KWAA 1EFRD 2Y5HA 3TNSA 1AVWA 1DICA 2AMPA 1GBMA 3T2NA 3LT3A 1DUEA 1UEPA 3N99A 2WV4A 4NIVA 4PQWA 2AYWA 1ELTA 4HFPB 1NFUA 1JXPA 1WTGH 1NFYA 1O3GA 2C93B 3DFJA 3I1EA 5C2ZA 5AVDA 3LNXA 5IDKA 4Q6HA 5JPMH 1DWEH 4IC6A 2DJTA 1PPGE 2PR3A 3UOUA 3EA8A 1E0FD 1GI2A 2ZHQH 4XRNA 4KTUA 2GV6A 2F9BH 2KM0A 1NC6A 1W3CA 1TNJA 3RMOH 3CBXA 4OS2A 3OEED 2RA3A 5DSFA 1O35A 2VIPA 1AFQC 1BMAA 1B0EA 2VWRA 3GCHC 3ZVDA 3N7EA 1BTWA 1ZOMA 2A5KA 4HI3A 2ESTE 3MNBA 1V2JT 2YMSB 4EDJA 3PYHA 1VGCB 1DE7H 3GY3A 2W7RA 3SJIA 1BBRH 1UEQA 2R0LA 1FV9A 3I29A 1TX7A 3SU0A 1GVZA 1FAXA 1SQOA 3PMJA 1QAVA 1EPTC 1CU1A 2QKVA 2ZCKP 1XXDA 4JOEA 2FXRA 1FQ3A 4XBCA 2QYIA 3ZVAA 3MOCA 3PWCA 5DP4A 2CV3A 1UTNA 1SOTA 3F6UH 3HVQC 2A7HA 4X2VA 5BPEA 3A82A 1QLCA 2SGFE 2ZPSA 5LGOA 1TGBA 2GCTB 4J1YA 1Z6JH 4CRDA 2OSGA 1F0UA 4CH2B 5HXFA 3TJNA 3P70B 3A7ZA 2TPIZ 2FNEA 3MH7A 1V2KT 1NZQH 3LGVA 1GCDA 1O5DH 3P6ZB 4GVUA 8GCHF 2OQ5A 6GCHF 1ID5H 5EIYA 1O2UA 2LA8A 3OU0A 3R69A 1H8HD 1YP9A 2ZECA 1YCPK 3U9AH 2PV9B 1TABE 1ZR0A 2FS9A 2PP6A 4VGCB 3BTEE 1SFIA 1GMHG 3HK6B 4CRAA 1MD8A 9ESTA 4MNVA 1D3DB 1YPKH 1A1RA 3QTOH 4LZ4B 5JDUB 1O2JA 4AZ2B 5HF4A 2Z3CA 5T1VA 1VJ9U 3P92A 1QHRB 3PM3A 2ZGHA 1E79D 3A8BA 4XDEA 2C8YB 2ZC9H 3IITA 2KZ4A 8GCHG 1JBUH 2V7QD 4KTSA 1GGDB 2QF0A 2ZNKH 3I78A 2EEHA 1QB6A 1EOLA 3MU8A 1ANBA 4ZUHA 4AGJA 3SUFA 4I32A 4WJG2 1WXRA 3RL8A 1DVAH 2BZAA 1DOJA 4IN1A 5CMXH 1YY3A 3A7VA 3PLKA 1C1UH 3AAVA 1C5PA 5IYTA 1VITG 2P94A 4X1SU 1THRH 4I8JA 4ESTE 2BD3A 1W12U 2QIQA 2WPLS 4ASHA 4BAHB 1W14U 4Q2QA 1L6OA 5H4IB 1AFEH 1HFDA 1P04A 1G37A 1WQVH 1SGYE 2BDHA 4I8KA 3FP8E 3SU1A 3ID1A 3GY2A 1UM7A 1FUJA 1I92A 2L6OA 4KP0A 5GIBA 2IWPA 2C8ZB 2J98A 1QL8A 2O8LA 3MU4A 5HEDA 1WG6A 3KQCA 1C5TA 1BTXA 1P1EA 2D90A 2VWLA 1C2LA 3RC5A 3AASA 3A85A 4SGAE 3VXFH 5FPYA 4B6EA 5E6PB 1WHAA 1ZMLA 3TJOA 3PDVA 2SFAA 2GZ9A 4WWYA 3BIUH 1FJSA 5C67A 5C3NA 4JZ1A 1GQ4A 4RN6A 2KR7A 3F2HA 3RLYH 3MU5A 2HPQH 2PHBA 3PMAB 4U30A 1KYNA 3NFKA 2MX6A 1AMHA 4GHTA 3ZZ7A 3S0NA 3BN9A 1N7EA 1Y5UT 1V6DA 1C1TA 2ZU5A 2VWNA 2RCEA 3OEHD 5C1YA 1UJDA 4NMRA 1HAPH 2P3TB 1YBOA 2Y5GA 1P3EA 1HCGA 3P8NA 5GNDA 2D8WA 3DORA 5F67A 1E35B 4E7RG 3CC0A 3RDZA 1TP3A 1FMGA 1ZTJA 1NBME 3KHVA 4ABEA 1GBIA 1DT2A 2FOEA 3TIUA 1EP6A 4XSKU 5ILBA 3UAIC 4U2WA 1HPGA 4ZMAH 4ZXYH 2WHXA 2B8OH 1IHTH 1TPPA 1XX9A 3M3VA 4MNYA 1PPHE 5L30H 4YM9A 2VIWA 1BMMH 2R3YA 1YM0A 2C3SA 5A0AE 4YTAA 4UU5A 3GYMA 1O3EA 2FS8A 3ZV9A 3AXAA 4KTCA 1TONA 1BMLA 1GI5A 4RKJB 2EGOA 1C4V2 1FPCH 1C2MA 1V62A 2O8TA 3SHWA 3M5MA 2H9HA 1XKAC 3QDZB 4NXPA 2Z7FE 1LO6A 3SNDA 1ZLRA 3W95A 4YXWD 1HJAC 1Q3PA 1BJUA 1NRQH 2JIZD 1BE9A 2VNTA 4FU7A 2VVVA 4NIWA 3E0PB 1O2SA 2Y5FA 1C5QA 4XOJA 2ZGBH 1T8LA 1X8SA 1V2PT 2BM2A 3HKIB 3F1SB 3PMBB 2BOKA 4JCNA 1P1DA 1UFXA 1VGCC 4CHAB 5A0CA 4RKOB 5HFFA 4I8GA 2H9EH 3PO1C 1ORFA 3ATWA 2BX3A 1SOZA 1O3IA 4OM9A 1IOEA 5T6FA 3TGIE 1GMHF 5FBEA 3FKSD 4O97A 2KA9A 5DP3A 2AWWA 1KLJH 4HGCA 2PZDA 1SQAA 2XBXA 1NRPH 5GPIB 1JIRA 2WUBA 3ZVBA 1TQ0B 2VIOA 4RSPA 1PPBH 2CSJA 2Z3DA 2W4FA 3ZZCA 2P59A 2F91A 2JREA 1VJ6A 1N7TA 3TSWA 1DXPA 4A1TA 1W10U 5F53A 1UITA 1V5QA 1OP0A 1F5RA 1QFKH 3IG6B 3I18A 1C1NA 3TMHA 5E2OA 3TPIZ 3M5OA 3QE1A 1W8BH 2ZFTA 1O3CA 1AY6H 1O3LA 1MKWH 3R3GB 4OS4A 1TBZH 4Y6DA 4MVNA 5C0UA 1TMTH 1NPMA 1R6JA 1K1JA 5C5OA 3NZIA 2QN5T 3A88A 2BLWA 2AERH 2JETB 5CHAB 3VEQB 4JORA 2O9QA 1U6QA 1WDIA 1SGDE 2SGAA 3OAAD 3PROA 5EPNA 3M36A 1UHBB 1WH1A 1Z87A 1TGNA 2J94A 4I8LA 2UUJB 2D26C 4X8VH 3PDZA 4P00A 1O2GH 3RM2H 3EQ0H 4RI0A 3QX5H 2TIOA 2P3UB 2PUXB 2KL1A 1DLEA 4H6SB 2G4UA 2ZZUH 5DP8A 5DN6D 3MH5A 1WU1A 3VB4A 1OBYA 3BTFE 4D9QA 1K1PA 4IMZA 1C1WH 4Q80A 1LHCH 4R8TB 3EYDA 3K65B 4A7IB 1TNLA 2K8IA 1FLEE 2LOBA 1K1LA 1IU0A 3SV8A 3UQVA 1OWDA 1TMUH 1J17T 4Q2NA 1A0LA 5E11A 1JWTA 1SFQB 3EE0B 2BMGB 1QBOA 4NMPA 1TGTA 3ZZDA 1B8QA 3AVZA 1GHZA 1VCQA 2LPRA 3BTTE 1MKWK 1NO9H 2VWOA 3VB3A 4UONA 4ZH8A 2CF8H 3HGPA 3U1JB 2AWXA 1B7XB 1FIZA 1M9UA 2Z9KA 3C1KA 3URCA 3RXDA 1LHGH 6ESTA 3UOPA 3FO8D 2VWMA 4TPIZ 1OX1A 1X7AC 2VIDA 3RC6A 5E21A 1WF7A 4YZUA 1AU8A 3MO6A 1FY3A 2HGTH 1GJAB 1O2PA 2KAWA 2RDEA 1KDQA 3M5LA 4Y76A 2OMJA 4WH8A 3ZZ8A 1FX0B 5EW1H 4Q2OA 4A1XA 2ZFRH 3SOSA 1GHWH 4NMVA 2DLSA 1FZZA 2FTMA 4CHAC 1Q2WA 1ZSLA 4Q7YA 3BEUA 3U1IB 2XBWA 3LNYA 4O9VA 1MCVA 2A5IA 1L1JA 4X2XA 5J4QA 1IQKA 1SPJA 2ZTZA 5GXPA 3WKMA 3DJ1A 1Y8TA 3RXRA 3TK9A 1C4Y2 3BTQE 1ZRKA 3GSLA 1HAVB 4I7YH 1A61H 5EXLA 2FX4A 5JXBA 1QTFA 1H9HE 2UWPA 1O5EH 4JZEH 4GUXA 1MKXK 3KZDA 2H2BA 1VITF 1TBRH 3LH1A 4ISNA 4HOPB 2BHGA 1DX5M 3SI3H 2JILA 4OAJA 1XUJA 1SG8B 4A6LA 2H6MA 2P8OB 2Z94A 4FXGH 2G51A 4I86A 1O3HA 4E35A 2OCSA 2KCPA 4JOPA 4UE7H 1COWD 5FX5A 3S7KB 2BX4A 1P2QA 4ZHLU 3FVFB 1Z8GA 4ABDA 2GDEH 3GCNA 8KME2 5EXMA 3RXPA 1GJ6A 2UUYA 5G4BA 3W94A 1OKXA 4MQAA 3MFJA 1P2IA 4U32A 3VGCB 1V6BA 3LC3A 1W0ZU 4NG9H 2J4IA 1O2VA 2PNTA 4KFWA 1C2EA 1LMWB 7GCHG 4GHQA 2AH4X 1VA8A 2RDLA 1E38B 1AHTH 1GI7B 1NM6A 4AORA 2ZPQA 2M0ZA 4DOQA 1O2XA 2ZWLH 1A5IA 1DSUA 1H4WA 2I6QA 4YOIA 4KKDA 1EZUC 1FC7A 2JIKA 1T31A 1V2UT 2Q6GA 1Y3WA 2DUCA 4X1PU 3UNQA 5GCHG 4JZFH 2AFQB 1P3CA 2XCNA 2HE2A 1IHSH 3A84A 3SN8A 2R9PA 4IS5A 3R68A 4ISIH 2A2QH 2EGKA 1XKBC 2A45B 2AGIX 4X0WU 1HIAB 1E34B 2NU0E 1V2ST 1J14A 5JBCS 1XXFA 1CT4E 4YDPA 5DG6A 1SGCA 5H3JA 2CMYA 2NWNA 2TGAA 4JK5A 3ZVEA 1BRUP 3GDUA 1W9OA 1EAWA 2FOCA 1YLCA 1C5SA 1IQFA 2DE9A 1LPZB 2YT8A 1TB6H 1T4VH 2EY4C 1T4UH 2ZGJA 4BAOB 3O8CA 2ZIQH 2F9NA 2BXUH 1YBWA 3EA7A 1ZOKA 3MNSA 4ZHAA 5JBTA 1HAYB 4E06H 3BG8A 3FANA 4AB9A 2KJKA 2EJYA 1C2DA 1ETTH 2FN5A 1AWFH 1PPZA 1YGCH 2HNTC 2J34A 3CS7A 5EZ0A 1Y5AT 4UU6A 1ELFA 2AIQA 3KDGA 2QV1A 3NXPA 4IBLH 3TLOA 3F9FA 4NWKA 5F8TA 2QT5A 1Y3YA 1RIWB 3PTBA 3S9AA 3FZDA 2G4TA 1S85A 1G2LA 2JDID 4AFUA 2YNAA 3SW2B 2AMDA 2FLRH 2BDCA 2F83A 2OBOA 1V5LA 4P02A 4ZAEA 3MYWA 5EQRA 2LELA 1EJAA 3Q3KA 1UTMA 4UEHH 5C1XA 3FOAA 3LGIA 1THSH 4WVPE 4GLYA 2GMTC 1E37B 1CE5A 3GS9A 1ARCA 1N8OC 1OYTH 1W0YH 1ZMNA 2THFB 1MMJN 2M0VA 1JIMA 1HXEH 3ESTA 4JYUH 3V7TA 1WI2A 3H09A 5TCCA 2QC2A 4PROA 3UY9A 1HXFH 1MU8B 4B2AA 1DFPA 2VSVA 4FOUC 4GCHG 7LPRA 1W9QA 1FIWA 3M7QA 4JL7A 4GAWA 3VB5A 1XVMA 1ELEE 3E90B 5EJZA 3TNTA 2EDVA 3LGUA 1TOMH 3SUGA 1OWJA 3EA9A 9LPRA 3DHKH 1WBGB 3SFJA 3K9XB 3E1XB 3SHAH 3K1RA 1BMNH 3SU3A 1UW7A 2OPGA 1P10A 3QWCH 4OS5A 3K50A 4JOGA 4K72A 2W6ID 1UTLM 1K28D 3KHFA 2I0IA 1H9LB 1KXDA 2G2LA 1IU2A 1HJ9A 2DE8A 2KPKA 1BDAA 2Z6BD 1U3BA 4AYVB 2LC7A 3Q00A 2Y6TA 4MG3A 2I0LA 4NNMA 1Z8IB 2M2AA 5J4SA 2I1NA 2AHME 1GMDF 1GBCA 5ESTE 1FY8E 1NRSH 2B5TB 1LHEH 1N1LA 1YPMH 4AN7A 1ELAA 4HOPA 2EEIA 3GCOA 4WMFA 1D4PB 2ZQ1A 5A8ZA 3BG4B 2OXSA 1GBKA 3OTJE 2R0KA 5JB9S 2OC0A 3CS0A 1PQAA 5TCAA 2M0TA 2XWBI 4LOYH 5FPTA 3U28C 3B76A 3SV9A 1QIXB 1QL7A 3KYGA 3LJJA 1TX6A 2HNTF 2DMZA 3VB6A 1K1NA 1EASA 4XD7D 1OBZA 1A4WH 1RY4A 3PWBA 3SUZA 1TPOA 2JOAA 4Q6SA 1VKYA 3T5FH 4GVDA 1YCPM 4FVDA 1WOFA 1SI5H 2ZCHP 2FOHA 1RGQA 1MAYA 4TWWA 4D7FA 1ZJKA 2QF3A 1GJ9B 3LGWA 2H3MA 3O8RA 4INHA 1F7ZA 4X6NA 5CHBA 1AFQB 2JJ2D 1GI8B 5C20A 1DANH 1IAUA 2J95A 2FTLE 4WMEA 1NF3C 1GMCF 1GHAG 3OE7D 1O3NA 2CGAA 4CREA 2V3MA 1OP8A 2ODQA 4WYTA 2R3UA 4X8TH 2A1DB 3RXGA 4TY7A 1ZSJA 2OGPA 1KSNA 1NY22 2ALVA 2UUFB 3QO6A 2EEJA 2HVXA 1A3EH 1O2HA 3L4FD 1X45A 1SL3A 2HRVA 1WJLA 1IQNA 1MBMA 3HPTB 1K0HA 1BJVA 2HGAA 4WXVA 4Y8ZA 1UJUA 4IN2A 1SLUB 1YF4A 2WV9A 5B6LA 4NMOA 1VR1H 4OS7A 3TJUA 5SGAE 4NXQA 3DJAA 3ENSB 2OD3B 1RRKA 1UK2A 4IC5A 2EA3A 1GL0E 4MPVA 3QIKA 3F9GA 1ELVA 1G32B 4LMMA 2PA1A 2QKUA 4K5ZA 1UM1A 1G3BA 1TRNA 1GQ5A 2K1QA 1UK4A 2BDIA 1IQIA 2OUAA 3VQFA 1UTQA 1KIGH 3BTWE 1HNEE 3ZVGA 3P8GA 1Q3OA 2C8XB 4AG1A 4K75A 2F9VA 3E3TA 4NA8A 1SGTA 3RP2A 1ZHPA 2P3FH 6GCHG 4WYUA 1MTNB 4REYA 2GD4B 3RU4E 3CBYA 1IQLA 3SQHE 3UQOA 2VBCA 4RT1A 1OWIA 4Y8XA 2PGBB 3IWMA 1S82A 1ZGIA 1O3PB 1MU6B 1NFWA 3ZZ3A 1A5HA 4YT6H 1NFXA 4O03A 4I8HA 2KRGA 4F8KA 1GWAA 4OS6A 2FOAA 5E8EH 1KDQB 1W0JD 2CHAC 5A09A 4ASUD 2FX6A 3SHCH 1GMDG 1QA0A 2EDPA 2D8IA 2ZEBA 2ZG0H 4B74A 1W2KH 4DT7B 4Z33A 3EGKH 2OC8A 1J16A 2ZQ2A 1K9OE 2JXOA 1INCA 3LU9B 3BTME 3K6YA 1C5LH 2DAZA 1N6YA 2OC1A 4K76A 1O2TA 2G5MB 2WPIS 3E8LA 3M7TA 4Y0ZE
chains in the Genus database with same CATH topology
1BTUA 3AAUA 2BQ6B 1GVKB 4ABFA 4CRGA 4TY6A 3O46A 1SLVB 5LPEA 3K6ZA 2C4FH 3PV5A 1GBEA 1QR3E 4ZKSU 3FZZA 3QGNB 3QJMA 1C2IA 1HAIH 4XE4A 1G9OA 2BQ7B 3STIA 1QGFA 1O3DA 3ZVFA 3A8DA 2FYRA 3GY5A 3A8AA 1ELDE 3PO1B 4JMYA 2VJ1A 5ETXA 4E05H 4GCHF 3RXAA 1UK3A 2A2XH 2VINA 2NU4E 2O8WA 3M35A 1QQUA 4NMSA 1P03A 1TALA 1RD3B 1TIOA 3QGJA 1O37A 4BANB 1F0TA 5AHGH 1WQSA 4UDWH 3VPKA 1UO6A 1ZPCA 2A7CA 1FCFA 1GG6C 3LPRA 4ZHMU 2ZF0H 2YT7A 1C9PA 2UUKB 4X2YA 4X2WA 1J9CH 1WYKA 1ANDA 1XUHA 1GL1A 1KY9A 1X5QA 4FLNA 3GJ9A 1YKTA 2V3OH 1P09A 3V3MA 3ZZ5A 4B1TA 1A5GH 3VGCC 5C1UA 5I25A 2KYLA 1EB2A 1TQ3A 2ZU1A 2L4SA 2VSPA 1O31A 2IJOB 1DITH 2BZ6H 2J92A 1C1VH 2WL7A 5ABWA 1OBXA 5GJ4B 4ABHA 2M10A 1MFLA 1SGIB 1ZTLA 2OCVB 1TE0A 2BVSH 1LCYA 1TP5A 1C2JA 1MAXA 1PPCE 2AGEX 2WPJS 2PSYA 3T29A 3UR9A 4H11A 5E0HA 4O3TA 3MO3A 3UPEA 3CH8A 3SU4A 1PPFE 3L33A 1RGWA 3BTGE 5HEBA 1WTHD 1GDQA 3QUMP 2KV8A 2GKVE 1QRZA 2VGCB 2ANYA 1FONA 1P9UA 4FUEA 1PQ7A 1XUIA 3NFLA 2ANWA 2WPHS 3LOXA 1SHYA 3E0NB 4CRFA 3O8BA 1GI9B 1UJ1A 4X1NU 1F92A 4ABIA 5LPRA 3RXMA 3RXHA 3AW1A 4Z8JA 2V0BA 2ZGXH 1GBDA 1CGHA 4TWYA 3HK3B 2ZDMA 3JXTA 2FZZA 2MHOA 1H8DH 1O32A 1OXGA 1CA0B 1HB0B 1CT2E 2V6NA 4JJ0A 1P2JA 2HPPH 4K1EA 2JH5D 1JRTA 3NK8A 1TPSA 4X1QU 4YOJA 1D6WA 4FU9A 3RMLH 1UCYK 3SNCA 1VJAU 1FN8A 1EKBB 4JJ3A 3TGJE 2Z3EA 4K6YA 4NZLA 3RU4D 1T8MA 2ODYB 1ETRH 1S0QA 3GOVB 4L8NA 1Y3XA 1ANEA 3NUMA 1V2QT 3GICB 5CE1A 1D3TB 2VIQA 3DA9B 3MH6A 2Q3GA 3UR6A 4H6TA 4AFQA 4BAQB 2SGDE 5G1DA 2AS9A 2UWLA 1EXFA 2VRFA 2W3KA 1U38A 3ODFA 2TBSA 3ZZ4A 3TITA 4JZDH 1TNKA 2AIPA 4X6PA 2OP9A 1HDTH 1AZ8A 1P01A 2ZTYA 2BY6X 3GGEA 1C1RA 2EEKA 2DKRA 1TWXB 1Z71A 3U8TH 2VZ5A 1C1QA 3H5CB 1MKXH 3TSVA 1K1OA 8ESTE 1MTVA 4IW4E 3RC4A 2BDGA 3MNXA 3MWIU 2D92A 1MTWA 1OSSA 1GGDC 3NPSA 2O8MA 1FY1A 4BAKB 4B2BA 2P95A 1PQ5A 1VCWA 5BRRE 1F2SE 4ZXXH 5FAHA 1ZHRA 1KLTA 2CXVA 1VZQH 5FBIA 4I33A 2HWLB 1ANCA 1SLWB 3U8RH 3STJA 1P57B 2VH6A 3U69H 3MMGA 1W7XH 2TRMA 1JRSA 1DLKB 3DD2H 4H42U 3HKJB 6CHAC 1C4U2 1C5NH 1GPZA 1OWKA 2F3CE 2XYAA 4UD9H 1O3JA 4NZQA 3RUOA 2AEIH 1P12E 1GBHA 1P2KA 3BTKE 3F68H 1O5BB 2KQFA 2X7ZA 5FXLA 1SLXB 1C5VA 2W7SA