1VCWA

Crystal structure of degs after backsoaking the activating peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
312
structure length
291
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVQLTLQVTIQEYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 56
structure length 291
sequence length 312
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1vcwA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcwA02
4AG2A 2ZI2H 5EOKA 4JZEH 1NZQH 2ZU5A 2O8UA 1CSOE 1VCPA 2V6NA 1YYY1 2FOEA 5ESBA 1WFVA 3GY8A 3LKWA 1AZZA 1E34B 1H4WA 1QAVA 2F9PA 3ATIA 2ZQ1A 4X1QU 1PPGE 2FOFA 1GQ5A 2HALA 2B5TB 4WY3A 4B71A 3S0NA 1AIXH 2PA1A 1QL9A 1V2OT 3L3TA 1VB7A 4FU9A 5JBTA 1ELEE 5L2YH 4OS2A 5FAHA 1H9LB 4Y8YA 4YLQH 2XBYA 2UUFB 1V2QT 2ODPA 2M3MA 1MZDA 2GKVE 4MTBA 3O5NA 1A5IA 2G81E 4NA7A 4WYTA 2FEQH 4AGJA 1C9PA 1Z7KA 2QAAA 3HPMA 2TGTA 2OUAA 1GJAB 3STJA 3ATWA 3ZZAA 2B0FA 3BV9B 4FUFA 1BBRE 3Q00A 3V7TA 4WMEA 2SGEE 5T6GA 3HVQC 2XBVA 1YPHE 1C5MD 3CBXA 3A85A 3Q3YA 3EA8A 1OBXA 2BDCA 2Z9JA 2Q6DA 1V2ST 3I4WA 3VQGA 2G5VA 3RXMA 4TYDA 2GCHF 2VIOA 4H4FA 3FP8E 1P10A 4Y10E 4OS4A 1IQHA 3HK3B 4D9QA 1PPFE 2BD2A 4DIHH 1ELFA 2PTNA 2THFB 1SI5H 1OWKA 5CMXH 1XUJA 2OZFA 1OP8A 3E90B 1BCUH 4KFVA 1CA0C 5HDYA 1GBTA 2CXVA 1MD8A 2QCYA 2XW9A 1SHHB 2PKSC 4NIVA 1VITF 1THPB 1P3CA 3R3GB 3QDZB 5H4IB 1N6YA 2G52A 1GVKB 2PKSB 3KF2A 3SHCH 2CS5A 4DW2U 3HK6B 2D2DA 1XM1A 3AVZA 3EAJA 1AFEH 4K6YA 1N1LA 3NGHA 5ABWA 4X6MA 2ZO3H 1LKAA 1S82A 4IN1A 2GZVA 2XC0A 4FVBA 3M7TA 4NXRA 2L97A 5EXNA 1LQDB 2LC7A 1Y5AT 1BTWA 2JINA 2GCHG 5DP5A 4O03A 5FCRA 4TY6A 4X2VA 1FNIA 3GCHC 3IITA 1KXFA 5HMAA 1EZQA 1A46H 1N99A 2FLRH 3GCHB 3A7WA 2SFAA 3MNBA 1ZJDA 2BY6X 2AS9A 3TK5A 1VJ6A 4MDSA 1W14U 3S9AA 4BNRA 2P95A 2P3FH 1TNJA 3EDXB 1U3BA 1LO6A 3H5CB 1V2VT 2FN5A 1VITG 1GM1A 1L4DA 2FOBA 2KYLA 1EATA 3B76A 3A83A 4TY7A 4WXVA 5I46H 1A3EH 1A0JA 3VXFH 4X0WU 3QDOA 1DFPA 4NWLA 5E0HA 1TWXB 2GZ8A 5DG6A 3EGKH 2BXUH 4ABAA 1HV7A 1QB9A 1QHRB 2QXIA 3JXTA 1UM1A 3DA9B 2JH6D 3MH5A 3PDZA 1LTOA 4HI3A 2F5YA 3IG6B 5HM2A 3ID4A 2FZZA 5LH8A 3TIUA 3R68A 1XZ9A 2WL7A 3LNXA 1UHBB 1N7TA 2H2CA 1OBYA 3RXGA 2BYAX 3RLWH 1L6OA 2KOHA 1C1TA 4CRFA 3SHAH 4G69A 1V2RT 5FCKA 3UNSA 4JYTA 1V5QA 1C1NA 1NFWA 1K28D 1DY9A 4X6PA 3AAUA 2IPHA 2KG2A 1HNEE 4FXGH 1WTGH 1OOKB 1NRNH 1AE8H 1Y5UT 1ELAA 1SLVB 5E21A 2F83A 1VJ9U 1O3EA 3LGIA 3RC5A 2GTBA 4YOGA 3R0HA 1C1VH 4OEOA 2DM8A 1N8OC 5HEBA 3FFGA 3LGWA 1QB1A 3FVFB 5FBIA 3LGUA 2AEIH 1FDPA 3LH3A 1O5EH 1N8OB 1C2MA 3AW1A 1C2LA 1ZOKA 1V2NT 1TMTH 2O9QA 1N7FA 4IC5A 2OQSA 1MUEB 3U98H 3QN7A 3RXLA 2V0BA 2ZTXA 2YUYA 1FAKH 1BJVA 1HJAC 3KZDA 1YPKH 3R69A 1HXFH 5K0HA 1OWDA 4MPWA 3RXPA 1HJAB 4MLFB 2L4TA 4K3JA 2EDPA 3OTPA 5L30H 4ISIH 1UEWA 1CT4E 3EQ0H 2VGCC 1Y3WA 3SI4H 1DITH 3LC5A 1O2WA 3SFJA 4ZKOU 2G55A 3LDXH 1W9QA 2VGCB 2ZGBH 4ZH8A 5GPIB 1P04A 4JYVH 1NRSH 5F8ZA 3RXFA 3ZZ8A 2FTMA 2BD5A 1G9IE 1BTPA 1ABJH 1ELCA 1TRYA 3LPRA 1CE5A 4WH8A 5L2ZH 2PKUA 1TBZH 1C5OH 1ANBA 1ZMLA 2F3CE 2FWWA 4Y76A 1QBNA 1S81A 2BLVA 4WXIA 4A1XA 3UOUA 1OP0A 1W8BH 4MVNA 1UEPA 1WF8A 2X7ZA 1GBKA 4UD9H 4FUIA 1QGFA 1FC7A 2BD8A 1WJLA 1JRSA 2JWEA 1W11U 2OBOA 3TJUA 1MC7A 2JOAA 3PROA 3S69A 1W13U 3PB1E 1O2QA 1HAIH 4INHA 5EG4A 3M5LA 1A61H 1TB6H 5EXMA 3PLBA 1UHBA 4UFFH 1K1LA 1KXAA 1UTJA 2ZHQH 3GOVB 3QGJA 1SGQE 1KXEA 1X5QA 1EB2A 1LDTT 1FLEE 2K1QA 2C93B 2R4HA 5E8EH 3TK9A 4MPVA 2OMJA 2Z3CA 1C5TA 3A7YA 4B76A 3RMNH 1EQ9A 2A32A 4NNMA 1BDAA 3HPTB 1GJCB 4U32A 4OAJA 1TYNA 3HPKA 3RU4E 2KL1A 1T8NA 1W0YH 1TX7A 5T6FA 1KTSB 4K8YA 3RU4D 1GBHA 2XC4A 3KIDU 1UK2A 1XUHA 2QIQA 1QB6A 4CRDA 5GXPA 3LGVA 3M37A 3M5NA 2BDIA 2XWBI 2Q6GA 1OYQA 1M5ZA 2P16A 5B6LA 3VEQB 1TGTA 2BY5X 3M7UA 3ZZDA 5EW1H 4NZQA 3OX7U 1TMUH 3MFJA 4NMTA 2G4UA 2Z3DA 2ZU3A 2Z17A 3UNQA 3QO6A 1PPHE 3PO1C 5L6NH 1HYLA 1G36A 1EP5A 2F9BH 3GDSA 4O97A 3PO1B 1QA0A 1DVAH 2BQ6B 1CGJE 1TAWA 4ABHA 1SGPE 1W7GH 3URCA 2OC1A 3VPKA 4NFFA 3UY9A 2JILA 1L4ZA 4HOPB 1LPGB 2D92A 2BQWB 2EEKA 2SGAA 2ZCHP 3SOEA 1PDRA 2Z94A 2AIQA 1DS2E 1TPPA 3SUZA 1B0EA 5E0JA 1NC6A 2ANMH 1SFIA 2V3HH 2AGEX 1ZPBA 4BAHB 4AORA 2I0LA 1TP3A 1TNGA 4H11A 2ZA5A 3BTKE 1RD3B 1CGHA 1UMAH 1MFLA 1GBEA 2H9EH 4GAWA 3HATH 1CHOF 2FYRA 3KQBA 3DJAA 5DTHA 2QV1A 3QIKA 3MO3A 1GGDC 3KGPA 2ILNA 1SGDE 1HCGA 1KWAA 5HFCA 2UUJB 1GGDB 2W7SA 1D3QB 2MHOA 3UPEA 2TGPZ 4DJZB 1YF4A 2TPIZ 3FANA 1EPTC 5FHTA 2KJPA 3SOSA 5ESTE 1EPTB 3K9XB 2BM2A 2ZQ2A 1O30A 5HEYA 3VQFA 1EAUA 1WYKA 3F9GA 2CF8H 3DIWA 1IOEA 1RTKA 2A0QB 2BXTH 2HNTE 1UTNA 3LJOA 1WV7H 1CGIE 3NWUA 2EXGA 4GCHF 1FC9A 3DJ3A 1Q7XA 1B7XB 3KCGH 1W0ZU 4X6NA 1YP9A 5F03A 3TLOA 2I4SA 1CHOG 3T27A 2J95A 3TK6A 2IN2A 1TGCA 1QJ6B 5EU8A 3M5OA 1WCZA 4X6OA 1C5WB 1TA2A 1O31A 1ANCA 1IQKA 4AZ2B 1GHZA 2YOLA 1INCA 4KKDA 1LKBA 1B5GH 1O2UA 4I31A 1EZSC 1D3PB 1F92A 1NTPA 4Y71A 1KLTA 1K21H 4WMDA 2A4OA 3ZRTA 8GCHF 2H5CA 1ACBE 4YOIA 2VSPA 5C20A 1KXBA 5FX5A 3RLEA 1Q3XA 2ZFRH 1GJ8B 1MZAA 4K8BA 4ZXYH 3KQDA 2XWAA 1O3KA 1AVWA 4JOEA 2BDHA 3E6PH 5JBCS 4GCHG 3ID1A 1SFQB 2PUQH 2FOAA 3MU5A 2HGAA 3M3TA 1UEQA 1O33A 4KFWA 5DP9A 1E36B 2KJKA 3M3VA 1G2LA 3H7OA 1Q31A 1OBZA 2I0IA 3IWMA 3OSYA 3SNBA 1ELDE 3SUGA 4KGAA 3ZYDA 4MNXA 3DORA 1T4UH 4MPXA 5JBBS 1UTPA 4OS5A 1PYTD 1PPBH 1XKBC 1FQ3A 1Y8TA 5HF1A 4E7NA 3SV7A 1GL0E 8GCHG 1NF3C 2Y80A 2HGTH 1HAYB 4Q7XA 3MYWA 1O3NA 2VWLA 2WYGA 1C2JA 3EE0B 1FC6A 1DXPA 2ENOA 5HF4A 2VIDA 5GNDA 2CN0H 2VH0A 3F9HA 1GBFA 1EPTA 2PR3A 1HXEH 3ZYEA 1GBDA 3T26A 3CS7A 4E05H 1BRCE 1GCTC 1ZYOA 2A4QA 2ZGXH 1QBVH 2ZFPH 3TH2H 4FU8A 1V2TT 1GCTB 1V5LA 3DHKH 2JREA 3AAVA 2BLWA 1SOZA 4NMVA 5HEDA 3M35A 3BTTE 2WUCA 1K1OA 1G3CA 4X8UH 5DPAA 3JZ2B 4JK5A 1T32A 8LPRA 3ZVFA 2A45B 2EV8A 2FNEA 2XRCA 1A5GH 1NFYA 3A87A 5A0AE 8KME2 1O0DH 1ZPZA 2ZTZA 4CBOA 4I7YH 1QQ4A 1GHXH 2OBQA 3PWBA 1P09A 2RCZA 1KYNA 1ABIH 1K32A 1BE9A 4A5TS 2JIKA 3ATMA 1W9OA 1JRTA 1O38A 1Y5BT 3S9CA 2ZDNA 1E37B 4BAKB 4BAMB 2Q3GA 4WH6A 2B8OH 3PV2A 4U2WA 2F9NA 2KPLA 3MU8A 1O2SA 3SU1A 1MU8B 1HAXB 2IWNA 1TONA 3MO9A 4A1TA 3TGKE 1UTMA 3QJNA 4JZ1A 1Z1IA 1F2SE 1DWCH 2Y7XA 2DLUA 1EXFA 3I78A 2DE8A 3BTFE 2D8IA 1F0UA 2W3IA 3U9AH 2QF0A 1KDQB 3VXEH 4X2XA 2J92A 2OXSA 3QE1A 1MKXH 3CS0A 3SNCA 4I8LA 2IWOA 2W4FA 1OX1A 2BDGA 2OGPA 1BTYA 2NU3E 3GDVA 2SGQE 4CRBA 1WHDA 2KPKA 1C1OA 2ZFQH 4GSOA 1OZIA 2EDVA 3OU0A 2SGPE 1QFKH 5EW2H 2M0ZA 2PUXB 1IQLA 2W7RA 3A8DA 1YC0A 1SQAA 2FE5A 5F67A 3SGAE 3GY6A 2KOMA 4X2YA 1TP5A 2WPKS 3ZZ6A 5DJ7A 4NMPA 1K1MA 2D1JA 5HJ1A 1ID5H 4A7IB 1GJDB 2UUKB 2G5NA 1PQ7A 3KEEA 2ZDMA 1SLXB 3OY6U 4NFEA 2XTTB 1O36A 2MX6A 1Z87A 1ELVA 2D8WA 1F0TA 2ZCLP 3T29A 1O2KA 1L1JA 2RDLA 1EZXC 3E1XB 2NU4E 1NT1A 1C2HA 1D9IA 2BOHB 2ZZUH 1OXGA 1AZ8A 1ORFA 5DO4H 1MD7A 1GBIA 1AB9C 1BIOA 1FPCH 1C1RA 5DP8A 4ZMAH 1AB9B 3QX5H 4AFSA 2ZIQH 4WVPE 3V3MA 4PQWA 1TRMA 1N6DA 1HB0B 2BMGB 2HOBA 3PTNA 1O5BB 1MAXA 2ZDLA 5I25A 5EQQA 1GHWH 5HM9A 5G4BA 5A09A 1HUTH 1SGFG 2H2BA 1WUNH 2YUBA 3F6UH 1O3AA 1CO7E 1X5NA 1C5VA 2GVFA 4NGAH 3S9BA 1HBTH 1O2OA 1QAUA 4LXBH 2PFEA 4Q2QA 4X1SU 4K1SA 1P2IA 2PLXA 4I8HA 1EJNA 2QKUA 4FUHA 1O3DA 3WKLA 2BZ6H 1ZR0A 3CENA 1W9EA 2GCTC 1SGNE 2JKHA 2SNVA 4OS6A 4ABBA 4O9VA 2UUYA 2GCTB 4LMMA 3UR6A 3UUZA 1KDQA 1P9UA 2DAZA 1A0HB 4JOGA 2OLGA 2A2QH 1EJMA 1S84A 1MH0A 1F5RA 1QA7A 2AMDA 3SHWA 2FI4E 2LPRA 4NA9H 4D7FA 2CV3A 2YT7A 3SUDA 2J94A 2H2ZA 1D5GA 2CF9H 2G8TA 4I8GA 1TPAE 1CA0B 4FUBA 5IDKA 5TCCA 2FX4A 1AE5A 1X45A 4FVDA 2EEIA 2P59A 3RC6A 1YCPM 3VB5A 2AWXA 1MTWA 4NXQA 1QLCA 2L4SA 3DJ1A 4DG4A 2ZPMA 2PHBA 4AYVB 1C4U2 1MU6B 4B73A 4O3UA 1DXWA 4JOJA 4UE7H 1ZRKA 1BMNH 2V35A 3QGNB 3I29A 2A2XH 2RA3A 2FI3E 4JZFH 5C1UA 2Z9LA 4D8NA 4QT8C 1DDJA 2TGDA 4K72A 1LHCH 4O3TA 5HXFA 1ARBA 2R2WU 4CH8B 2BB4A 1F5KU 1Q3OA 2O2TA 4KP0A 3E17A 4NG9H 3LT3A 1QQUA 1KY9A 5EYZA 3SUEA 2I6VA 1K1IA 3DFLA 1TX6A 4BXWA 5JB9S 1SGTA 2LC6A 3CYYA 4WF8A 1UTKA 1IQIA 1GJ9B 4UU5A 2IWQA 5J4QA 1HAGE 3M3SA 4LK4A 1UTQA 1BB0B 2DUCA 5GWZA 1O3GA 3KN2A 4OGXA 4M7GA 1BITA 1BJUA 1PPCE 3QZQA 4ZAEA 3BTWE 1P57B 4Z6AH 3RUOA 1FMGA 1P03A 1O3MA 3T25A 5C67A 1G37A 1O37A 1GI2A 1DICA 1QNJA 3NZIA 2IWPA 1P1EA 2AGGX 2BZAA 1A1RA 1P2MA 3MTYA 1QL8A 5JPMH 1O3FA 1BHXB 2XXLA 3HGPA 3QJMA 1YGCH 1OPHB 4J1YA 2R0KA 2ZC9H 3T2NA 3RXBA 1RFNA 1P12E 1C5RA 1RTLA 5LPFA 1ZTKA 1K1PA 1ZRBA 4NIWA 1K1NA 3U69H 1Z8IB 1KSNA 1AY6H 1V3XA 1FPHH 1AUJA 3TMHA 2FDAA 1Y3VA 1C2IA 2FLBH 3BG4C 2OSGA 3A8AA 4MPUA 1BTUA 1ZSKA 5AFZH 4CBNA 3MWIU 4GLYA 2DMZA 2HPQH 3BG4B 1GQ4A 2UWOA 5BPEA 4MQAA 1RS0A 2LUIA 5C2ZA 2PTCE 3ZVEA 2H6MA 2OTVA 3KZEA 1SQTA 1FY5A 2JH0D 1V2UT 1L0ZA 1X7AC 3DUXH 1I16A 1VR1H 3LJJA 4X8VH 1UJVA 5C5OA 2XNIA 1FCFA 1MQ6A 1O3HA 3PDVA 3RXVA 1AUTC 2FXRA 3TSVA 2M10A 2PGBB 5JBAS 2P3TB 1XUIA 1EASA 1FIWA 1FIZA 3P92A 4AFZA 1ELTA 3ENSB 2C8ZB 4GVDA 5T3HA 1ELBA 2EI6A 2QF3A 5H3JA 3SZNA 3TITA 2ZPSA 4BXSA 3A8CA 1N6EA 3VB6A 2BY9X 1YM0A 3GCTF 1GJ6A 4ZROA 5HFEA 4XBCA 1DUAA 3E3TA 2VIWA 2PNTA 1XUGA 4ZHMU 4IMQA 2F9OA 3A88A 1A3BH 2BDBA 2GZ9A 2ZFSA 5PTPA 1NU9A 1WIFA 4ABGA 5ETXA 3T62A 2R9PA 4YZUA 2R0LA 2Z9IA 1D6WA 2GMTC 4R2ZA 3RXCA 4YT7H 1O2JA 2EC9H 1O39A 2NU0E 2P8OC 1C2EA 1EAWA 1SBWA 2GMTB 3ZZ9A 5JYIA 3PMAB 1HRTH 1SGFA 2AINA 2P8OB 1UITA 4KELA 5JB8S 1WI4A 3BTGE 3SJIA 5F3XA 1EOJA 1LQEA 3AW0A 3TJOA 1A2CH 2EEGA 4L8NA 1NN6A 2VIQA 2WPMS 3ODDA 3P8FA 3SNDA 3UR9A 5C5NA 3TH4H 3E16B 1MTVA 5FXLA 2G00A 4CR9A 1YPGH 4NIYA 4CRAA 2UWLA 3GCTG 4ISLA 1NRRH 4B74A 1BTHH 3BIVH 1EP6A 4OS1A 1SOTA 3UIRA 1LPZB 1V2KT 4AB9A 4GHQA 5A0CA 1ESAA 3UOPA 1YPLH 1MFGA 4Q7YA 5AFYH 3MU1A 2JXOA 1QY6A 2TIOA 1UEZA 4Q7ZA 3OTJE 1MKXK 1P0SH 3K2UA 4XDEA 3SU6A 2FOHA 2STAE 1V1TA 2KV8A 1G32B 2ZG0H 2FS8A 2QXJA 4ABEA 1UJUA 1S83A 4CREA 3U8RH 4IBLH 3MOCA 2ZGHA 4F4OC 1YCPH 2FI5E 1C1WH 4YYXA 1ETSH 2EA3A 1C2KA 4SGAE 1QR3E 1V6BA 1UHPA 3TU7H 1C1QA 2BYGA 2H3MA 1V2LT 4A1VA 1ZZZA 1O2HA 2F9VA 1UVPA 3RXOA 1GBAA 1SSXA 5IYTA 4H6TA 3P6ZB 2QBWA 4DCDA 1IQMA 3E91A 3UWIA 3OYPA 1TIOA 1BRUP 2M0VA 1C4V2 1ZJKA 2GP9B 3P70B 1O5DH 5AVDA 1HJ9A 2M5TA 4ZKSU 4MNVA 1MAYA 2ZFFH 4ZUHA 3SO3A 1HAVB 3C1KA 2ZECA 1U39A 2AH4X 2ASUB 2ODYB 1NRPH 1ZMJA 1VGCC 1P3EA 5JDUB 2TGAA 2QXGA 1K1JA 2FOMB 1UVOA 1UF1A 1YPHC 1PQ8A 1VAEA 1VGCB 1P1DA 2PV9B 3U1JB 1MTUA 1UCYH 3UWJH 4FGMA 2FCFA 2PSYA 1GJ7B 3DFJA 1GJ5H 5B6OA 3CP7A 4Y8ZA 3PV5A 1TGNA 3B23B 2NU2E 1O3PB 1H8DH 3MO6A 5J4SA 4XBBA 2VVUA 2ZPQA 1T8MA 2ZNKH 1WG6A 1NU7B 3A7ZA 1JWTA 1GI9B 1GBMA 3M5MA 1DT2A 4I8JA 4B2CA 2Y7ZA 2C8WB 4I32A 1CT2E 2C8YB 3L4FD 4Y0ZE 3ZZBA 3EGHC 1LVBA 2ZKSA 3A7TA 4D7GA 1LHEH 1RZXA 4NA8A 9LPRA 4E06H 4MG3A 3T28A 2VNTA 2BQ7B 2F91A 1CHGA 1SGIB 3VB7A 3SBKA 1O3CA 1T8OA 5GIBA 2NU1E 3JZ1B 4K69A 1P01A 2ZTYA 1ZTJA 3ZV9A 2ANWA 1RIWC 1Y7NA 4JOFA 1FY4A 3UQVA 3ZV8A 3QZRA 1U37A 1ANEA 1THRH 2HPPH 1ZHPA 3Q77A 1RIWB 1RGWA 1J16A 1YBWA 1Z8GA 2Z9GA 1FJSA 1LHFH 1H9HE 2VVCA 3F9EA 4X1RU 1ESBA 4DURA 1BUIA 1YLCA 4ABDA 3RLYH 1X5RA 1TGBA 3RXJA 5DGJA 4Y11E 4KTSA 5TCAA 4FUJA 3LONA 1W7XH 5A8ZA 5EQRA 1A7SA 1FV9A 3D49H 2BOKA 2A5IA 3SJ9A 2VU8E 3MI4A 1OP2A 3RXKA 5E1YA 1MTNC 2C8XB 4PROA 2A5AA 4BANB 4E3BA 3GICB 1O2PA 2VWOA 1SR5C 4UFGH 2PKTA 2FM2A 1MTNB 1JBUH 1SGYE 3A7XA 1UO6A 3ID2A 2A1DB 3DD2H 1SG8B 4FUCA 3FZDA 2Y5FA 2WUBA 1WQSA 4A92A 5E22A 4UFDH 1C5ZB 2Z9KA 4BAOB 4JORA 2P93A 1AU8A 1MMJN 4KTCA 1HAVA 4K78A 1DLEA 1GVLA 1FUJA 4Q2NA 1WBGB 4HOPA 2Y81A 2GDEH 4GVUA 2F0AA 3SU0A 4NNLA 4XHVA 1UK4A 1LCYA 1BFEA 1TNHA 1B8QA 4CR5A 4AGKA 1W2KH 4RKOB 1AHTH 2PWXA 4AYYB 2DB5A 2G4TA 1GDNA 3GJ9A 3BEUA 1GI6A 3URDA 2AMQA 2C90B 2FYQA 4RSPA 2EEHA 4NZLA 3Q76A 5HFFA 3RU4T 4CRGA 3A7VA 2ANYA 1HDTH 4KTUA 1O2NA 2AERH 1LVYA 5CHAC 2IOTA 5EODA 5HETA 1FY8E 4TWYA 1P2KA 4F8KA 3A89A 1TE0A 5EXLA 1KIGH 4OS7A 2OINA 5CHAB 3ATLA 1O2VA 1AD8H 5K7RA 1N6XA 4B1TA 1V2MT 2ZHDA 1EOLA 1OYTH 2GV6A 3TSWA 2ZGJA 7LPRA 1ELGA 1AMHA 2VH6A 2PW8H 5C3NA 2SGFE 4ABFA 1P02A 4K75A 3W94A 1JIMA 4YLUA 1GI4A 1L2EA 1O3IA 2H1UA 3G01A 3SU4A 3F1SB 1E0FD 1TABE 1D3TB 4ESTE 1HAPH 3M61U 2O8LA 3RXHA 4E34A 1Q3PA 2D90A 2QG1A 3SNAA 1ANDA 4Q6SA 1N6FA 4AX9H 5F8XA 2WPIS 4X1PU 1PFXC 5DK1A 1ETTH 1FN6A 1GHVH 1GCDA 5C1YA 1PJPA 4AOQA 2M0UA 4Q2PA 5E6PB 1UFXA 2PSXA 4YT6H 1YKTA 3AXAA 2OQUA 3FY5A 1RTFB 3MMGA 5FX6A 2VVVA 1G3EA 2SNWA 2KAIB 2XBWA 4JK6A 2BDYA 4BTUB 1WH1A 4HTCH 3F9FA 3V0XA 2VZ5A 1SGRE 4LZ4B 1NFUA 4Q6HA 3QTOH 4GPGA 2HNTF 1UVTH 5FBEA 4ZKNU 3BEIB 2WPJS 3ZVAA 3NFKA 2FIRH 3I77A 3ATKA 3RP2A 3RXSA 1GDUA 2BLQA 3MH6A 1GBLA 3TNSA 1VITH 2EHRA 3GYLB 1U6QA 1P9SA 3RXRA 4DGJA 1V62A 2H3LA 4NMRA 3FP7E 2DJTA 1GVZA 5E2OA 2EGNA 3AASA 1MKWH 3RXEA 4AFUA 1ESTA 2CSJA 1IHSH 2JETC 4F49A 3BN9A 3SU3A 1MTSA 2G2LA 1O2IA 2FOCA 1QURH 2VWNA 3FP6E 1AGJA 3MNCA 4YOJA 2ODQA 2JETB 1T31A 1PQAA 4UFEH 1IU0A 4FUDA 1DY8A 1EAIA 4NMOA 1BZXE 5BRRE 2AGIX 1LPKB 2XCNA 1RRKA 1SMFE 3WY8A 2FESH 3ZZ4A 1KXDA 3SGBE 2BDAA 3BTEE 1GI3A 3N7OA 1F5LA 4XOJA 1OS8A 4DY7B 2G51A 1KLIH 3UQOA 1GHYH 2ESTE 3E0PB 2GDDA 2J4IA 5AHGH 5D13A 2W5EA 3ESTA 1B0FA 1C5SA 3PWCA 3BTDE 2TBSA 1Z8RA 3NCLA 1OWHA 1BHXF 2BVXH 4ZHAA 1OKXA 5DP3A 1GI1A 1HGTH 1Z6EA 3I1EA 5G1EA 3BTQE 2HE4A 1O2YA 1TBQH 1O5AB 5FB8C 1Z8JB 3GSLA 1MBQA 1DWDH 1Y3YA 2AIPA 5FPTA 1AFQC 7ESTE 3ZZ3A 5FPYA 3LOXA 1WOFA 1AO5A 1RXPA 3TNTA 2DE9A 1QRZA 4BOHA 4NMSA 1AFQB 5GCHF 2ZPLA 1YCPK 4THNH 4UU6A 2EJYA 1V6DA 4H6SB 1TQ3A 2C3SA 4NSYA 4X8SH 3T5FH 2ZDAH 4ISHH 3RXTA 1Z86A 1TFXA 2KAIA 2H9TH 3ELAH 2H5DA 3ZZCA 2GV7A 4P0CA 1GJ4H 3DT0H 3PLPA 1WQVH 3QTVH 2Y6TA 1IQEA 1D6RA 4BTTB 1SGEE 1A4WH 1C1MA 5E2PA 2VWRA 2VB0A 1C1SA 4INLA 1BBRH 4BAQB 3GCOA 2RG3A 1K2I1 1CT0E 1D4PB 3VB4A 4D76A 1UM7A 1NY22 3SHUA 1YPMH 3TVJB 2ZCKP 1THSH 3RMOH 1HAHH 4JOPA 1O2GH 3BPUA 1UCYK 4R8TB 1O5GH 3STIA 1N7EA 4YESB 1GJBB 3A86A 5GCHG 4A6LA 1V2PT 1P2OA 4TWWA 1WHAA 3K82A 1NO9H 5HFBA 4EDJA 2HNTC 4BTIB 5DP7A 1TNLA 3ZVGA 2ULLA 1EAXA 1KEFA 3RL8A 1IQGA 3U1IB 2KJDA 2XC5A 3PMBB 1ZGVA 1GDQA 4AG1A 2KQFA 3SNEA 1J8AA 2BX4A 1DM4B 1OWIA 4AB8A 2R3UA 2WV5A 2Z7FE 3P17H 1GL1A 1WU1A 4B2AA 1DSUA 1H9IE 3F68H 4Y8XA 1QRWA 4YM9A 1C5YB 1F7ZA 4DOQA 1EJAA 4ASHA 4ISOA 1BQYA 3TPIZ 2FX6A 1GBBA 5AF9H 5C1XA 2DC2A 4NXPA 5GLJA 1NPMA 1KTTB 1O3OA 1TALA 2FOGA 3PLKA 5EQSA 5F8TA 1M9UA 3RMMH 1UVUH 4ZXXH 3NK8A 2HLCA 2Y82A 1DOJA 3GDUA 1ZHRA 4UEHH 3CBZA 2EGKA 3BIUH 2AWUA 2I04A 1GMHF 4INKA 4K60A 4JOHA 5JXBA 3SUFA 3NFLA 2DKRA 4MNWA 1QCPA 1QJ7B 2V90A 1EKBB 3GY5A 4K1EA 4HZHA 4K2YA 3S7HB 3FZZA 1HIAB 1X6DA 2R2MB 3GISB 3P8NA 1ETRH 3QWCH 2ZDKA 4GHNA 1XMNB 4N6XA 2A7CA 5A0BA 1P05A 3BEFB 2I6QA 2XCFA 1SVPA 1AI8H 5FPSA 1PYTC 1XXFA 1SLUB 1FY3A 1GBJA 1MBMA 2FPZA 5DKMA 2G5MB 2YTWA 1ZSLA 1Z71A 1IU2A 1XX9A 2M0TA 2W26A 1VZQH 1YPEH 3M7QA 1C5XB 3GYMA 1S85A 1L1GA 1GI8B 2OC8A 3MU0A 4JCNA 1UJDA 3RXIA 2QYIA 4LOYH 2P3UB 4JOKA 2K20A 1J15A 6GCHF 2BTCE 1GMHG 4DVAU 2F9UA 1NRQH 4GUXA 2CJIA 2P94A 3RC4A 1UTLM 2QY0B 1T8LA 5DP6A 2ZGCA 3LNYA 2O8TA 4LZ1H 1GI0A 3TH3H 1NESE 1C5LH 4ABIA 4JMYA 3PV4A 4Q80A 3K50A 1BTZA 1DSTA 5G1DA 1AQ7A 3ZVDA 4DIIH 1WTHD 5CE1A 4JZDH 1CVWH 3ZZ5A 4AFQA 2CGAA 1SPJA 2OC0A 1BT7A 2Q1JA 5TJXA 2LOBA 2Z6BD 2PGQB 1R6JA 4Y79A 3PMJA 1OWEA 1O2RA 2A5KA 3LH1A 1CA8B 2SGDE 1ZTLA 1T4VH 2QGRA 4IC6A 6GCHG 1ZPCA 3GY2A 1W12U 4RKJB 5F6MA 1U38A 4I33A 3NPSA 2VJ1A 2BD7A 2Q9VA 3MU4A 4NMQA 4GVCA 1O3LA 2A31A 2FP7B 2W3KA 1QRXA 2ZU1A 3PYHA 1G2MA 1V2WT 3K6YA 1O3JA 3H7TA 1JIRA 2BD3A 2A4GA 3LGYA 3OY5U 1MCTA 1GWAA 1QL7A 1P06A 2ZPRA 2KOJA 2VRFA 3NKKA 1HIAA 1UTOA 3MHWU 3RXDA 1QTFA 2Y5GA 1SLWB 1SQOA 1FY1A 1DANH 3ZVBA 4OEPA 1IQJA 1DE7H 4ZKRU 3UFAA 6LPRA 1IQNA 1TMBH 1QIXB 3EA7A 1RJXB 3QLPH 1IQFA 1O2MA 3WKMA 1Z1JA 1GPZA 2AYWA 1BTXA 4UDWH 3O8RA 2DLSA 3SJOA 2B7DH 1NFXA 4K1TA 3U8TH 2REYA 1NM6A 4I8KA 2VIVA 1SL3A 2KAWA 4VGCC 1SC8U 1G9OA 2XYAA 1UK3A 3L33A 1FN8A 4AN7A 4FUEA 4VGCB 3V13A 1BMLA 1TLDA 1UJ1A 1EX3A 3ODFA 4YDPA 4MNYA 4B2BA 5SGAE 5A2PA 1O2ZA 1S6HA 1AVXA 5EPNA 1MKWK 2QT5A 2ZFTA 3BTME 1LMWB 1V2JT 1T7CA 3RXAA 3V12A 1QJ1B 1K9OE 3A82A 5A8XA 3K6ZA 1SGCA 1GHBF 1OSSA 5A8YA 1WFGA 1CU1A 6CHAC 4Q3HA 4E35A 2EI8A 3KQEA 2EAQA 1EB1H 1C2DA 4JL7A 1O35A 3BG8A 3O46A 3K65B 4JYUH 4OGYA 6CHAB 3KQCA 3RXUA 1KXCA 1Y59T 3KL6A 4U01A 4R0IA 1W3CA 5GJ4B 1LHDH 1C9TA 4IGDA 1WAYB 5EZ0A 1Z6JH 1TPSA 1GMDF 2BX3A 3MH4A 2KA9A 3TJNA 1YLDA 4K76A 1LVOA 1NTEA 2OCSA 2V1WA 1LHGH 4FU7A 1S0QA 3HGNA 2NWNA 2OP9A 1G3BA 2QKTA 1UCYE 2ZHWH 5LPRA 1C5NH 1E35B 1G30B 3D62A 2ALPA 2QA9E 2A7HA 1S0RA 2CSSA 3B8JA 1LVMA 1ZMNA 3U8OH 1G3DA 2ANKH 4WWYA 1ZHMA 4Y6DA 4NCYA 2C4FH 1GHBG 2HRVA 3A8BA 2QN5T 2STBE 2ZWLH 3GCNA 1EZUC 4IS5A 1PQ5A 3NUMA 2AWWA 1GHAF 2AFQB 2ZHEH 4ZHLU 2FO9A 1WF7A 2YNAA 1GMCF 3CH8A 2RRMA 5E0GA 1MQ5A 3SQEE 2GX4A 5HFDA 1WSSH 2BLOA 1P2NA 1VCQA 1JOUB 1GMDG 2ZHFH 3SV6A 4WYUA 4NWKA 2WPLS 1J17T 2FODA 3RL7A 1XUFA 2PKAB 3FAOA 1TX8A 4IW4E 1BBRK 2OC7A 3MNSA 4O06A 4XFQA 2FMJA 3P8OA 2OQ5A 2KBSA 3NXPA 3R0FA 7KMEH 2RA0A 4XBDA 3Q3KA 3KHFA 1NROH 2EI7A 1O2LA 3SV9A 1C1PA 3SJKA 6ESTA 3LIWA 4E7RG 1C5PA 3EGGC 3P95A 1KLJH 1ZUBA 1EUFA 1FZZA 1XKAC 3B9FH 3O8DA 4X2WA 1PPEE 2BY8X 4MPAA 3PM3A 2ZP0H 2TRMA 3TJVA 1K22H 1FONA 3LC3A 3D23A 1C4Y2 4SGBE 1GHAG 2RCEA 4U30A 1DWEH 1GMCG 2J2UA 4Y7AA 3UNRA 4CHAC 2QKVA 2VIPA 1AKSB 3EYDA 1J9CH 3PMHB 2PDZA 3SV2H 1ZOMA 2ZU4A 2P3WA 1VCWA 1O2XA 1ZSJA 4CHAB 2OCVB 3VFEA 4YO9A 1HJ8A 2D26C 4UONA 1BMAA 1O32A 2AMPA 4X1NU 1CQQA 3UREA 3GY4A 3W95A 3QGLA 4WMFA 3KNXA 4P2AB 2WV4A 3Q3XA 5T6DA 2KRGA 2ZDVH 2BVSH 3RMLH 3GY7A 1DUEA 1XUKA 1CBWC 2A7JA 2EGOA 3PS4A 1XVOA 5A2MH 9ESTA 3MH7A 1XVMA 2VWMA 1JMOH 3LGTA 2CMYA 1CBWB 1O3BA 1I92A 1P2JA 2R3YA 3QUMP 2GD4B 1XXDA 1RY4A 2QXHA 1BA8B 1C1UH 1A0LA 1F0SA 1OWJA 2ZU2A 1ARCA 1TRNA 1GBCA 3RM2H 2HVXA 2Y5HA 1FXYA 1HFDA 3PTBA 1S6FA 2XBXA 4Q2KA 3GY3A 3A84A 2GZ7A 1C5UA 4TPIZ 1DLKB 2FS9A 2VINA 3ZVCA 3A80A 1C2FA 3D65E 1P2QA 2YNBA 1FI8A 1S5SA 2BD9A 1O34A 5E11A 2BHGA 4H42U 3RM0H 3UTUH 2GT8A 3CC0A 1ZLRA 2OS6A 2H9HA 2BVRH 4RN6A 4YTAA 2Q6FA 3TGJE 2I1NA 1P11E 4CH2B 2W7UA 3GGEA 1BRAA 3EA9A 1VJAU 1RGRA 2ZF0H 4NIXA 4Z33A 4HGCA 1BRBE 4AMHA 3O8BA 1TNKA 1F0RA 4REYA 5EGMA 2OD3B 1AVGH 1A5HA 3SW2B 2PKAA 1TOMH 3M36A 7GCHF 3HKJB 2I6SA 1C2GA 1GG6C 2BY7X 1O5CB 4GHTA 1UVSH 2B9LA 1GG6B 4Y0YE 3VGCC 2A4RA 2HE2A 3E8LA 3RDZA 3HKIB 5EPYA 4X8TH 1HLTH 1QAVB 3ITIA 1GI7B 4JZIA 3SJ8A 4WJG2 3SORA 1DX5M 1J14A 1GI5A 3VGCB 3SQHE 3SV8A 3ZZ7A 2IJOB 2ZEBA 5HYOA 2CHAC 3O8CA 4ISNA 1BMMH 1Q2WA 2QC2A 4K5ZA 3K1RA 3A81A 3I18A 1O2TA 2CHAB 1HAOH 2BD4A 2GGVB 5DP4A 4IMZA 1AKSA 1TQ0B 2UWPA 3CBYA 3TGIE 5LPEA 2VPHA 1W10U 1SB1H 2LA8A 1SHYA 1E38B 3BTHE 2O8WA 1YBOA 3SU5A 8ESTE 1HPGA 4FUGA 1BOQA 2Z3EA 1TQ7B 2GT7A 3C27B 1DPOA 4Z8JA 4D9RA 7GCHG 3RXQA 2FTLE 1AN1E 1JXPA 3SN8A 1T2MA 3QK1A 4Y7BA 5HGGA 1NS3A 1VA8A 2PZDA 4HFPB 1ZGIA 2YT8A 3ID3A 1TA6A 1QBOA 1C5QA 4XSKU 4CRCA 1FAXA 3VB3A 1D3DB 1H8IH 4ABJA 3BF6H 2WPHS 3SI3H 4RI0A 1TBRH 2EDZA 3L6PA 3LU9B 5GDSH 2VSVA 1X8SA 1P8VC 2HWLB 1MCVA 1RGQA 4Z0KA 1IAUA 1IHTH 2ALVA 1AWHB 3SGQE 5I7ZA 2K1ZA 2OPGA 2EEJA 1TNIA 3TSZA 1DWBH 2LNCA 2J9NA 2O8MA 1TPOA 1AWFH 3E0NB 2J34A 3SU2A 2WINI 5LGOA 4IN2A 1Y3XA 1IHJA 2UZCA 1YPJH 1HAZB 1L1NA 3S7KB 1WI2A 2J38A 4J2YB 4NSVA 1TOCB 1O5FH 4XE4A 4B75A 2E7KA 1H1BA 4TPYA 2V3OH 4Q2OA 4DT7B 1Y3UA 3BSQA 2WYJA 3MNXA 2JH5D 1TGSZ 3KHVA 3P8GA 1PPZA
chains in the Genus database with same CATH superfamily
4AG2A 2ZI2H 5EOKA 4JZEH 1NZQH 2ZU5A 2O8UA 1CSOE 1VCPA 2V6NA 3MQKC 1YYY1 2FOEA 5ESBA 1WFVA 3GY8A 3LKWA 1AZZA 1E34B 1H4WA 1QAVA 2F9PA 3ATIA 2ZQ1A 4X1QU 1PPGE 2FOFA 1GQ5A 2J98A 2HALA 2B5TB 4WY3A 4B71A 3S0NA 1AIXH 2PA1A 1QL9A 1V2OT 3L3TA 1VB7A 3KQ5A 4FU9A 5JBTA 1ELEE 5L2YH 4F55A 4OS2A 5FAHA 1H9LB 4Y8YA 4YLQH 2XBYA 2UUFB 1V2QT 2ODPA 2M3MA 1MZDA 2GKVE 4MTBA 3O5NA 1A5IA 2G81E 4NA7A 4WYTA 2FEQH 4AGJA 1C9PA 1Z7KA 2QAAA 1UW7A 3HPMA 2TGTA 2OUAA 1GJAB 3STJA 4JJ0A 3ATWA 3ZZAA 2B0FA 3BV9B 4FUFA 1BBRE 3Q00A 3V7TA 4WMEA 2SGEE 5T6GA 3HVQC 2XBVA 1YPHE 1C5MD 3CBXA 3A85A 3Q3YA 3EA8A 1OBXA 2BDCA 2Z9JA 2Q6DA 1V2ST 3I4WA 3VQGA 2G5VA 3RXMA 4TYDA 2GCHF 2VIOA 4H4FA 3FP8E 1P10A 4Y10E 4OS4A 1IQHA 3HK3B 4D9QA 1PPFE 2BD2A 4DIHH 1ELFA 2PTNA 2THFB 1SI5H 1OWKA 3KDKA 5CMXH 1XUJA 2OZFA 1OP8A 3E90B 1BCUH 4KFVA 1CA0C 5HDYA 1GBTA 2CXVA 1MD8A 2QCYA 2XW9A 1SHHB 2PKSC 4NIVA 1VITF 1THPB 1P3CA 3R3GB 3QDZB 5H4IB 3WWFA 1N6YA 2G52A 1GVKB 2PKSB 3KF2A 3SHCH 2CS5A 4DW2U 3HK6B 2D2DA 1XM1A 3AVZA 3EAJA 1AFEH 4K6YA 1N1LA 3NGHA 5ABWA 4X6MA 2ZO3H 1LKAA 1S82A 4IN1A 2GZVA 2XC0A 4FVBA 3M7TA 4NXRA 2L97A 5EXNA 1LQDB 2LC7A 1Y5AT 1BTWA 2JINA 2GCHG 5DP5A 2EY4C 4O03A 5FCRA 4TY6A 4X2VA 1FNIA 3GCHC 3IITA 1KXFA 5HMAA 1EZQA 1A46H 1N99A 2FLRH 3GCHB 3A7WA 2SFAA 3MNBA 1ZJDA 2BY6X 2AS9A 3TK5A 1VJ6A 4MDSA 1W14U 3S9AA 4BNRA 2P95A 2P3FH 1TNJA 3EDXB 1U3BA 1LO6A 3H5CB 1V2VT 2FN5A 5T1VA 1VITG 2KCOA 5F53A 1GM1A 1L4DA 2FOBA 2KYLA 1EATA 3B76A 3A83A 4TY7A 4WXVA 5I46H 1A3EH 1A0JA 3VXFH 4X0WU 3QDOA 1DFPA 1OHHD 4NWLA 5E0HA 1TWXB 2GZ8A 5DG6A 3EGKH 2BXUH 4ABAA 4Q4LA 1HV7A 1QB9A 1QHRB 2QXIA 3JXTA 1UM1A 3DA9B 2JH6D 3MH5A 3PDZA 2J5UA 1LTOA 3EE7A 4HI3A 2F5YA 3IG6B 5HM2A 3ID4A 2FZZA 5LH8A 3TIUA 3R68A 1XZ9A 2WL7A 3LNXA 1UHBB 1N7TA 2H2CA 1OBYA 3RXGA 2BYAX 3RLWH 1L6OA 2KOHA 1C1TA 4CRFA 3SHAH 4G69A 1V2RT 1FX0B 5FCKA 3UNSA 4JYTA 1V5QA 1C1NA 1NFWA 1K28D 1DY9A 4X6PA 3AAUA 2IPHA 2KG2A 1HNEE 4FXGH 4ACAA 1WTGH 1OOKB 1NRNH 1AE8H 1Y5UT 1ELAA 1SLVB 5E21A 2F83A 1VJ9U 1O3EA 3LGIA 3RC5A 2GTBA 4YOGA 3R0HA 1C1VH 4OEOA 2DM8A 1N8OC 5HEBA 3FFGA 3LGWA 1QB1A 3FVFB 5FBIA 3LGUA 2AEIH 1FDPA 3LH3A 1O5EH 1N8OB 1C2MA 3AW1A 1C2LA 3F0OA 1ZOKA 1V2NT 1TMTH 2O9QA 1N7FA 4IC5A 2OQSA 1MUEB 3U98H 3QN7A 3RXLA 2V0BA 2ZTXA 2YUYA 1FAKH 1BJVA 1HJAC 3KZDA 1YPKH 4HG6A 3NRLA 3R69A 1HXFH 5K0HA 1OWDA 4MPWA 3RXPA 1HJAB 4MLFB 2L4TA 4K3JA 2EDPA 3OTPA 5L30H 4ISIH 1UEWA 1CT4E 3EQ0H 2VGCC 1Y3WA 3SI4H 1DITH 3LC5A 1W0KD 1O2WA 3SFJA 4ZKOU 2G55A 3LDXH 1W9QA 2VGCB 2ZGBH 4ZH8A 5GPIB 1P04A 4JYVH 1NRSH 5F8ZA 3RXFA 3ZZ8A 2FTMA 2BD5A 1G9IE 1BTPA 1ABJH 1ELCA 1TRYA 3LPRA 1CE5A 4WH8A 5L2ZH 2PKUA 1TBZH 1C5OH 1ANBA 1ZMLA 2F3CE 2FWWA 4Y76A 1QBNA 1S81A 2BLVA 4WXIA 4A1XA 3UOUA 1OP0A 1W8BH 3F0PA 4MVNA 1UEPA 1WF8A 2X7ZA 2KZ4A 1GBKA 4UD9H 5KECA 4FUIA 1QGFA 1FC7A 2BD8A 2L74A 1WJLA 1JRSA 2JWEA 3KDGA 1W11U 2OBOA 3TJUA 1MC7A 2JOAA 3PROA 3S69A 1W13U 3PB1E 1O2QA 1HAIH 4INHA 5EG4A 3M5LA 1A61H 1TB6H 5EXMA 3PLBA 1UHBA 4UFFH 1K1LA 1KXAA 1UTJA 2YMSC 2ZHQH 3GOVB 3QGJA 1SGQE 1KXEA 1X5QA 1EB2A 1LDTT 1FLEE 2K1QA 2C93B 2R4HA 2YMSB 5E8EH 3TK9A 4MPVA 2OMJA 2Z3CA 1C5TA 3A7YA 4B76A 3RMNH 1EQ9A 2A32A 4NNMA 1BDAA 3HPTB 1GJCB 4U32A 4OAJA 1TYNA 3HPKA 3RU4E 2KL1A 1T8NA 1W0YH 1TX7A 5T6FA 1KTSB 4K8YA 3RU4D 1GBHA 2XC4A 3KIDU 1UK2A 1XUHA 2QIQA 1QB6A 4CRDA 5GXPA 3LGVA 3M37A 3M5NA 2BDIA 2XWBI 2Q6GA 1OYQA 1M5ZA 2P16A 5B6LA 3VEQB 3OEHD 1TGTA 2BY5X 3M7UA 3ZZDA 5EW1H 4NZQA 3OX7U 1TMUH 3MFJA 4NMTA 2G4UA 2Z3DA 2ZU3A 2Z17A 3UNQA 3QO6A 1PPHE 3PO1C 5L6NH 1HYLA 1G36A 1EP5A 2F9BH 3GDSA 4O97A 3PO1B 1QA0A 1DVAH 3N99A 2BQ6B 1CGJE 1TAWA 4ABHA 1SGPE 1W7GH 3URCA 2OC1A 3VPKA 4NFFA 3UY9A 2LELA 2JILA 1L4ZA 4HOPB 1LPGB 2D92A 2BQWB 2EEKA 2SGAA 2ZCHP 3SOEA 1PDRA 2Z94A 2AIQA 1DS2E 1TPPA 3SUZA 1B0EA 5E0JA 1NC6A 2ANMH 1SFIA 3OFND 2V3HH 2AGEX 1ZPBA 4BAHB 4AORA 2I0LA 1TP3A 4H11A 1TNGA 2ZA5A 3BTKE 1RD3B 1CGHA 1UMAH 1MFLA 1GBEA 2H9EH 4GAWA 3HATH 1YWUA 1CHOF 2FYRA 3KQBA 3DJAA 5DTHA 2QV1A 3QIKA 3MO3A 1GGDC 3KGPA 2ILNA 1SGDE 1HCGA 1KWAA 5HFCA 2UUJB 1GGDB 2W7SA 1D3QB 2MHOA 3UPEA 2TGPZ 4DJZB 1YF4A 2TPIZ 3FANA 1EPTC 5FHTA 2KJPA 3SOSA 5ESTE 1EPTB 3K9XB 2BM2A 2ZQ2A 1O30A 5HEYA 3VQFA 1EAUA 1WYKA 3F9GA 2CF8H 3DIWA 1IOEA 1RTKA 2A0QB 2BXTH 2HNTE 1UTNA 3LJOA 1WV7H 1CGIE 3NWUA 4F48B 2EXGA 4GCHF 1FC9A 3DJ3A 1Q7XA 1B7XB 3OEED 3KCGH 1W0ZU 4X6NA 1YP9A 5F03A 3TLOA 2I4SA 1CHOG 3T27A 2J95A 3TK6A 2IN2A 1TGCA 1QJ6B 5EU8A 3M5OA 1WCZA 4X6OA 5C94A 1C5WB 1TA2A 1O31A 1ANCA 1IQKA 4AZ2B 1GHZA 2YOLA 1INCA 4KKDA 1LKBA 1B5GH 1O2UA 4I31A 1EZSC 1D3PB 1F92A 1NTPA 4Y71A 1KLTA 1K21H 4WMDA 2A4OA 2KCAA 3ZRTA 8GCHF 2H5CA 1ACBE 4YOIA 2VSPA 5C20A 1KXBA 5FX5A 3RLEA 1Q3XA 2ZFRH 2KCPA 1GJ8B 1MZAA 4K8BA 4ZXYH 3KQDA 2XWAA 1O3KA 1AVWA 4JOEA 2BDHA 3E6PH 5JBCS 4GCHG 3FO8D 5C17A 3ID1A 1SFQB 2PUQH 2FOAA 3MU5A 2HGAA 3M3TA 1UEQA 1O33A 4KFWA 5DP9A 1E36B 2KJKA 3M3VA 1G2LA 3H7OA 1Q31A 1OBZA 2CK3D 2HLDD 3WWBA 2I0IA 3IWMA 3OSYA 3SNBA 1ELDE 3SUGA 4KGAA 3ZYDA 4MNXA 3DORA 1T4UH 4MPXA 5JBBS 1UTPA 4OS5A 1PYTD 3FOAA 1PPBH 2WHXA 2OK5A 1XKBC 1FQ3A 1Y8TA 5HF1A 4E7NA 3SV7A 1GL0E 8GCHG 1NF3C 2Y80A 5FL7D 2HGTH 1HAYB 4Q7XA 3MYWA 1O3NA 2VWLA 2WYGA 1C2JA 3EE0B 1FC6A 1DXPA 2ENOA 5HF4A 2VIDA 5GNDA 2CN0H 2VH0A 3F9HA 1GBFA 1EPTA 2PR3A 1HXEH 3ZYEA 1GBDA 3T26A 3CS7A 4E05H 1BRCE 1GCTC 1ZYOA 2QE7D 2A4QA 2ZGXH 1QBVH 2ZFPH 3TH2H 4FU8A 2HVYB 3F2FA 1V2TT 1GCTB 1V5LA 3DHKH 2JREA 3AAVA 2BLWA 1SOZA 5C0UA 2QF5A 4NMVA 5HEDA 1EFRD 3M35A 3BTTE 5EJLA 2L6OA 2WUCA 1K1OA 1G3CA 4X8UH 5DPAA 3JZ2B 5ILBA 1T32A 4JK5A 8LPRA 3ZVFA 2A45B 2EV8A 2FNEA 2XRCA 1A5GH 1NFYA 3A87A 3F2HA 5A0AE 8KME2 1O0DH 1ZPZA 2ZTZA 4CBOA 4I7YH 1QQ4A 1GHXH 2OBQA 3PWBA 1P09A 2RCZA 1KYNA 1ABIH 1K32A 1BE9A 4A5TS 2JIKA 3ATMA 1W9OA 1JRTA 1O38A 1Y5BT 3S9CA 2ZDNA 1E37B 4BAKB 4BAMB 2Q3GA 4WH6A 1H8HD 2B8OH 3PV2A 4U2WA 2F9NA 2KPLA 3MU8A 1O2SA 3SU1A 1MU8B 1HAXB 2IWNA 1TONA 3MO9A 4A1TA 4ASUD 3TGKE 1UTMA 3QJNA 4JZ1A 1Z1IA 1F2SE 1DWCH 2Y7XA 2DLUA 1EXFA 3I78A 4FLNA 2DE8A 2D8IA 1F0UA 2W3IA 3BTFE 2QF0A 3U9AH 1KDQB 3VXEH 4X2XA 2J92A 2OXSA 3QE1A 4RT1A 1MKXH 3CS0A 3SNCA 4I8LA 2IWOA 2W4FA 1OX1A 3FKSD 2BDGA 2OGPA 1BTYA 1H8ED 2NU3E 3GDVA 2SGQE 4CRBA 2RDEA 1WHDA 4B6FA 2KPKA 1C1OA 2ZFQH 4GSOA 1OZIA 2EDVA 3OU0A 2SGPE 1QFKH 5EW2H 2M0ZA 2PUXB 1IQLA 2W7RA 3A8DA 1YC0A 1SQAA 2FE5A 5F67A 3SGAE 3GY6A 2KOMA 4X2YA 1TP5A 2WPKS 3ZZ6A 5DJ7A 4NMPA 1K1MA 2D1JA 5HJ1A 1ID5H 4A7IB 1GJDB 2UUKB 2G5NA 1PQ7A 3KEEA 2ZDMA 5IL9A 1SLXB 3OY6U 4NFEA 2XTTB 1O36A 3DCLA 2MX6A 1Z87A 2GEFA 1ELVA 1F0TA 2D8WA 2ZCLP 1O2KA 3T29A 1L1JA 2RDLA 1EZXC 3E1XB 2NU4E 1NT1A 1C2HA 1D9IA 2BOHB 2ZZUH 1OXGA 1AZ8A 1ORFA 2JIZD 5DO4H 1MD7A 1GBIA 1AB9C 1BIOA 1FPCH 1C1RA 5DP8A 4ZMAH 1E79D 1AB9B 3QX5H 4AFSA 2ZIQH 4WVPE 3V3MA 4PQWA 1TRMA 1N6DA 1HB0B 2BMGB 2HOBA 3PTNA 1O5BB 1MAXA 2ZDLA 5I25A 5EQQA 1GHWH 5HM9A 5G4BA 5A09A 1HUTH 1SGFG 2H2BA 5CHBA 1WUNH 2YUBA 3F6UH 1NBME 1O3AA 1CO7E 1X5NA 1C5VA 2GVFA 4NGAH 5C0TA 3S9BA 1HBTH 1O2OA 1QAUA 4LXBH 1NBMD 2PFEA 4Q2QA 4X1SU 4K1SA 1P2IA 2PLXA 4I8HA 1EJNA 2QKUA 4FUHA 1O3DA 3WKLA 2BZ6H 1ZR0A 3CENA 1W9EA 2GCTC 1SGNE 2JKHA 2SNVA 4OS6A 4ABBA 4O9VA 2UUYA 2GCTB 4LMMA 3UR6A 3UUZA 5IK2D 1KDQA 1P9UA 2DAZA 1A0HB 4JOGA 2OLGA 2A2QH 1EJMA 1S84A 1MH0A 1F5RA 1QA7A 2AMDA 3SHWA 2FI4E 2LPRA 4NA9H 4D7FA 2CV3A 2YT7A 3SUDA 2J94A 2H2ZA 1D5GA 2CF9H 2G8TA 4I8GA 1TPAE 1CA0B 4FUBA 5IDKA 5TCCA 2FX4A 2EQNA 1AE5A 1X45A 4FVDA 2EEIA 2P59A 3RC6A 1YCPM 3VB5A 2AWXA 1QZ8A 4NXQA 1MTWA 1QLCA 2L4SA 3DJ1A 4DG4A 2ZPMA 2PHBA 4AYVB 1C4U2 1MU6B 4B73A 4O3UA 1DXWA 4JOJA 4UE7H 1ZRKA 1BMNH 2V35A 3SZEA 3QGNB 3I29A 2A2XH 2RA3A 2FI3E 4JZFH 5C1UA 5B42A 2Z9LA 4TT3D 4QT8C 4D8NA 1DDJA 2TGDA 4K72A 1LHCH 4O3TA 5HXFA 1ARBA 2R2WU 4CH8B 2BB4A 1F5KU 1Q3OA 2O2TA 4KP0A 3E17A 4NG9H 3LT3A 1QQUA 1KY9A 5EYZA 3SUEA 4XRNA 2I6VA 1K1IA 3DFLA 1TX6A 4BXWA 5JB9S 1SGTA 2LC6A 3CYYA 4WF8A 1UTKA 1IQIA 1GJ9B 4UU5A 2IWQA 5J4QA 1HAGE 3M3SA 4LK4A 1VKYA 1UTQA 1BB0B 2DUCA 2LP6A 1O3GA 3KN2A 4OGXA 5GWZA 4M7GA 1BITA 1BJUA 1PPCE 3QZQA 4ZAEA 1SQRA 3BTWE 1P57B 4Z6AH 3RUOA 1FMGA 1P03A 1O3MA 3T25A 5C67A 1G37A 1O37A 1GI2A 1DICA 1QNJA 3NZIA 2IWPA 1P1EA 2AGGX 2BZAA 1A1RA 1P2MA 3MTYA 1QL8A 5JPMH 1WXRA 1O3FA 1BHXB 2XXLA 3HGPA 3QJMA 1YGCH 1OPHB 4J1YA 2R0KA 2ZC9H 3T2NA 3RXBA 1RFNA 1P12E 1C5RA 1RTLA 5LPFA 1ZTKA 1K1PA 1ZRBA 4NIWA 5HKKD 1K1NA 3U69H 1Z8IB 1KSNA 1AY6H 1V3XA 1FPHH 1AUJA 3TMHA 2FDAA 1Y3VA 1C2IA 2FLBH 3BG4C 2OSGA 3A8AA 4MPUA 1BTUA 1ZSKA 5AFZH 4CBNA 3MWIU 4GLYA 2DMZA 2HPQH 3BG4B 1GQ4A 2UWOA 5BPEA 4MQAA 1RS0A 2LUIA 5C2ZA 2PTCE 3ZVEA 2H6MA 2OTVA 3KZEA 1SQTA 1FY5A 2JH0D 1V2UT 1L0ZA 1X7AC 3DUXH 1I16A 1VR1H 3LJJA 4X8VH 1UJVA 4FETA 5C5OA 2XNIA 1FCFA 1MQ6A 1O3HA 3PDVA 3RXVA 1AUTC 2FXRA 3TSVA 2M10A 2PGBB 5JBAS 2P3TB 1XUIA 1EASA 1FIWA 1FIZA 3P92A 4AFZA 1ELTA 3ENSB 2C8ZB 4GVDA 5T3HA 1ELBA 4M9FA 2EI6A 2QF3A 5H3JA 3SZNA 3TITA 2ZPSA 4BXSA 5CDFE 3A8CA 1N6EA 3VB6A 2BY9X 1YM0A 1SKYE 3GCTF 1GJ6A 4ZROA 5HFEA 4XBCA 1DUAA 3E3TA 5HIYA 4Q63A 2VIWA 2PNTA 1XUGA 4ZHMU 4IMQA 2F9OA 3A88A 1A3BH 2BDBA 2GZ9A 2ZFSA 5PTPA 1NU9A 1WIFA 4ABGA 5ETXA 3T62A 2R9PA 4YZUA 2R0LA 2Z9IA 1D6WA 2GMTC 4R2ZA 3RXCA 4YT7H 1O2JA 2EC9H 1O39A 2NU0E 2P8OC 1C2EA 1EAWA 1SBWA 2GMTB 3ZZ9A 5JYIA 2WV9A 3PMAB 1HRTH 1SGFA 2AINA 2P8OB 4FOUC 1UITA 4KELA 5JB8S 1WI4A 3BTGE 3SJIA 5F3XA 1EOJA 1LQEA 3AW0A 3TJOA 1A2CH 2EEGA 4L8NA 1NN6A 2VIQA 2WPMS 3ODDA 3P8FA 3SNDA 3UR9A 5C5NA 2AHME 3TH4H 3E16B 1MTVA 5FXLA 2G00A 4CR9A 1YPGH 4NIYA 4JJ3A 4CRAA 2UWLA 3GCTG 4ISLA 1NRRH 1W0JD 4B74A 1BTHH 3BIVH 1EP6A 4OS1A 4ZCNA 1SOTA 3UIRA 1LPZB 1V2KT 4AB9A 4GHQA 5A0CA 1ESAA 2JJ2D 1YPLH 3N7EA 3UOPA 1YY3A 2J97A 1MFGA 4Q7YA 5AFYH 3MU1A 2JXOA 1QY6A 2TIOA 1UEZA 4Q7ZA 3OTJE 1MKXK 1P0SH 3K2UA 4XDEA 4P02A 4RT0A 3SU6A 2FOHA 2STAE 1V1TA 2KV8A 1G32B 2ZG0H 2FS8A 2PP6A 2QXJA 4ABEA 1UJUA 1S83A 4CREA 3U8RH 4IBLH 3MOCA 2ZGHA 4F4OC 1YCPH 2FI5E 1C1WH 4YYXA 1ETSH 2EA3A 1C2KA 4SGAE 1QR3E 1V6BA 1UHPA 3TU7H 1C1QA 2BYGA 2H3MA 1V2LT 4A1VA 1ZZZA 1O2HA 2F9VA 1UVPA 3RXOA 3GS9A 1GBAA 1SSXA 5IYTA 4H6TA 3P6ZB 2QBWA 4DCDA 1IQMA 3E91A 3UWIA 3OYPA 1TIOA 1BRUP 2M0VA 1C4V2 1ZJKA 2GP9B 3P70B 1O5DH 5AVDA 1HJ9A 2M5TA 4ZKSU 4MNVA 1MAYA 2ZFFH 4ZUHA 3SO3A 1HAVB 3C1KA 2ZECA 1U39A 2AH4X 2ASUB 2ODYB 1NRPH 1ZMJA 1VGCC 1P3EA 5JDUB 2TGAA 2QXGA 1K1JA 2FOMB 1UVOA 1UF1A 1YPHC 1PQ8A 1VAEA 1VGCB 1P1DA 2PV9B 3U1JB 1MTUA 1UCYH 3UWJH 4FGMA 2FCFA 2PSYA 1GJ7B 3DFJA 1GJ5H 5B6OA 3CP7A 4Y8ZA 3PV5A 1TGNA 3B23B 2NU2E 1O3PB 1H8DH 3MO6A 5J4SA 4XBBA 2VVUA 2ZPQA 1T8MA 2ZNKH 1WG6A 1NU7B 3A7ZA 1JWTA 1GI9B 1GBMA 3M5MA 1DT2A 4I8JA 4B2CA 2Y7ZA 2C8WB 4I32A 1CT2E 2C8YB 3L4FD 4Y0ZE 3ZZBA 3EGHC 1LVBA 2ZKSA 3A7TA 4D7GA 1LHEH 1RZXA 4NA8A 9LPRA 3GABA 4MG3A 3T28A 4E06H 2VNTA 2BQ7B 2F91A 1CHGA 1SGIB 3VB7A 3SBKA 1O3CA 1T8OA 5GIBA 2NU1E 3JZ1B 4K69A 1P01A 2ZTYA 1ZTJA 3ZV9A 2ANWA 1RIWC 1Y7NA 4JOFA 1FY4A 3UQVA 3ZV8A 3QZRA 1U37A 1ANEA 1THRH 2HPPH 1ZHPA 3Q77A 1RIWB 1RGWA 1J16A 1YBWA 1Z8GA 2Z9GA 1FJSA 1LHFH 1H9HE 2VVCA 3F9EA 4X1RU 1ESBA 4DURA 4XD7D 1BUIA 1YLCA 2IPQX 4ABDA 3RLYH 1X5RA 1TGBA 3RXJA 5DGJA 4Y11E 4KTSA 5TCAA 4FUJA 3LONA 1W7XH 5A8ZA 5EQRA 1A7SA 1FV9A 3D49H 2BOKA 2A5IA 3SJ9A 2VU8E 3MI4A 1OP2A 3RXKA 5E1YA 1MTNC 2C8XB 4PROA 2A5AA 4BANB 4E3BA 3GICB 1O2PA 2VWOA 1SR5C 4UFGH 2PKTA 2FM2A 3OAAD 1MTNB 1JBUH 1SGYE 3A7XA 1UO6A 3ID2A 2A1DB 3DD2H 1SG8B 4FUCA 3FZDA 2Y5FA 2WUBA 1WQSA 4A92A 5E22A 4UFDH 1C5ZB 2Z9KA 4BAOB 4JORA 2P93A 1AU8A 1MMJN 4KTCA 1HAVA 4K78A 1COWD 1DLEA 1FUJA 4Q2NA 1GVLA 4HOPA 1WBGB 2Y81A 2KX4A 2GDEH 4GVUA 2F0AA 3SU0A 4NNLA 4XHVA 1UK4A 1LCYA 1BFEA 1TNHA 1B8QA 4CR5A 4AGKA 1W2KH 4RKOB 1AHTH 2PWXA 4AYYB 2RFKC 2DB5A 2G4TA 1GDNA 3GJ9A 3BEUA 1GI6A 3URDA 2AMQA 2C90B 2FYQA 4RSPA 2EEHA 4NZLA 3Q76A 5HFFA 3RU4T 4CRGA 3A7VA 2ANYA 1HDTH 2W6JD 1O2NA 2AERH 1LVYA 4KTUA 5CHAC 3ZIAD 5EJ1A 2IOTA 5EODA 5HETA 1FY8E 4TWYA 1P2KA 4F8KA 3A89A 1TE0A 5EXLA 3H09A 1KIGH 4OS7A 2OINA 5CHAB 3ATLA 1O2VA 1AD8H 1S6LA 5K7RA 1N6XA 4B1TA 1V2MT 2ZHDA 3KYGA 1EOLA 1OYTH 2GV6A 3TSWA 2ZGJA 7LPRA 1ELGA 1AMHA 2VH6A 2PW8H 5C3NA 2F43B 2SGFE 5KEDA 4ABFA 1P02A 2WZQA 4K75A 3W94A 1JIMA 4YLUA 1GI4A 1L2EA 1O3IA 2H1UA 3G01A 3SU4A 3F1SB 1E0FD 1TABE 1D3TB 4ESTE 1HAPH 3M61U 2O8LA 3RXHA 4E34A 1Q3PA 2D90A 2QG1A 3SNAA 1ANDA 4Q6SA 1N6FA 4AX9H 5F8XA 2WPIS 4X1PU 1PFXC 5DK1A 1ETTH 1FN6A 1GHVH 1GCDA 5C1YA 1PJPA 2QF4A 4AOQA 2M0UA 4Q2PA 5E6PB 1UFXA 2PSXA 4YT6H 1YKTA 3AXAA 2OQUA 3FY5A 1RTFB 3MMGA 5FX6A 2VVVA 1G3EA 2SNWA 2KAIB 2XBWA 4JK6A 2BDYA 4BTUB 1WH1A 4HTCH 3F9FA 3V0XA 2VZ5A 1SGRE 4LZ4B 1NFUA 5DSFA 4Z1MD 4Q6HA 3QTOH 4GPGA 2HNTF 1UVTH 5FBEA 4ZKNU 3BEIB 2WPJS 3ZVAA 1WDIA 3NFKA 2FIRH 3I77A 3ATKA 3RP2A 3RXSA 1GDUA 2BLQA 3MH6A 1GBLA 3TNSA 1VITH 2EHRA 3GYLB 1U6QA 1P9SA 3RXRA 4DGJA 3VG8A 1V62A 2H3LA 4NMRA 3FP7E 2DJTA 1GVZA 5E2OA 2EGNA 3AASA 1MKWH 3RXEA 4AFUA 1ESTA 2CSJA 1IHSH 2JETC 4F49A 3BN9A 3SU3A 1MTSA 2G2LA 1O2IA 2FOCA 1QURH 2VWNA 3FN8A 1AGJA 3FP6E 3MNCA 5KGOA 4YOJA 2ODQA 1X9ZA 2JETB 1T31A 1PQAA 4UFEH 1IU0A 4FUDA 1DY8A 1EAIA 4NMOA 1BZXE 5BRRE 2AGIX 1LPKB 2XCNA 1RRKA 1SMFE 4I86A 3WY8A 2FESH 3ZZ4A 1KXDA 3SGBE 2BDAA 4TSFD 3W1EA 3BTEE 1GI3A 3N7OA 1F5LA 4XOJA 1OS8A 4DY7B 2G51A 1KLIH 2KFWA 3UQOA 1GHYH 2ESTE 3E0PB 2GDDA 2J4IA 5AHGH 5D13A 2W5EA 3ESTA 1B0FA 1C5SA 3PWCA 3BTDE 2TBSA 2YMSD 3CNRA 1Z8RA 3NCLA 1OWHA 2K8IA 1BHXF 2BVXH 4ZHAA 1OKXA 5DP3A 1GI1A 1HGTH 1Z6EA 3I1EA 5G1EA 3BTQE 2HE4A 1O2YA 1TBQH 1O5AB 5FB8C 1Z8JB 3GSLA 1MBQA 1K0HA 1DWDH 1Y3YA 2AIPA 5FPTA 1AFQC 7ESTE 3ZZ3A 2IJD1 5FPYA 3LOXA 1WOFA 1AO5A 1RXPA 3TNTA 2DE9A 1QRZA 4BOHA 4NMSA 1AFQB 3F2GA 5GCHF 2ZPLA 1YCPK 4THNH 4UU6A 2EJYA 4OM9A 1V6DA 4H6SB 1TQ3A 2C3SA 4NSYA 4X8SH 3T5FH 2ZDAH 4ISHH 3RXTA 1Z86A 1TFXA 2KAIA 2H9TH 3ELAH 2H5DA 3ZZCA 2GV7A 4P0CA 1GJ4H 3DT0H 3PLPA 1WQVH 3QTVH 2Y6TA 3F3BA 1IQEA 1D6RA 4BTTB 1SGEE 2JSNA 1A4WH 1C1MA 5E2PA 2VWRA 2VB0A 1C1SA 4INLA 1BBRH 4BAQB 3GCOA 2RG3A 1K2I1 1CT0E 1D4PB 3VB4A 4D76A 1UM7A 1NY22 3SHUA 3U28C 1YPMH 3TVJB 2ZCKP 1THSH 3RMOH 1HAHH 4JOPA 1O2GH 3BPUA 1UCYK 2V7QD 4R8TB 1O5GH 3STIA 1N7EA 4YESB 1GJBB 3A86A 5GCHG 4A6LA 3PRBA 1V2PT 1P2OA 4TWWA 1WHAA 3K82A 1NO9H 5HFBA 4EDJA 2HNTC 4BTIB 5DP7A 1TNLA 3ZVGA 2ULLA 1EAXA 1KEFA 3RL8A 1IQGA 3U1IB 2KJDA 2XC5A 3PMBB 1ZGVA 1GDQA 4AG1A 2KQFA 3SNEA 1J8AA 2BX4A 1DM4B 1OWIA 4AB8A 2R3UA 2WV5A 2Z7FE 3P17H 1GL1A 1WU1A 4B2AA 1DSUA 1H9IE 3F68H 4Y8XA 1QRWA 4YM9A 1C5YB 1F7ZA 4DOQA 1EJAA 4AC9A 4ASHA 4ISOA 1BQYA 3TPIZ 2FX6A 1GBBA 5AF9H 5C1XA 2DC2A 4NXPA 5GLJA 1NPMA 1KTTB 1O3OA 1TALA 2FOGA 3PLKA 5EQSA 5F8TA 1M9UA 3RMMH 1UVUH 4ZXXH 3NK8A 2HLCA 2Y82A 1DOJA 3GDUA 1ZHRA 4UEHH 3CBZA 2EGKA 3BIUH 4DT4A 2AWUA 2I04A 1GMHF 4INKA 4K60A 4JOHA 5JXBA 3SUFA 3NFLA 2DKRA 4MNWA 1QCPA 1QJ7B 2V90A 1EKBB 3GY5A 4K1EA 4HZHA 4K2YA 3S7HB 1KMHB 3FZZA 1HIAB 1X6DA 2R2MB 3GISB 3P8NA 1ETRH 3QWCH 2ZDKA 4GHNA 1XMNB 4N6XA 2A7CA 5A0BA 1P05A 3BEFB 2I6QA 2XCFA 1SVPA 1AI8H 5FPSA 1PYTC 1XXFA 1SLUB 1FY3A 1GBJA 1MBMA 2FPZA 5DKMA 2G5MB 2YTWA 1ZSLA 1Z71A 1IU2A 1XX9A 2M0TA 2W26A 1VZQH 1YPEH 3M7QA 1C5XB 3GYMA 1S85A 1L1GA 1GI8B 2OC8A 3MU0A 4JCNA 1UJDA 3RXIA 2QYIA 4LOYH 2P3UB 4JOKA 2K20A 1J15A 6GCHF 2BTCE 1GMHG 4DVAU 2F9UA 1NRQH 4GUXA 2CJIA 2P94A 3RC4A 1UTLM 2QY0B 1T8LA 5DP6A 2ZGCA 3LNYA 2O8TA 4LZ1H 1GI0A 3TH3H 1NESE 1C5LH 4ABIA 4JMYA 3PV4A 5HIZA 4Q80A 3K50A 1BTZA 1DSTA 5G1DA 1AQ7A 3ZVDA 4DIIH 2M2AA 1WTHD 4ACBA 5CE1A 4JZDH 1CVWH 3ZZ5A 4AFQA 2CGAA 2K0QA 1SPJA 2OC0A 1BT7A 2Q1JA 5TJXA 2LOBA 2Z6BD 2PGQB 1R6JA 4Y79A 3PMJA 1OWEA 1O2RA 2A5KA 3LH1A 1CA8B 2SGDE 1ZTLA 1T4VH 2QGRA 2GJGA 5EIYA 4IC6A 6GCHG 1ZPCA 3GY2A 1W12U 4RKJB 5F6MA 1U38A 4I33A 3NPSA 2VJ1A 2BD7A 2Q9VA 3MU4A 2XNDD 4NMQA 4GVCA 1O3LA 2A31A 2FP7B 2W3KA 1QRXA 2ZU1A 3PYHA 1G2MA 1V2WT 3K6YA 1O3JA 3H7TA 1JIRA 2BD3A 2A4GA 3LGYA 3OY5U 1MCTA 1GWAA 1QL7A 1P06A 2ZPRA 2KOJA 2VRFA 3NKKA 1HIAA 1UTOA 3MHWU 3RXDA 1QTFA 2Y5GA 1SLWB 1MABB 1SQOA 1FY1A 1DANH 3ZVBA 4OEPA 1IQJA 1DE7H 4ZKRU 3NCVA 3UFAA 6LPRA 1IQNA 1TMBH 1QIXB 3EA7A 1RJXB 3QLPH 1IQFA 1O2MA 3WKMA 1Z1JA 1GPZA 2AYWA 1BTXA 4UDWH 3O8RA 2DLSA 3SJOA 2B7DH 1NFXA 4K1TA 3U8TH 2REYA 1NM6A 4I8KA 2VIVA 1SL3A 2KAWA 4VGCC 1SC8U 1G9OA 2XYAA 2KM0A 1UK3A 3L33A 1FN8A 4AN7A 4FUEA 4VGCB 3V13A 1BMLA 1TLDA 1UJ1A 1EX3A 3ODFA 4YDPA 4MNYA 4B2BA 5SGAE 5A2PA 1O2ZA 1S6HA 1AVXA 5EPNA 1MKWK 2QT5A 2ZFTA 3BTME 1LMWB 3KYFA 1V2JT 1T7CA 3RXAA 3V12A 2JJ1D 1QJ1B 1K9OE 3A82A 5A8XA 3K6ZA 1SGCA 1GHBF 1OSSA 5A8YA 1WFGA 3AK5A 1CU1A 6CHAC 4Q3HA 4E35A 2EI8A 3KQEA 2EAQA 1EB1H 1C2DA 4JL7A 1O35A 3BG8A 3O46A 3K65B 4JYUH 4OGYA 6CHAB 3KQCA 3RXUA 1KXCA 1Y59T 3KL6A 3PRDA 4U01A 4R0IA 3DSPA 1W3CA 5GJ4B 1LHDH 1C9TA 4IGDA 1WAYB 5EZ0A 1Z6JH 1TPSA 1GMDF 2BX3A 3MH4A 2KA9A 3TJNA 1YLDA 2XOKD 4K76A 1LVOA 1NTEA 2OCSA 2V1WA 1LHGH 4FU7A 1S0QA 3HGNA 2NWNA 2OP9A 2VBCA 1G3BA 2QKTA 1E1RD 1UCYE 2ZHWH 5LPRA 1C5NH 1E35B 1G30B 3D62A 2ALPA 2QA9E 2A7HA 1S0RA 2CSSA 3B8JA 1LVMA 1ZMNA 3U8OH 1G3DA 2ANKH 4WWYA 1ZHMA 4Y6DA 3OE7D 4NCYA 2C4FH 1GHBG 2HRVA 3A8BA 2QN5T 2STBE 2ZWLH 3GCNA 1EZUC 2WPDD 4IS5A 1PQ5A 3UAIC 3NUMA 2AWWA 1GHAF 2AFQB 2ZHEH 4ZHLU 2FO9A 1WF7A 2YNAA 1GMCF 3CH8A 2RRMA 5E0GA 1MQ5A 3SQEE 2GX4A 5HFDA 1WSSH 2BLOA 1P2NA 1VCQA 1JOUB 1GMDG 2ZHFH 3SV6A 4WYUA 4NWKA 3DSGA 2WPLS 4B6EA 1J17T 2FODA 3RL7A 1XUFA 2PKAB 3FAOA 1TX8A 4IW4E 1BBRK 2OC7A 3MNSA 4O06A 4XFQA 2FMJA 3P8OA 2OQ5A 2KBSA 3NXPA 3R0FA 7KMEH 2RA0A 4XBDA 3Q3KA 3KHFA 1NROH 2EI7A 3SYJA 1O2LA 3SV9A 1C1PA 3SJKA 6ESTA 3LIWA 4E7RG 1C5PA 3EGGC 3P95A 1KLJH 1ZUBA 1EUFA 1FZZA 1XKAC 3B9FH 3O8DA 4X2WA 1PPEE 2BY8X 2WSSD 4MPAA 3PM3A 2ZP0H 2TRMA 3TJVA 1K22H 1FONA 3LC3A 3D23A 1C4Y2 4SGBE 1GHAG 2RCEA 4U30A 1DWEH 1GMCG 2J2UA 4Y7AA 3UNRA 4CHAC 2QKVA 2VIPA 1AKSB 3EYDA 1J9CH 3PMHB 2PDZA 3SV2H 1ZOMA 2ZU4A 2P3WA 1VCWA 1O2XA 1ZSJA 4CHAB 2OCVB 3VFEA 4YXWD 4YO9A 1HJ8A 2D26C 4UONA 1BMAA 1O32A 2AMPA 4X1NU 1CQQA 3UREA 3GY4A 3W95A 3QGLA 4WMFA 3KNXA 2W6ID 4P2AB 2WV4A 3Q3XA 5T6DA 2KRGA 2ZDVH 2BVSH 4P00A 3RMLH 3UB0A 3GY7A 1DUEA 1XUKA 1CBWC 2A7JA 2EGOA 3PS4A 1XVOA 5A2MH 9ESTA 3MH7A 1XVMA 2VWMA 1JMOH 3LGTA 2CMYA 1CBWB 1O3BA 1I92A 1BMFD 1P2JA 2R3YA 3QUMP 2GD4B 1XXDA 1RY4A 2QXHA 1BA8B 1C1UH 1A0LA 1F0SA 1OWJA 2ZU2A 1ARCA 1TRNA 1GBCA 3RM2H 2HVXA 2Y5HA 1FXYA 1HFDA 3PTBA 1S6FA 2XBXA 4Q2KA 3GY3A 3A84A 2GZ7A 1C5UA 4TPIZ 1DLKB 2FS9A 2VINA 3ZVCA 3A80A 1C2FA 3D65E 1P2QA 2YNBA 1FI8A 1S5SA 2BD9A 1O34A 5E11A 2BHGA 4H42U 3RM0H 3UTUH 2GT8A 3CC0A 1ZLRA 2OS6A 2H9HA 2BVRH 4RN6A 4YTAA 2Q6FA 3TGJE 2I1NA 1P11E 4CH2B 2W7UA 3GGEA 1BRAA 3EA9A 1VJAU 1RGRA 2ZF0H 4NIXA 4Z33A 4HGCA 1BRBE 4AMHA 3O8BA 1TNKA 1F0RA 4REYA 5EGMA 2OD3B 1AVGH 1A5HA 3SW2B 2PKAA 2KR7A 1TOMH 3M36A 7GCHF 3HKJB 2I6SA 1C2GA 1GG6C 2BY7X 1O5CB 2F4LA 4GHTA 1UVSH 2B9LA 1GG6B 2JDID 4Y0YE 3VGCC 2A4RA 2HE2A 3E8LA 3RDZA 3HKIB 5EPYA 4X8TH 1HLTH 1QAVB 3ITIA 1GI7B 4JZIA 3SJ8A 4WJG2 3SORA 1DX5M 1J14A 1GI5A 2J98B 3VGCB 3SQHE 3SV8A 3ZZ7A 2IJOB 2ZEBA 5HYOA 2CHAC 3O8CA 4ISNA 1BMMH 1Q2WA 2QC2A 4K5ZA 3K1RA 3A81A 3I18A 1O2TA 2CHAB 1HAOH 2BD4A 2GGVB 5DP4A 4IMZA 1AKSA 1TQ0B 2UWPA 3CBYA 3TGIE 5LPEA 2VPHA 1W10U 1SB1H 2LA8A 1SHYA 1E38B 3BTHE 2O8WA 1YBOA 3SU5A 8ESTE 1HPGA 4FUGA 1BOQA 2Z3EA 1TQ7B 2GT7A 3C27B 1DPOA 3DSOA 4Z8JA 3WW7A 4D9RA 5DN6D 7GCHG 1E1QD 3RXQA 2FTLE 1AN1E 1JXPA 3SN8A 1T2MA 3QK1A 4Y7BA 5HGGA 1NS3A 1VA8A 2PZDA 4HFPB 1ZGIA 2YT8A 3ID3A 1TA6A 1QBOA 1C5QA 4XSKU 4CRCA 1FAXA 3VB3A 1D3DB 1H8IH 4ABJA 3BF6H 2WPHS 2KCYA 3SI3H 4RI0A 1TBRH 2EDZA 3L6PA 3LU9B 5GDSH 2VSVA 2V3MA 1X8SA 1P8VC 2HWLB 1MCVA 1RGQA 4Z0KA 1IAUA 1IHTH 2ALVA 1AWHB 3SGQE 5I7ZA 2K1ZA 2OPGA 2EEJA 1DWBH 3TSZA 1TNIA 2LNCA 2J9NA 2O8MA 3N7DA 1TPOA 1AWFH 3E0NB 5EJZA 2J34A 1YLNA 3SU2A 2WINI 5LGOA 4IN2A 1Y3XA 1IHJA 2UZCA 1YPJH 1HAZB 1L1NA 3S7KB 1WI2A 2J38A 4J2YB 4NSVA 1TOCB 1O5FH 4XE4A 4B75A 2E7KA 1H1BA 4TPYA 2V3OH 4Q2OA 4DT7B 1Y3UA 3BSQA 2WYJA 3MNXA 2JH5D 1TGSZ 3KHVA 3P8GA 1PPZA
chains in the Genus database with same CATH topology
4AG2A 2ZI2H 5EOKA 4JZEH 1NZQH 2ZU5A 2O8UA 1CSOE 1VCPA 2V6NA 1YYY1 2FOEA 5ESBA 1WFVA 3GY8A 3LKWA 1AZZA 1E34B 1H4WA 1QAVA 2F9PA 3ATIA 2ZQ1A 4X1QU 1PPGE 2FOFA 1GQ5A 2HALA 2B5TB 4WY3A 4B71A 3S0NA 1AIXH 2PA1A 1QL9A 1V2OT 3L3TA 1VB7A 4FU9A 5JBTA 1ELEE 5L2YH 4OS2A 5FAHA 1H9LB 4Y8YA 4YLQH 2XBYA 2UUFB 1V2QT 2ODPA 2M3MA 1MZDA 2GKVE 4MTBA 3O5NA 1A5IA 2G81E 4NA7A 4WYTA 2FEQH 4AGJA 1C9PA 1Z7KA 2QAAA 3HPMA 2TGTA 2OUAA 1GJAB 3STJA 4JJ0A 3ATWA 3ZZAA 2B0FA 3BV9B 4FUFA 1BBRE 3Q00A 3V7TA 4WMEA 2SGEE 5T6GA 3HVQC 2XBVA 1YPHE 1C5MD 3CBXA 3A85A 3Q3YA 3EA8A 1OBXA 2BDCA 2Z9JA 2Q6DA 1V2ST 3I4WA 3VQGA 2G5VA 3RXMA 4TYDA 2GCHF 2VIOA 4H4FA 3FP8E 1P10A 4Y10E 4OS4A 1IQHA 3HK3B 4D9QA 1PPFE 2BD2A 4DIHH 1ELFA 2PTNA 2THFB 1SI5H 1OWKA 3KDKA 5CMXH 1XUJA 2OZFA 1OP8A 3E90B 1BCUH 4KFVA 1CA0C 5HDYA 1GBTA 2CXVA 1MD8A 2QCYA 2XW9A 1SHHB 2PKSC 4NIVA 1VITF 1THPB 1P3CA 3R3GB 3QDZB 5H4IB 1N6YA 2G52A 1GVKB 2PKSB 3KF2A 3SHCH 2CS5A 4DW2U 3HK6B 2D2DA 1XM1A 3AVZA 3EAJA 1AFEH 4K6YA 1N1LA 3NGHA 5ABWA 4X6MA 2ZO3H 1LKAA 1S82A 4IN1A 2GZVA 2XC0A 4FVBA 3M7TA 4NXRA 2L97A 5EXNA 1LQDB 2LC7A 1Y5AT 1BTWA 2JINA 2GCHG 5DP5A 4O03A 5FCRA 4TY6A 4X2VA 1FNIA 3GCHC 3IITA 1KXFA 5HMAA 1EZQA 1A46H 1N99A 2FLRH 3GCHB 3A7WA 2SFAA 3MNBA 1ZJDA 2BY6X 2AS9A 3TK5A 1VJ6A 4MDSA 1W14U 3S9AA 4BNRA 2P95A 2P3FH 1TNJA 3EDXB 1U3BA 1LO6A 3H5CB 1V2VT 2FN5A 1VITG 1GM1A 1L4DA 2FOBA 2KYLA 1EATA 3B76A 3A83A 4TY7A 4WXVA 5I46H 1A3EH 1A0JA 3VXFH 4X0WU 3QDOA 1DFPA 4NWLA 5E0HA 1TWXB 2GZ8A 5DG6A 3EGKH 2BXUH 4ABAA 1HV7A 1QB9A 1QHRB 2QXIA 3JXTA 1UM1A 3DA9B 2JH6D 3MH5A 3PDZA 1LTOA 4HI3A 2F5YA 3IG6B 5HM2A 3ID4A 2FZZA 5LH8A 3TIUA 3R68A 1XZ9A 2WL7A 3LNXA 1UHBB 1N7TA 2H2CA 1OBYA 3RXGA 2BYAX 3RLWH 1L6OA 2KOHA 1C1TA 4CRFA 3SHAH 4G69A 1V2RT 5FCKA 3UNSA 4JYTA 1V5QA 1C1NA 1NFWA 1K28D 1DY9A 4X6PA 3AAUA 2IPHA 2KG2A 1HNEE 4FXGH 1WTGH 1OOKB 1NRNH 1AE8H 1Y5UT 1ELAA 1SLVB 5E21A 2F83A 1VJ9U 1O3EA 3LGIA 3RC5A 2GTBA 4YOGA 3R0HA 1C1VH 4OEOA 2DM8A 1N8OC 5HEBA 3FFGA 3LGWA 1QB1A 3FVFB 5FBIA 3LGUA 2AEIH 1FDPA 3LH3A 1O5EH 1N8OB 1C2MA 3AW1A 1C2LA 1ZOKA 1V2NT 1TMTH 2O9QA 1N7FA 4IC5A 2OQSA 1MUEB 3U98H 3QN7A