2HGAA

Solution nmr structure of conserved protein mth1368, northeast structural genomics consortium target tt821a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
QPDGVQIDSVVPGSPASKVLTPGLVIESINGMPTSNLTTYSAALKTISVGEVINITTDQGTFHLKTGRNPNNSSRAYMGIRTSNHLRVRDSVASVLGDTLPFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein MTH1368
publication title Solution NMR Structure of Conserved protein MTH1368, Northeast Structural Genomics Consortium Target TT821A
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2hgaA01
4WYTA 2JREA 1MFGA 4JOFA 2K1ZA 1N7TA 1XZ9A 4Z8JA 4K6YA 3QGLA 1OBXA 5E11A 2EGKA 1UITA 1ZUBA 2AWXA 5I7ZA 2KPKA 4Q6SA 1BE9A 2EDZA 2IWQA 5HFCA 5HFDA 5GLJA 1N7EA 2V90A 3CBYA 4REYA 1X8SA 4HOPB 4K75A 3O46A 4NNMA 2YTWA 2EV8A 3O5NA 1I92A 2KOMA 2E7KA 2K20A 3RL8A 5E22A 3DORA 2EDPA 4JORA 2LC6A 5EYZA 2Z9IA 2DM8A 2QKVA 4Q2NA 2W7RA 3JXTA 3PV4A 3HVQC 3GDUA 4IC6A 5HF4A 5FB8C 2I1NA 1UFXA 1BFEA 1U3BA 3BPUA 1OBZA 1X5RA 3NFLA 4AMHA 5F67A 5E6PB 2DAZA 1WJLA 2DLUA 1VAEA 2PZDA 4YYXA 2IWPA 1Q3OA 3FY5A 2PKUA 2KBSA 1K32A 1VB7A 5HETA 3QO6A 1KY9A 4GVCA 1ZOKA 1N6FA 2EJYA 3NGHA 1FCFA 2VSPA 3GDSA 2CS5A 1WFGA 4KFWA 3PDZA 2FCFA 2QT5A 2OS6A 2ZPMA 3SOEA 2PNTA 2RRMA 3SFJA 4HOPA 1X6DA 1RGWA 3CBZA 3CH8A 5HEDA 4OAJA 2EEHA 2KPLA 1I16A 1V5QA 2YUBA 1T2MA 1UEQA 3LNYA 1R6JA 3RL7A 2IWOA 2D90A 3B76A 3PV5A 3ID4A 1RZXA 3R69A 3ZRTA 2QBWA 1N7FA 4Q6HA 2M10A 2L4SA 1W9EA 2HGAA 2D92A 2LA8A 2KV8A 1NTEA 1VCWA 2KJKA 4FGMA 1U37A 2KYLA 1YBOA 1WHDA 4H11A 2IWNA 1KEFA 1SOZA 2CSJA 5JXBA 3TMHA 3CBXA 4JOGA 2HE2A 4NMOA 1W9QA 1WF8A 2I4SA 4OEPA 2F0AA 3E17A 1VJ6A 2PDZA 1V6BA 4Q3HA 1TE0A 2L97A 2OQSA 2VWRA 3TSVA 5A2PA 1TP3A 2DJTA 1FC9A 3HPMA 1N6DA 1WG6A 5HF1A 3DIWA 1UJUA 2L4TA 3K50A 3PS4A 2I0IA 1N99A 1PDRA 2F5YA 5HEYA 3LNXA 4E34A 1U38A 4JOKA 2BYGA 4JOHA 4MPAA 2AWWA 2JIKA 1TP5A 1WH1A 2ENOA 2Z17A 1QAVB 1P1DA 2KG2A 3QE1A 5D13A 1WI4A 1WF7A 1Y7NA 2OPGA 2JINA 1P1EA 4NMRA 2OMJA 1SOTA 2GZVA 2AWUA 2QG1A 4GVDA 2KA9A 1N6EA 2KAWA 3ID3A 2AINA 2FN5A 2M3MA 3PV2A 2EEIA 1G9OA 4F8KA 4G69A 2FE5A 3TSZA 3GCNA 2D8IA 3QIKA 1OZIA 2CSSA 1W9OA 2EEJA 2OCSA 3EGHC 3MH4A 3GJ9A 2LOBA 2EEGA 3R0HA 4R2ZA 4XHVA 4YDPA 2VPHA 2LC7A 3VQFA 4P0CA 4O06A 2KJDA 3I4WA 2OGPA 2QKTA 1UM7A 2DMZA 1V62A 5E21A 5HDYA 2OSGA 3CYYA 1WIFA 3MH6A 2KJPA 4P2AB 1IU0A 2H3LA 2KOHA 1RY4A 2O2TA 3SUZA 4UU5A 2JOAA 3GGEA 4UU6A 3DJ1A 1QLCA 1LCYA 2H2BA 1FC6A 3MH7A 1WHAA 3ID2A 1Y8TA 4NNLA 2M0TA 1GM1A 2X7ZA 1RGRA 2EHRA 4L8NA 4K76A 1IU2A 4JOEA 1UM1A 4N6XA 5H3JA 3I1EA 3EGGC 1GQ5A 3GDVA 2OZFA 5B6LA 1M5ZA 3OTPA 1B8QA 2WL7A 3K82A 4Q2QA 1U39A 4NXQA 2P3WA 2Q9VA 3STJA 3GSLA 3TSWA 2PA1A 2H2CA 3GCOA 1MC7A 1KWAA 2PKTA 2I6VA 1UEZA 1UEPA 4E35A 5EZ0A 4Q2PA 4NMTA 2M0VA 3RLEA 3WKLA 4KFVA 3VQGA 1X45A 5HFBA 3KHFA 3SHWA 1D5GA 1FC7A 3SHUA 4K72A 5E1YA 2I0LA 1UF1A 2KOJA 4GHNA 5GNDA 2FNEA 5HJ1A 5HFFA 3ID1A 3DJ3A 1V1TA 1WI2A 2EXGA 4JOJA 1GQ4A 2G2LA 2H3MA 3QDOA 1TQ3A 3R68A 2R4HA 3HPKA 2EAQA 1L6OA 2M0ZA 2LUIA 1Z87A 2YT7A 4E3BA 2EGOA 2DLSA 2VSVA 5FHTA 1UJDA 1NF3C 2JILA 3DJAA 3I18A 1UJVA 2VRFA 5G1DA 1X5QA 2EDVA 4NMQA 3PDVA 4NXRA 2R3YA 2REYA 4RI0A 3K1RA 2MHOA 2DB5A 2RCZA 1OBYA 1V5LA 2M0UA 3OU0A 4NMSA 2KL1A 5F3XA 3QJNA 2JXOA 3QJMA 3KZDA 5HFEA 1IHJA 1QAVA 4K78A 4PQWA 4JL7A 4EDJA 1WFVA 2JWEA 1MFLA 3WKMA 1QAUA 2G5MB 3CC0A 4WYUA 4JOPA 3L4FD 2KQFA 1Q3PA 1UEWA 2V1WA 3AXAA 4NXPA 2DKRA 1UHPA 5DTHA 2YUYA 4OEOA 2Q3GA 2VZ5A 1X5NA 1Z86A 2I04A 4Z33A 4NMVA 5G1EA 4Q2OA 2W4FA 1VA8A 2EGNA 3CS0A 2UZCA 3NFKA 2KRGA 2YT8A 2HE4A 2MX6A 1Q7XA 3KZEA 4LMMA 4NMPA 5HEBA 2DC2A 2ZPLA 2QKUA
chains in the Genus database with same CATH superfamily
4WYTA 2JREA 1MFGA 4JOFA 2K1ZA 1N7TA 1XZ9A 4Z8JA 4K6YA 3QGLA 1OBXA 5E11A 2EGKA 1UITA 1ZUBA 2AWXA 5I7ZA 2KPKA 4Q6SA 1BE9A 2EDZA 2IWQA 5HFCA 5HFDA 5GLJA 1N7EA 2V90A 3CBYA 4REYA 1X8SA 4HOPB 4K75A 3O46A 4NNMA 2YTWA 2EV8A 3O5NA 1I92A 2KOMA 2E7KA 2K20A 4FLNA 3RL8A 5E22A 3DORA 2EDPA 3KDGA 4JORA 2LC6A 5EYZA 2Z9IA 2DM8A 2QKVA 4Q2NA 2W7RA 3JXTA 3PV4A 3HVQC 3GDUA 4IC6A 5HF4A 5FB8C 2I1NA 1UFXA 1BFEA 1U3BA 3BPUA 1OBZA 1X5RA 3NFLA 4AMHA 5F67A 5E6PB 2DAZA 1WJLA 2DLUA 1VAEA 2PZDA 4JJ3A 4YYXA 2IWPA 1Q3OA 3FY5A 2PKUA 2KBSA 1K32A 1VB7A 5HETA 3QO6A 1KY9A 4GVCA 1ZOKA 1N6FA 2EJYA 3NGHA 1FCFA 2VSPA 3GDSA 2CS5A 1WFGA 4KFWA 3PDZA 2FCFA 2QT5A 2OS6A 2ZPMA 3SOEA 2PNTA 2RRMA 3SFJA 4HOPA 1X6DA 1RGWA 3CBZA 3CH8A 5HEDA 4OAJA 2EEHA 2KPLA 1I16A 1V5QA 2YUBA 1T2MA 1UEQA 3LNYA 1R6JA 3KDKA 3RL7A 2IWOA 2D90A 3B76A 3PV5A 3ID4A 1RZXA 3R69A 3ZRTA 2QBWA 1N7FA 4Q6HA 2M10A 2L4SA 1W9EA 2HGAA 2D92A 2LA8A 2KV8A 3GABA 1NTEA 1VCWA 2KJKA 4FGMA 1U37A 2KYLA 1YBOA 1WHDA 4H11A 2IWNA 1KEFA 1SOZA 2CSJA 5JXBA 3TMHA 3CBXA 4JOGA 2HE2A 4NMOA 1W9QA 1WF8A 2I4SA 4OEPA 2F0AA 3E17A 1VJ6A 2PDZA 1V6BA 4Q3HA 1TE0A 2L97A 2OQSA 2VWRA 3TSVA 5A2PA 1TP3A 2DJTA 1FC9A 3HPMA 4JJ0A 1N6DA 1WG6A 5HF1A 3DIWA 1UJUA 2JSNA 2L4TA 3K50A 2I0IA 3PS4A 1N99A 1PDRA 2F5YA 5HEYA 3LNXA 4E34A 1U38A 4JOKA 2BYGA 4JOHA 4MPAA 2AWWA 2JIKA 1TP5A 1WH1A 2ENOA 2Z17A 1QAVB 5ILBA 1P1DA 2KG2A 3QE1A 5D13A 1WI4A 1WF7A 1Y7NA 2OPGA 2JINA 5B42A 1P1EA 4NMRA 2OMJA 1SOTA 2GZVA 2AWUA 2QG1A 4GVDA 2KA9A 1N6EA 2KAWA 3ID3A 2AINA 2FN5A 2M3MA 3PV2A 2EEIA 1G9OA 4F8KA 4G69A 2FE5A 3TSZA 3GCNA 2D8IA 3QIKA 1OZIA 2CSSA 1W9OA 2EEJA 2OCSA 3EGHC 3MH4A 3GJ9A 2LOBA 2EEGA 3R0HA 4R2ZA 4XHVA 4YDPA 2VPHA 2LC7A 3VQFA 4P0CA 4O06A 2KJDA 3I4WA 2OGPA 2QKTA 1UM7A 2DMZA 1V62A 5E21A 5HDYA 2OSGA 3CYYA 1WIFA 3MH6A 2KJPA 4P2AB 1IU0A 2H3LA 2KOHA 1RY4A 2O2TA 3SUZA 4UU5A 2JOAA 3GGEA 4UU6A 3DJ1A 1QLCA 1LCYA 2H2BA 1FC6A 3MH7A 1WHAA 3ID2A 1Y8TA 4NNLA 2M0TA 1GM1A 2X7ZA 1RGRA 2EHRA 4L8NA 4K76A 1IU2A 4JOEA 1UM1A 4N6XA 5H3JA 3I1EA 3EGGC 1GQ5A 3GDVA 2OZFA 5B6LA 5IL9A 1M5ZA 3OTPA 1B8QA 2WL7A 3K82A 4Q2QA 1U39A 4NXQA 2P3WA 2Q9VA 3STJA 3GSLA 3TSWA 2PA1A 2H2CA 3GCOA 1MC7A 1KWAA 1X9ZA 2PKTA 2I6VA 1UEZA 1UEPA 4E35A 5EZ0A 4Q2PA 4NMTA 2M0VA 3RLEA 3WKLA 4KFVA 3VQGA 1X45A 5HFBA 3KHFA 3SHWA 1D5GA 1FC7A 3SHUA 4K72A 5E1YA 2I0LA 2GEFA 1UF1A 2KOJA 4GHNA 5GNDA 2FNEA 5HJ1A 5HFFA 3ID1A 3DJ3A 1V1TA 1WI2A 2EXGA 4JOJA 1GQ4A 2G2LA 2H3MA 3QDOA 1TQ3A 3R68A 2R4HA 3HPKA 2EAQA 1L6OA 2M0ZA 2LUIA 1Z87A 2YT7A 4E3BA 2EGOA 2DLSA 2VSVA 5FHTA 1UJDA 1NF3C 2JILA 3DJAA 3I18A 1UJVA 2VRFA 5G1DA 1X5QA 2EDVA 4NMQA 3PDVA 4NXRA 2R3YA 2REYA 3NCVA 4RI0A 3K1RA 2MHOA 2DB5A 2RCZA 1OBYA 1V5LA 2M0UA 3OU0A 4NMSA 2KL1A 5F3XA 3QJNA 2JXOA 3QJMA 3KZDA 5HFEA 1IHJA 1QAVA 4K78A 4PQWA 4JL7A 4EDJA 1WFVA 2JWEA 1MFLA 3WKMA 1QAUA 2G5MB 3CC0A 4WYUA 4JOPA 3L4FD 2KQFA 1Q3PA 1UEWA 2V1WA 3AXAA 4NXPA 2DKRA 1UHPA 5DTHA 2YUYA 4OEOA 2Q3GA 2VZ5A 1X5NA 1Z86A 2I04A 4Z33A 4NMVA 5G1EA 4Q2OA 2W4FA 1VA8A 2EGNA 3CS0A 2UZCA 3NFKA 2KRGA 2YT8A 2HE4A 2MX6A 1Q7XA 3KZEA 4LMMA 4NMPA 5HEBA 2DC2A 2ZPLA 2QKUA
chains in the Genus database with same CATH topology
4WYTA 2JREA 1MFGA 4JOFA 2K1ZA 1N7TA 1XZ9A 4Z8JA 4K6YA 3QGLA 1OBXA 5E11A 2EGKA 1UITA 1ZUBA 2AWXA 5I7ZA 2KPKA 4Q6SA 1BE9A 2EDZA 2IWQA 5HFCA 5HFDA 5GLJA 1N7EA 2V90A 3CBYA 4REYA 1X8SA 4HOPB 4K75A 3O46A 4NNMA 2YTWA 2EV8A 3O5NA 1I92A 2KOMA 2E7KA 2K20A 4FLNA 3RL8A 5E22A 3DORA 2EDPA 3KDGA 4JORA 2LC6A 5EYZA 2Z9IA 2DM8A 2QKVA 4Q2NA 2W7RA 3JXTA 3PV4A 3HVQC 3GDUA 4IC6A 5HF4A 5FB8C 2I1NA 1UFXA 1BFEA 1U3BA 3BPUA 1OBZA 1X5RA 3NFLA 4AMHA 5F67A 5E6PB 2DAZA 1WJLA 2DLUA 1VAEA 2PZDA 4JJ3A 4YYXA 2IWPA 1Q3OA 3FY5A 2PKUA 2KBSA 1K32A 1VB7A 5HETA 3QO6A 1KY9A 4GVCA 1ZOKA 1N6FA 2EJYA 3NGHA 1FCFA 2VSPA 3GDSA 2CS5A 1WFGA 4KFWA 3PDZA 2FCFA 2QT5A 2OS6A 2ZPMA 3SOEA 2PNTA 2RRMA 3SFJA 4HOPA 1X6DA 1RGWA 3CBZA 3CH8A 5HEDA 4OAJA 2EEHA 2KPLA 1I16A 1V5QA 2YUBA 1T2MA 1UEQA 3LNYA 1R6JA 3KDKA 3RL7A 2IWOA 2D90A 3B76A 3PV5A 3ID4A 1RZXA 3R69A 3ZRTA 2QBWA 1N7FA 4Q6HA 2M10A 2L4SA 1W9EA 2HGAA 2D92A 2LA8A 2KV8A 3GABA 1NTEA 1VCWA 2KJKA 4FGMA 1U37A 2KYLA 1YBOA 1WHDA 4H11A 2IWNA 1KEFA 1SOZA 2CSJA 5JXBA 3TMHA 3CBXA 4JOGA 2HE2A 4NMOA 1W9QA 1WF8A 2I4SA 4OEPA 2F0AA 3E17A 1VJ6A 2PDZA 1V6BA 4Q3HA 1TE0A 2L97A 2OQSA 2VWRA 3TSVA 5A2PA 1TP3A 2DJTA 1FC9A 3HPMA 4JJ0A 1N6DA 1WG6A 5HF1A 3DIWA 1UJUA 2JSNA 2L4TA 3K50A 2I0IA 3PS4A 1N99A 1PDRA 2F5YA 5HEYA 3LNXA 4E34A 1U38A 4JOKA 2BYGA 4JOHA 4MPAA 2AWWA 2JIKA 1TP5A 1WH1A 2ENOA 2Z17A 1QAVB 5ILBA 1P1DA 2KG2A 3QE1A 5D13A 1WI4A 1WF7A 1Y7NA 2OPGA 2JINA 5B42A 1P1EA 4NMRA 2OMJA 1SOTA 2GZVA 2AWUA 2QG1A 4GVDA 2KA9A 1N6EA 2KAWA 3ID3A 2AINA 2FN5A 2M3MA 3PV2A 2EEIA 1G9OA 4F8KA 4G69A 2FE5A 3TSZA 3GCNA 2D8IA 3QIKA 1OZIA 2CSSA 1W9OA 2EEJA 2OCSA 3EGHC 3MH4A 3GJ9A 2LOBA 2EEGA 3R0HA 4R2ZA 4XHVA 4YDPA 2VPHA 2LC7A 3VQFA 4P0CA 4O06A 2KJDA 3I4WA 2OGPA 2QKTA 1UM7A 2DMZA 1V62A 5E21A 5HDYA 2OSGA 3CYYA 1WIFA 3MH6A 2KJPA 4P2AB 1IU0A 2H3LA 2KOHA 1RY4A 2O2TA 3SUZA 4UU5A 2JOAA 3GGEA 4UU6A 3DJ1A 1QLCA 1LCYA 2H2BA 1FC6A 3MH7A 1WHAA 3ID2A 1Y8TA 4NNLA 2M0TA 1GM1A 2X7ZA 1RGRA 2EHRA 4L8NA 4K76A 1IU2A 4JOEA 1UM1A 4N6XA 5H3JA 3I1EA 3EGGC 1GQ5A 3GDVA 2OZFA 5B6LA 5IL9A 1M5ZA 3OTPA 1B8QA 2WL7A 3K82A 4Q2QA 1U39A 4NXQA 2P3WA 2Q9VA 3STJA 3GSLA 3TSWA 2PA1A 2H2CA 3GCOA 1MC7A 1KWAA 1X9ZA 2PKTA 2I6VA 1UEZA 1UEPA 4E35A 5EZ0A 4Q2PA 4NMTA 2M0VA 3RLEA 3WKLA 4KFVA 3VQGA 1X45A 5HFBA 3KHFA 3SHWA 1D5GA 1FC7A 3SHUA 4K72A 5E1YA 2I0LA 2GEFA 1UF1A 2KOJA 4GHNA 5GNDA 2FNEA 5HJ1A 5HFFA 3ID1A 3DJ3A 1V1TA 1WI2A 2EXGA 4JOJA 1GQ4A 2G2LA 2H3MA 3QDOA 1TQ3A 3R68A 2R4HA 3HPKA 2EAQA 1L6OA 2M0ZA 2LUIA 1Z87A 2YT7A 4E3BA 2EGOA 2DLSA 2VSVA 5FHTA 1UJDA 1NF3C 2JILA 3DJAA 3I18A 1UJVA 2VRFA 5G1DA 1X5QA 2EDVA 4NMQA 3PDVA 4NXRA 2R3YA 2REYA 3NCVA 4RI0A 3K1RA 2MHOA 2DB5A 2RCZA 1OBYA 1V5LA 2M0UA 3OU0A 4NMSA 2KL1A 5F3XA 3QJNA 2JXOA 3QJMA 3KZDA 5HFEA 1IHJA 1QAVA 4K78A 4PQWA 4JL7A 4EDJA 1WFVA 2JWEA 1MFLA 3WKMA 1QAUA 2G5MB 3CC0A 4WYUA 4JOPA 3L4FD 2KQFA 1Q3PA 1UEWA 2V1WA 3AXAA 4NXPA 2DKRA 1UHPA 5DTHA 2YUYA 4OEOA 2Q3GA 2VZ5A 1X5NA 1Z86A 2I04A 4Z33A 4NMVA 5G1EA 4Q2OA 2W4FA 1VA8A 2EGNA 3CS0A 2UZCA 3NFKA 2KRGA 2YT8A 2HE4A 2MX6A 1Q7XA 3KZEA 4LMMA 4NMPA 5HEBA 2DC2A 2ZPLA 2QKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYT A;  2JRE A;  1MFG A;  4JOF A;  2K1Z A;  1N7T A;  1XZ9 A;  4Z8J A;  4K6Y A;  3QGL A;  1OBX A;  5E11 A;  2EGK A;  1UIT A;  1ZUB A;  2AWX A;  5I7Z A;  2KPK A;  4Q6S A;  1BE9 A;  2EDZ A;  2IWQ A;  5HFC A;  5HFD A;  5GLJ A;  1N7E A;  2V90 A;  3CBY A;  4REY A;  1X8S A;  4HOP B;  4K75 A;  3O46 A;  4NNM A;  2YTW A;  2EV8 A;  3O5N A;  1I92 A;  2KOM A;  2E7K A;  2K20 A;  3RL8 A;  5E22 A;  3DOR A;  2EDP A;  4JOR A;  2LC6 A;  5EYZ A;  2Z9I A;  2DM8 A;  2QKV A;  4Q2N A;  2W7R A;  3JXT A;  3PV4 A;  3HVQ C;  3GDU A;  4IC6 A;  5HF4 A;  5FB8 C;  2I1N A;  1UFX A;  1BFE A;  1U3B A;  3BPU A;  1OBZ A;  1X5R A;  3NFL A;  4AMH A;  5F67 A;  5E6P B;  2DAZ A;  1WJL A;  2DLU A;  1VAE A;  2PZD A;  4YYX A;  2IWP A;  1Q3O A;  3FY5 A;  2PKU A;  2KBS A;  1K32 A;  1VB7 A;  5HET A;  3QO6 A;  1KY9 A;  4GVC A;  1ZOK A;  1N6F A;  2EJY A;  3NGH A;  1FCF A;  2VSP A;  3GDS A;  2CS5 A;  1WFG A;  4KFW A;  3PDZ A;  2FCF A;  2QT5 A;  2OS6 A;  2ZPM A;  3SOE A;  2PNT A;  2RRM A;  3SFJ A;  4HOP A;  1X6D A;  1RGW A;  3CBZ A;  3CH8 A;  5HED A;  4OAJ A;  2EEH A;  2KPL A;  1I16 A;  1V5Q A;  2YUB A;  1T2M A;  1UEQ A;  3LNY A;  1R6J A;  3RL7 A;  2IWO A;  2D90 A;  3B76 A;  3PV5 A;  3ID4 A;  1RZX A;  3R69 A;  3ZRT A;  2QBW A;  1N7F A;  4Q6H A;  2M10 A;  2L4S A;  1W9E A;  2HGA A;  2D92 A;  2LA8 A;  2KV8 A;  1NTE A;  1VCW A;  2KJK A;  4FGM A;  1U37 A;  2KYL A;  1YBO A;  1WHD A;  4H11 A;  2IWN A;  1KEF A;  1SOZ A;  2CSJ A;  5JXB A;  3TMH A;  3CBX A;  4JOG A;  2HE2 A;  4NMO A;  1W9Q A;  1WF8 A;  2I4S A;  4OEP A;  2F0A A;  3E17 A;  1VJ6 A;  2PDZ A;  1V6B A;  4Q3H A;  1TE0 A;  2L97 A;  2OQS A;  2VWR A;  3TSV A;  5A2P A;  1TP3 A;  2DJT A;  1FC9 A;  3HPM A;  1N6D A;  1WG6 A;  5HF1 A;  3DIW A;  1UJU A;  2L4T A;  3K50 A;  3PS4 A;  2I0I A;  1N99 A;  1PDR A;  2F5Y A;  5HEY A;  3LNX A;  4E34 A;  1U38 A;  4JOK A;  2BYG A;  4JOH A;  4MPA A;  2AWW A;  2JIK A;  1TP5 A;  1WH1 A;  2ENO A;  2Z17 A;  1QAV B;  1P1D A;  2KG2 A;  3QE1 A;  5D13 A;  1WI4 A;  1WF7 A;  1Y7N A;  2OPG A;  2JIN A;  1P1E A;  4NMR A;  2OMJ A;  1SOT A;  2GZV A;  2AWU A;  2QG1 A;  4GVD A;  2KA9 A;  1N6E A;  2KAW A;  3ID3 A;  2AIN A;  2FN5 A;  2M3M A;  3PV2 A;  2EEI A;  1G9O A;  4F8K A;  4G69 A;  2FE5 A;  3TSZ A;  3GCN A;  2D8I A;  3QIK A;  1OZI A;  2CSS A;  1W9O A;  2EEJ A;  2OCS A;  3EGH C;  3MH4 A;  3GJ9 A;  2LOB A;  2EEG A;  3R0H A;  4R2Z A;  4XHV A;  4YDP A;  2VPH A;  2LC7 A;  3VQF A;  4P0C A;  4O06 A;  2KJD A;  3I4W A;  2OGP A;  2QKT A;  1UM7 A;  2DMZ A;  1V62 A;  5E21 A;  5HDY A;  2OSG A;  3CYY A;  1WIF A;  3MH6 A;  2KJP A;  4P2A B;  1IU0 A;  2H3L A;  2KOH A;  1RY4 A;  2O2T A;  3SUZ A;  4UU5 A;  2JOA A;  3GGE A;  4UU6 A;  3DJ1 A;  1QLC A;  1LCY A;  2H2B A;  1FC6 A;  3MH7 A;  1WHA A;  3ID2 A;  1Y8T A;  4NNL A;  2M0T A;  1GM1 A;  2X7Z A;  1RGR A;  2EHR A;  4L8N A;  4K76 A;  1IU2 A;  4JOE A;  1UM1 A;  4N6X A;  5H3J A;  3I1E A;  3EGG C;  1GQ5 A;  3GDV A;  2OZF A;  5B6L A;  1M5Z A;  3OTP A;  1B8Q A;  2WL7 A;  3K82 A;  4Q2Q A;  1U39 A;  4NXQ A;  2P3W A;  2Q9V A;  3STJ A;  3GSL A;  3TSW A;  2PA1 A;  2H2C A;  3GCO A;  1MC7 A;  1KWA A;  2PKT A;  2I6V A;  1UEZ A;  1UEP A;  4E35 A;  5EZ0 A;  4Q2P A;  4NMT A;  2M0V A;  3RLE A;  3WKL A;  4KFV A;  3VQG A;  1X45 A;  5HFB A;  3KHF A;  3SHW A;  1D5G A;  1FC7 A;  3SHU A;  4K72 A;  5E1Y A;  2I0L A;  1UF1 A;  2KOJ A;  4GHN A;  5GND A;  2FNE A;  5HJ1 A;  5HFF A;  3ID1 A;  3DJ3 A;  1V1T A;  1WI2 A;  2EXG A;  4JOJ A;  1GQ4 A;  2G2L A;  2H3M A;  3QDO A;  1TQ3 A;  3R68 A;  2R4H A;  3HPK A;  2EAQ A;  1L6O A;  2M0Z A;  2LUI A;  1Z87 A;  2YT7 A;  4E3B A;  2EGO A;  2DLS A;  2VSV A;  5FHT A;  1UJD A;  1NF3 C;  2JIL A;  3DJA A;  3I18 A;  1UJV A;  2VRF A;  5G1D A;  1X5Q A;  2EDV A;  4NMQ A;  3PDV A;  4NXR A;  2R3Y A;  2REY A;  4RI0 A;  3K1R A;  2MHO A;  2DB5 A;  2RCZ A;  1OBY A;  1V5L A;  2M0U A;  3OU0 A;  4NMS A;  2KL1 A;  5F3X A;  3QJN A;  2JXO A;  3QJM A;  3KZD A;  5HFE A;  1IHJ A;  1QAV A;  4K78 A;  4PQW A;  4JL7 A;  4EDJ A;  1WFV A;  2JWE A;  1MFL A;  3WKM A;  1QAU A;  2G5M B;  3CC0 A;  4WYU A;  4JOP A;  3L4F D;  2KQF A;  1Q3P A;  1UEW A;  2V1W A;  3AXA A;  4NXP A;  2DKR A;  1UHP A;  5DTH A;  2YUY A;  4OEO A;  2Q3G A;  2VZ5 A;  1X5N A;  1Z86 A;  2I04 A;  4Z33 A;  4NMV A;  5G1E A;  4Q2O A;  2W4F A;  1VA8 A;  2EGN A;  3CS0 A;  2UZC A;  3NFK A;  2KRG A;  2YT8 A;  2HE4 A;  2MX6 A;  1Q7X A;  3KZE A;  4LMM A;  4NMP A;  5HEB A;  2DC2 A;  2ZPL A;  2QKU A; 
#chains in the Genus database with same CATH topology
 4WYT A;  2JRE A;  1MFG A;  4JOF A;  2K1Z A;  1N7T A;  1XZ9 A;  4Z8J A;  4K6Y A;  3QGL A;  1OBX A;  5E11 A;  2EGK A;  1UIT A;  1ZUB A;  2AWX A;  5I7Z A;  2KPK A;  4Q6S A;  1BE9 A;  2EDZ A;  2IWQ A;  5HFC A;  5HFD A;  5GLJ A;  1N7E A;  2V90 A;  3CBY A;  4REY A;  1X8S A;  4HOP B;  4K75 A;  3O46 A;  4NNM A;  2YTW A;  2EV8 A;  3O5N A;  1I92 A;  2KOM A;  2E7K A;  2K20 A;  4FLN A;  3RL8 A;  5E22 A;  3DOR A;  2EDP A;  3KDG A;  4JOR A;  2LC6 A;  5EYZ A;  2Z9I A;  2DM8 A;  2QKV A;  4Q2N A;  2W7R A;  3JXT A;  3PV4 A;  3HVQ C;  3GDU A;  4IC6 A;  5HF4 A;  5FB8 C;  2I1N A;  1UFX A;  1BFE A;  1U3B A;  3BPU A;  1OBZ A;  1X5R A;  3NFL A;  4AMH A;  5F67 A;  5E6P B;  2DAZ A;  1WJL A;  2DLU A;  1VAE A;  2PZD A;  4JJ3 A;  4YYX A;  2IWP A;  1Q3O A;  3FY5 A;  2PKU A;  2KBS A;  1K32 A;  1VB7 A;  5HET A;  3QO6 A;  1KY9 A;  4GVC A;  1ZOK A;  1N6F A;  2EJY A;  3NGH A;  1FCF A;  2VSP A;  3GDS A;  2CS5 A;  1WFG A;  4KFW A;  3PDZ A;  2FCF A;  2QT5 A;  2OS6 A;  2ZPM A;  3SOE A;  2PNT A;  2RRM A;  3SFJ A;  4HOP A;  1X6D A;  1RGW A;  3CBZ A;  3CH8 A;  5HED A;  4OAJ A;  2EEH A;  2KPL A;  1I16 A;  1V5Q A;  2YUB A;  1T2M A;  1UEQ A;  3LNY A;  1R6J A;  3KDK A;  3RL7 A;  2IWO A;  2D90 A;  3B76 A;  3PV5 A;  3ID4 A;  1RZX A;  3R69 A;  3ZRT A;  2QBW A;  1N7F A;  4Q6H A;  2M10 A;  2L4S A;  1W9E A;  2HGA A;  2D92 A;  2LA8 A;  2KV8 A;  3GAB A;  1NTE A;  1VCW A;  2KJK A;  4FGM A;  1U37 A;  2KYL A;  1YBO A;  1WHD A;  4H11 A;  2IWN A;  1KEF A;  1SOZ A;  2CSJ A;  5JXB A;  3TMH A;  3CBX A;  4JOG A;  2HE2 A;  4NMO A;  1W9Q A;  1WF8 A;  2I4S A;  4OEP A;  2F0A A;  3E17 A;  1VJ6 A;  2PDZ A;  1V6B A;  4Q3H A;  1TE0 A;  2L97 A;  2OQS A;  2VWR A;  3TSV A;  5A2P A;  1TP3 A;  2DJT A;  1FC9 A;  3HPM A;  4JJ0 A;  1N6D A;  1WG6 A;  5HF1 A;  3DIW A;  1UJU A;  2JSN A;  2L4T A;  3K50 A;  2I0I A;  3PS4 A;  1N99 A;  1PDR A;  2F5Y A;  5HEY A;  3LNX A;  4E34 A;  1U38 A;  4JOK A;  2BYG A;  4JOH A;  4MPA A;  2AWW A;  2JIK A;  1TP5 A;  1WH1 A;  2ENO A;  2Z17 A;  1QAV B;  5ILB A;  1P1D A;  2KG2 A;  3QE1 A;  5D13 A;  1WI4 A;  1WF7 A;  1Y7N A;  2OPG A;  2JIN A;  5B42 A;  1P1E A;  4NMR A;  2OMJ A;  1SOT A;  2GZV A;  2AWU A;  2QG1 A;  4GVD A;  2KA9 A;  1N6E A;  2KAW A;  3ID3 A;  2AIN A;  2FN5 A;  2M3M A;  3PV2 A;  2EEI A;  1G9O A;  4F8K A;  4G69 A;  2FE5 A;  3TSZ A;  3GCN A;  2D8I A;  3QIK A;  1OZI A;  2CSS A;  1W9O A;  2EEJ A;  2OCS A;  3EGH C;  3MH4 A;  3GJ9 A;  2LOB A;  2EEG A;  3R0H A;  4R2Z A;  4XHV A;  4YDP A;  2VPH A;  2LC7 A;  3VQF A;  4P0C A;  4O06 A;  2KJD A;  3I4W A;  2OGP A;  2QKT A;  1UM7 A;  2DMZ A;  1V62 A;  5E21 A;  5HDY A;  2OSG A;  3CYY A;  1WIF A;  3MH6 A;  2KJP A;  4P2A B;  1IU0 A;  2H3L A;  2KOH A;  1RY4 A;  2O2T A;  3SUZ A;  4UU5 A;  2JOA A;  3GGE A;  4UU6 A;  3DJ1 A;  1QLC A;  1LCY A;  2H2B A;  1FC6 A;  3MH7 A;  1WHA A;  3ID2 A;  1Y8T A;  4NNL A;  2M0T A;  1GM1 A;  2X7Z A;  1RGR A;  2EHR A;  4L8N A;  4K76 A;  1IU2 A;  4JOE A;  1UM1 A;  4N6X A;  5H3J A;  3I1E A;  3EGG C;  1GQ5 A;  3GDV A;  2OZF A;  5B6L A;  5IL9 A;  1M5Z A;  3OTP A;  1B8Q A;  2WL7 A;  3K82 A;  4Q2Q A;  1U39 A;  4NXQ A;  2P3W A;  2Q9V A;  3STJ A;  3GSL A;  3TSW A;  2PA1 A;  2H2C A;  3GCO A;  1MC7 A;  1KWA A;  1X9Z A;  2PKT A;  2I6V A;  1UEZ A;  1UEP A;  4E35 A;  5EZ0 A;  4Q2P A;  4NMT A;  2M0V A;  3RLE A;  3WKL A;  4KFV A;  3VQG A;  1X45 A;  5HFB A;  3KHF A;  3SHW A;  1D5G A;  1FC7 A;  3SHU A;  4K72 A;  5E1Y A;  2I0L A;  2GEF A;  1UF1 A;  2KOJ A;  4GHN A;  5GND A;  2FNE A;  5HJ1 A;  5HFF A;  3ID1 A;  3DJ3 A;  1V1T A;  1WI2 A;  2EXG A;  4JOJ A;  1GQ4 A;  2G2L A;  2H3M A;  3QDO A;  1TQ3 A;  3R68 A;  2R4H A;  3HPK A;  2EAQ A;  1L6O A;  2M0Z A;  2LUI A;  1Z87 A;  2YT7 A;  4E3B A;  2EGO A;  2DLS A;  2VSV A;  5FHT A;  1UJD A;  1NF3 C;  2JIL A;  3DJA A;  3I18 A;  1UJV A;  2VRF A;  5G1D A;  1X5Q A;  2EDV A;  4NMQ A;  3PDV A;  4NXR A;  2R3Y A;  2REY A;  3NCV A;  4RI0 A;  3K1R A;  2MHO A;  2DB5 A;  2RCZ A;  1OBY A;  1V5L A;  2M0U A;  3OU0 A;  4NMS A;  2KL1 A;  5F3X A;  3QJN A;  2JXO A;  3QJM A;  3KZD A;  5HFE A;  1IHJ A;  1QAV A;  4K78 A;  4PQW A;  4JL7 A;  4EDJ A;  1WFV A;  2JWE A;  1MFL A;  3WKM A;  1QAU A;  2G5M B;  3CC0 A;  4WYU A;  4JOP A;  3L4F D;  2KQF A;  1Q3P A;  1UEW A;  2V1W A;  3AXA A;  4NXP A;  2DKR A;  1UHP A;  5DTH A;  2YUY A;  4OEO A;  2Q3G A;  2VZ5 A;  1X5N A;  1Z86 A;  2I04 A;  4Z33 A;  4NMV A;  5G1E A;  4Q2O A;  2W4F A;  1VA8 A;  2EGN A;  3CS0 A;  2UZC A;  3NFK A;  2KRG A;  2YT8 A;  2HE4 A;  2MX6 A;  1Q7X A;  3KZE A;  4LMM A;  4NMP A;  5HEB A;  2DC2 A;  2ZPL A;  2QKU A; 
#chains in the Genus database with same CATH homology
 4WYT A;  2JRE A;  1MFG A;  4JOF A;  2K1Z A;  1N7T A;  1XZ9 A;  4Z8J A;  4K6Y A;  3QGL A;  1OBX A;  5E11 A;  2EGK A;  1UIT A;  1ZUB A;  2AWX A;  5I7Z A;  2KPK A;  4Q6S A;  1BE9 A;  2EDZ A;  2IWQ A;  5HFC A;  5HFD A;  5GLJ A;  1N7E A;  2V90 A;  3CBY A;  4REY A;  1X8S A;  4HOP B;  4K75 A;  3O46 A;  4NNM A;  2YTW A;  2EV8 A;  3O5N A;  1I92 A;  2KOM A;  2E7K A;  2K20 A;  4FLN A;  3RL8 A;  5E22 A;  3DOR A;  2EDP A;  3KDG A;  4JOR A;  2LC6 A;  5EYZ A;  2Z9I A;  2DM8 A;  2QKV A;  4Q2N A;  2W7R A;  3JXT A;  3PV4 A;  3HVQ C;  3GDU A;  4IC6 A;  5HF4 A;  5FB8 C;  2I1N A;  1UFX A;  1BFE A;  1U3B A;  3BPU A;  1OBZ A;  1X5R A;  3NFL A;  4AMH A;  5F67 A;  5E6P B;  2DAZ A;  1WJL A;  2DLU A;  1VAE A;  2PZD A;  4JJ3 A;  4YYX A;  2IWP A;  1Q3O A;  3FY5 A;  2PKU A;  2KBS A;  1K32 A;  1VB7 A;  5HET A;  3QO6 A;  1KY9 A;  4GVC A;  1ZOK A;  1N6F A;  2EJY A;  3NGH A;  1FCF A;  2VSP A;  3GDS A;  2CS5 A;  1WFG A;  4KFW A;  3PDZ A;  2FCF A;  2QT5 A;  2OS6 A;  2ZPM A;  3SOE A;  2PNT A;  2RRM A;  3SFJ A;  4HOP A;  1X6D A;  1RGW A;  3CBZ A;  3CH8 A;  5HED A;  4OAJ A;  2EEH A;  2KPL A;  1I16 A;  1V5Q A;  2YUB A;  1T2M A;  1UEQ A;  3LNY A;  1R6J A;  3KDK A;  3RL7 A;  2IWO A;  2D90 A;  3B76 A;  3PV5 A;  3ID4 A;  1RZX A;  3R69 A;  3ZRT A;  2QBW A;  1N7F A;  4Q6H A;  2M10 A;  2L4S A;  1W9E A;  2HGA A;  2D92 A;  2LA8 A;  2KV8 A;  3GAB A;  1NTE A;  1VCW A;  2KJK A;  4FGM A;  1U37 A;  2KYL A;  1YBO A;  1WHD A;  4H11 A;  2IWN A;  1KEF A;  1SOZ A;  2CSJ A;  5JXB A;  3TMH A;  3CBX A;  4JOG A;  2HE2 A;  4NMO A;  1W9Q A;  1WF8 A;  2I4S A;  4OEP A;  2F0A A;  3E17 A;  1VJ6 A;  2PDZ A;  1V6B A;  4Q3H A;  1TE0 A;  2L97 A;  2OQS A;  2VWR A;  3TSV A;  5A2P A;  1TP3 A;  2DJT A;  1FC9 A;  3HPM A;  4JJ0 A;  1N6D A;  1WG6 A;  5HF1 A;  3DIW A;  1UJU A;  2JSN A;  2L4T A;  3K50 A;  2I0I A;  3PS4 A;  1N99 A;  1PDR A;  2F5Y A;  5HEY A;  3LNX A;  4E34 A;  1U38 A;  4JOK A;  2BYG A;  4JOH A;  4MPA A;  2AWW A;  2JIK A;  1TP5 A;  1WH1 A;  2ENO A;  2Z17 A;  1QAV B;  5ILB A;  1P1D A;  2KG2 A;  3QE1 A;  5D13 A;  1WI4 A;  1WF7 A;  1Y7N A;  2OPG A;  2JIN A;  5B42 A;  1P1E A;  4NMR A;  2OMJ A;  1SOT A;  2GZV A;  2AWU A;  2QG1 A;  4GVD A;  2KA9 A;  1N6E A;  2KAW A;  3ID3 A;  2AIN A;  2FN5 A;  2M3M A;  3PV2 A;  2EEI A;  1G9O A;  4F8K A;  4G69 A;  2FE5 A;  3TSZ A;  3GCN A;  2D8I A;  3QIK A;  1OZI A;  2CSS A;  1W9O A;  2EEJ A;  2OCS A;  3EGH C;  3MH4 A;  3GJ9 A;  2LOB A;  2EEG A;  3R0H A;  4R2Z A;  4XHV A;  4YDP A;  2VPH A;  2LC7 A;  3VQF A;  4P0C A;  4O06 A;  2KJD A;  3I4W A;  2OGP A;  2QKT A;  1UM7 A;  2DMZ A;  1V62 A;  5E21 A;  5HDY A;  2OSG A;  3CYY A;  1WIF A;  3MH6 A;  2KJP A;  4P2A B;  1IU0 A;  2H3L A;  2KOH A;  1RY4 A;  2O2T A;  3SUZ A;  4UU5 A;  2JOA A;  3GGE A;  4UU6 A;  3DJ1 A;  1QLC A;  1LCY A;  2H2B A;  1FC6 A;  3MH7 A;  1WHA A;  3ID2 A;  1Y8T A;  4NNL A;  2M0T A;  1GM1 A;  2X7Z A;  1RGR A;  2EHR A;  4L8N A;  4K76 A;  1IU2 A;  4JOE A;  1UM1 A;  4N6X A;  5H3J A;  3I1E A;  3EGG C;  1GQ5 A;  3GDV A;  2OZF A;  5B6L A;  5IL9 A;  1M5Z A;  3OTP A;  1B8Q A;  2WL7 A;  3K82 A;  4Q2Q A;  1U39 A;  4NXQ A;  2P3W A;  2Q9V A;  3STJ A;  3GSL A;  3TSW A;  2PA1 A;  2H2C A;  3GCO A;  1MC7 A;  1KWA A;  1X9Z A;  2PKT A;  2I6V A;  1UEZ A;  1UEP A;  4E35 A;  5EZ0 A;  4Q2P A;  4NMT A;  2M0V A;  3RLE A;  3WKL A;  4KFV A;  3VQG A;  1X45 A;  5HFB A;  3KHF A;  3SHW A;  1D5G A;  1FC7 A;  3SHU A;  4K72 A;  5E1Y A;  2I0L A;  2GEF A;  1UF1 A;  2KOJ A;  4GHN A;  5GND A;  2FNE A;  5HJ1 A;  5HFF A;  3ID1 A;  3DJ3 A;  1V1T A;  1WI2 A;  2EXG A;  4JOJ A;  1GQ4 A;  2G2L A;  2H3M A;  3QDO A;  1TQ3 A;  3R68 A;  2R4H A;  3HPK A;  2EAQ A;  1L6O A;  2M0Z A;  2LUI A;  1Z87 A;  2YT7 A;  4E3B A;  2EGO A;  2DLS A;  2VSV A;  5FHT A;  1UJD A;  1NF3 C;  2JIL A;  3DJA A;  3I18 A;  1UJV A;  2VRF A;  5G1D A;  1X5Q A;  2EDV A;  4NMQ A;  3PDV A;  4NXR A;  2R3Y A;  2REY A;  3NCV A;  4RI0 A;  3K1R A;  2MHO A;  2DB5 A;  2RCZ A;  1OBY A;  1V5L A;  2M0U A;  3OU0 A;  4NMS A;  2KL1 A;  5F3X A;  3QJN A;  2JXO A;  3QJM A;  3KZD A;  5HFE A;  1IHJ A;  1QAV A;  4K78 A;  4PQW A;  4JL7 A;  4EDJ A;  1WFV A;  2JWE A;  1MFL A;  3WKM A;  1QAU A;  2G5M B;  3CC0 A;  4WYU A;  4JOP A;  3L4F D;  2KQF A;  1Q3P A;  1UEW A;  2V1W A;  3AXA A;  4NXP A;  2DKR A;  1UHP A;  5DTH A;  2YUY A;  4OEO A;  2Q3G A;  2VZ5 A;  1X5N A;  1Z86 A;  2I04 A;  4Z33 A;  4NMV A;  5G1E A;  4Q2O A;  2W4F A;  1VA8 A;  2EGN A;  3CS0 A;  2UZC A;  3NFK A;  2KRG A;  2YT8 A;  2HE4 A;  2MX6 A;  1Q7X A;  3KZE A;  4LMM A;  4NMP A;  5HEB A;  2DC2 A;  2ZPL A;  2QKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...