1NTEA

Crystal structure analysis of the second pdz domain of syntenin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
GAMDPRTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Syntenin 1
publication title Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1nteA00
3PV2A 2H2CA 2VZ5A 3GDUA 1W9EA 5HFBA 3E17A 4NMRA 1LCYA 2AINA 4JOGA 4KFWA 2EAQA 3DORA 2K20A 1NTEA 2M0ZA 4NNLA 1X6DA 2H2BA 3MH4A 4Q3HA 2JWEA 1K32A 4Q2QA 1QAVB 3RL7A 3WKLA 1N6FA 4NXQA 1U37A 2F0AA 1N7TA 1TQ3A 2KJPA 2KL1A 2KG2A 2EEIA 1V6BA 2KOHA 5E22A 2PZDA 2KAWA 3SHWA 2I6VA 1IHJA 2VRFA 2KBSA 2M0TA 3GCNA 4L8NA 2CSJA 2I0IA 2QKTA 3I4WA 1ZOKA 1I16A 2JREA 1X5QA 3NFKA 2KRGA 4NXRA 5F3XA 5I7ZA 3MH7A 2G2LA 3L4FD 4NXPA 5EZ0A 2KOJA 3GDVA 2EGNA 2FE5A 2JIKA 2O2TA 2EEJA 1FC7A 2FN5A 2KQFA 1Q7XA 2EGKA 5FB8C 2M10A 1NF3C 2EDVA 3K1RA 2I4SA 2OZFA 4IC6A 3SHUA 2D92A 1U38A 2F5YA 2M0VA 4NMQA 2JILA 2VSPA 5D13A 2D8IA 2QKUA 2AWUA 2E7KA 1KEFA 2CS5A 1W9OA 3PDZA 3TSZA 2KOMA 2EHRA 2I0LA 2PDZA 4N6XA 3SOEA 4UU5A 3R68A 3KZDA 4WYTA 5HDYA 1M5ZA 2OCSA 2PKTA 4Q2PA 3QDOA 1B8QA 1N6EA 2DB5A 2RCZA 1W9QA 3O5NA 2VSVA 2V90A 2MHOA 1WI4A 3BPUA 5GNDA 1UM1A 2IWQA 2R3YA 4E35A 3VQFA 3RL8A 4Q2OA 3GJ9A 4FGMA 2YT8A 2LC7A 1WF7A 5EYZA 1V1TA 2OGPA 1WHAA 4GVCA 4JOPA 3GGEA 4OAJA 1GQ5A 4XHVA 5E11A 5G1EA 3ID1A 4K6YA 2OQSA 2QKVA 1VA8A 3PV5A 2DM8A 3DJ3A 1Q3PA 5HFEA 3ID3A 2LOBA 1OBYA 4NMPA 3ZRTA 1L6OA 5HFDA 2KA9A 2LUIA 1SOZA 3QIKA 1QAUA 3K50A 5H3JA 4NMTA 1T2MA 4EDJA 2EDPA 4K72A 1I92A 1UITA 2JXOA 1SOTA 5B6LA 1D5GA 2H3MA 2FCFA 2DJTA 1UEPA 2K1ZA 2EDZA 2I04A 2KV8A 1KWAA 1UHPA 2D90A 1MFGA 3PS4A 2DKRA 2GZVA 3CS0A 3DJAA 5FHTA 3VQGA 3FY5A 1IU0A 3QJMA 1Z86A 3CBZA 2ENOA 2HGAA 3GCOA 2RRMA 4KFVA 4O06A 1UJUA 1X45A 1X5NA 1WG6A 1UEZA 2YUYA 4HOPA 3B76A 2BYGA 1RGRA 1RY4A 4GVDA 1FC9A 2P3WA 4JOKA 1N99A 2EJYA 3K82A 1G9OA 1VJ6A 3CC0A 1R6JA 2OMJA 2DC2A 2EEGA 4MPAA 5HEYA 1XZ9A 3KZEA 3EGGC 4JOEA 5GLJA 5HF1A 1VCWA 4Z8JA 5E6PB 3TMHA 3DIWA 2IWPA 4NMOA 2ZPLA 3LNXA 2YUBA 2ZPMA 4NNMA 1VAEA 4E3BA 2OSGA 4PQWA 2EXGA 4AMHA 4F8KA 2OS6A 1MC7A 2PKUA 2KPLA 2L4TA 3PDVA 1KY9A 2R4HA 1WHDA 1WIFA 2YTWA 2AWXA 2AWWA 2V1WA 3R69A 4JORA 1FCFA 1GM1A 4HOPB 4JOJA 1U39A 1N7EA 5E21A 1P1EA 3STJA 2IWNA 2YT7A 1OBZA 4K78A 2JINA 1BE9A 3O46A 2H3LA 1BFEA 5HFCA 2DLSA 1PDRA 3HPMA 4Q2NA 2LC6A 2I1NA 2L97A 2EV8A 2KPKA 1IU2A 2KJDA 5JXBA 1MFLA 4R2ZA 2Z9IA 1N6DA 4JL7A 2M3MA 4LMMA 3TSVA 2EEHA 3WKMA 2M0UA 1UJVA 2JOAA 2HE4A 3MH6A 3NFLA 3JXTA 4GHNA 3CBYA 4NMVA 3CBXA 3QGLA 5DTHA 3TSWA 2LA8A 5F67A 3I1EA 2Q3GA 4YDPA 1OBXA 4OEPA 1Q3OA 4UU6A 1FC6A 1TP3A 1GQ4A 1UEWA 2OPGA 4NMSA 2Z17A 1WF8A 1WJLA 2W7RA 1P1DA 4RI0A 3SFJA 1TP5A 3CH8A 2KJKA 1RGWA 5HJ1A 4JOFA 3CYYA 1X8SA 2IWOA 3GDSA 2QT5A 1N7FA 3R0HA 1Y8TA 4P2AB 1WI2A 2WL7A 4P0CA 4OEOA 2UZCA 1X5RA 1YBOA 1UJDA 1WH1A 2PA1A 3PV4A 3RLEA 2DAZA 3LNYA 3ID2A 4K75A 3QJNA 3NGHA 1Y7NA 5HEDA 2VWRA 1V5LA 4Q6SA 1WFGA 1VB7A 5A2PA 5HEBA 1UM7A 4Z33A 1RZXA 2KYLA 2CSSA 1Z87A 1UF1A 3OTPA 4E34A 4H11A 2MX6A 2PNTA 3GSLA 2QG1A 3AXAA 1OZIA 3QO6A 5G1DA 2L4SA 2QBWA 1WFVA 3SUZA 4Q6HA 2X7ZA 4JOHA 3I18A 4WYUA 2Q9VA 5E1YA 5HF4A 4YYXA 1QAVA 3EGHC 1UEQA 3KHFA 2W4FA 1U3BA 3DJ1A 2FNEA 2DLUA 1QLCA 2HE2A 4G69A 5HETA 1V5QA 4K76A 5HFFA 1V62A 2G5MB 1UFXA 4REYA 3ID4A 3HPKA 2REYA 1ZUBA 3OU0A 2DMZA 3HVQC 2EGOA 2VPHA 1TE0A 3QE1A
chains in the Genus database with same CATH superfamily
5IL9A 3PV2A 2H2CA 2VZ5A 3GDUA 1W9EA 5HFBA 3E17A 4NMRA 1LCYA 2AINA 4JOGA 4KFWA 2EAQA 3DORA 2K20A 1NTEA 2M0ZA 4NNLA 1X6DA 2H2BA 3MH4A 4Q3HA 2JWEA 1K32A 4Q2QA 1QAVB 3RL7A 3WKLA 1N6FA 3GABA 4NXQA 1U37A 2F0AA 1N7TA 1TQ3A 2KJPA 2KL1A 2KG2A 2EEIA 1V6BA 2KOHA 5E22A 2PZDA 2KAWA 3SHWA 2I6VA 1IHJA 4JJ3A 2VRFA 2KBSA 2M0TA 3GCNA 4L8NA 2CSJA 2I0IA 2QKTA 3I4WA 1ZOKA 1I16A 2JREA 1X5QA 3NFKA 2KRGA 4NXRA 5F3XA 5I7ZA 3MH7A 2G2LA 3L4FD 4NXPA 5EZ0A 2KOJA 3GDVA 2EGNA 2FE5A 2JIKA 2O2TA 2EEJA 1FC7A 2FN5A 2KQFA 1Q7XA 2EGKA 5FB8C 2M10A 1NF3C 2EDVA 2I4SA 2OZFA 3K1RA 4IC6A 3SHUA 2D92A 1U38A 2F5YA 2M0VA 4NMQA 2JILA 2VSPA 5D13A 2D8IA 2QKUA 2AWUA 2E7KA 1KEFA 2CS5A 1W9OA 3PDZA 3TSZA 2KOMA 2EHRA 2I0LA 2PDZA 4N6XA 3SOEA 4UU5A 3R68A 3KZDA 4WYTA 5HDYA 1M5ZA 2OCSA 2PKTA 4Q2PA 3QDOA 1B8QA 1N6EA 2DB5A 2RCZA 1W9QA 3O5NA 2VSVA 2V90A 2MHOA 1WI4A 3BPUA 5GNDA 5B42A 1UM1A 2IWQA 2R3YA 4E35A 3VQFA 3RL8A 4Q2OA 3GJ9A 4FGMA 2YT8A 2LC7A 1WF7A 5EYZA 1V1TA 2OGPA 5ILBA 1WHAA 4GVCA 4JOPA 3GGEA 4OAJA 1GQ5A 4XHVA 5E11A 5G1EA 3ID1A 4K6YA 3NCVA 2OQSA 2QKVA 1VA8A 3KDGA 3PV5A 2DM8A 3DJ3A 1Q3PA 5HFEA 3ID3A 2LOBA 1OBYA 4NMPA 3ZRTA 1L6OA 5HFDA 2KA9A 2LUIA 1SOZA 3QIKA 1QAUA 3K50A 5H3JA 4NMTA 1T2MA 4EDJA 2EDPA 4K72A 1I92A 1UITA 2JXOA 1SOTA 5B6LA 1D5GA 2H3MA 2FCFA 2DJTA 1UEPA 2K1ZA 2EDZA 2I04A 2KV8A 1KWAA 1UHPA 2D90A 1MFGA 3PS4A 2DKRA 2GZVA 3CS0A 3DJAA 5FHTA 3VQGA 3FY5A 1IU0A 3QJMA 1Z86A 3CBZA 2ENOA 2HGAA 3GCOA 2RRMA 4KFVA 4O06A 1UJUA 1X45A 1X5NA 1WG6A 1UEZA 2YUYA 4HOPA 3B76A 2BYGA 1RGRA 1RY4A 4GVDA 1FC9A 2P3WA 4JOKA 1N99A 2EJYA 3K82A 1G9OA 1VJ6A 3CC0A 1R6JA 2OMJA 2DC2A 2EEGA 4MPAA 5HEYA 1XZ9A 3KZEA 3EGGC 4JOEA 5GLJA 5HF1A 1VCWA 4Z8JA 5E6PB 3TMHA 3DIWA 2IWPA 4NMOA 2ZPLA 3LNXA 2YUBA 2GEFA 2ZPMA 4NNMA 1VAEA 4E3BA 2OSGA 4PQWA 2EXGA 4AMHA 4F8KA 3KDKA 2OS6A 1MC7A 2PKUA 2KPLA 2L4TA 3PDVA 1KY9A 2R4HA 1WHDA 1WIFA 2YTWA 2AWXA 2AWWA 2V1WA 3R69A 4JORA 1FCFA 1GM1A 4HOPB 4JOJA 1U39A 4JJ0A 1N7EA 5E21A 1P1EA 3STJA 2IWNA 2YT7A 1OBZA 4K78A 2JINA 1BE9A 3O46A 2H3LA 1BFEA 5HFCA 2DLSA 1PDRA 3HPMA 4Q2NA 2LC6A 2I1NA 2L97A 2EV8A 2KPKA 1IU2A 2KJDA 5JXBA 1MFLA 4R2ZA 2Z9IA 1N6DA 4JL7A 2M3MA 4LMMA 3TSVA 2EEHA 3WKMA 2M0UA 1UJVA 2JOAA 2HE4A 3MH6A 3NFLA 3JXTA 4GHNA 3CBYA 4NMVA 3CBXA 3QGLA 5DTHA 3TSWA 2LA8A 5F67A 3I1EA 2Q3GA 1X9ZA 4YDPA 1OBXA 4OEPA 1Q3OA 4UU6A 1FC6A 1TP3A 1GQ4A 1UEWA 2OPGA 4NMSA 2Z17A 1WF8A 1WJLA 2W7RA 1P1DA 4RI0A 3SFJA 1TP5A 3CH8A 2KJKA 1RGWA 5HJ1A 4JOFA 3CYYA 1X8SA 2IWOA 3GDSA 2QT5A 1N7FA 3R0HA 1Y8TA 4P2AB 1WI2A 2WL7A 4P0CA 4OEOA 2UZCA 1X5RA 1YBOA 1UJDA 1WH1A 2JSNA 2PA1A 3PV4A 3RLEA 2DAZA 3LNYA 3ID2A 4K75A 3QJNA 3NGHA 1Y7NA 5HEDA 2VWRA 1V5LA 4Q6SA 1WFGA 1VB7A 5A2PA 5HEBA 1UM7A 4Z33A 1RZXA 2KYLA 2CSSA 1Z87A 1UF1A 3OTPA 4E34A 4H11A 2MX6A 2PNTA 3GSLA 2QG1A 3AXAA 1OZIA 3QO6A 5G1DA 2L4SA 2QBWA 1WFVA 3SUZA 4Q6HA 2X7ZA 4JOHA 3I18A 4WYUA 2Q9VA 4FLNA 5E1YA 5HF4A 4YYXA 1QAVA 3EGHC 1UEQA 3KHFA 2W4FA 1U3BA 3DJ1A 2FNEA 2DLUA 1QLCA 2HE2A 4G69A 5HETA 1V5QA 4K76A 5HFFA 1V62A 2G5MB 1UFXA 4REYA 3ID4A 3HPKA 2REYA 1ZUBA 3OU0A 2DMZA 3HVQC 2EGOA 2VPHA 1TE0A 3QE1A
chains in the Genus database with same CATH topology
5IL9A 3PV2A 2H2CA 2VZ5A 3GDUA 1W9EA 5HFBA 3E17A 4NMRA 1LCYA 2AINA 4JOGA 4KFWA 2EAQA 3DORA 2K20A 1NTEA 2M0ZA 4NNLA 1X6DA 2H2BA 3MH4A 4Q3HA 2JWEA 1K32A 4Q2QA 1QAVB 3RL7A 3WKLA 1N6FA 3GABA 4NXQA 1U37A 2F0AA 1N7TA 1TQ3A 2KJPA 2KL1A 2KG2A 2EEIA 1V6BA 2KOHA 5E22A 2PZDA 2KAWA 3SHWA 2I6VA 1IHJA 4JJ3A 2VRFA 2KBSA 2M0TA 3GCNA 4L8NA 2CSJA 2I0IA 2QKTA 3I4WA 1ZOKA 1I16A 2JREA 1X5QA 3NFKA 2KRGA 4NXRA 5F3XA 5I7ZA 3MH7A 2G2LA 3L4FD 4NXPA 5EZ0A 2KOJA 3GDVA 2EGNA 2FE5A 2JIKA 2O2TA 2EEJA 1FC7A 2FN5A 2KQFA 1Q7XA 2EGKA 5FB8C 2M10A 1NF3C 2EDVA 2I4SA 2OZFA 3K1RA 4IC6A 3SHUA 2D92A 1U38A 2F5YA 2M0VA 4NMQA 2JILA 2VSPA 5D13A 2D8IA 2QKUA 2AWUA 2E7KA 1KEFA 2CS5A 1W9OA 3PDZA 3TSZA 2KOMA 2EHRA 2I0LA 2PDZA 4N6XA 3SOEA 4UU5A 3R68A 3KZDA 4WYTA 5HDYA 1M5ZA 2OCSA 2PKTA 4Q2PA 3QDOA 1B8QA 1N6EA 2DB5A 2RCZA 1W9QA 3O5NA 2VSVA 2V90A 2MHOA 1WI4A 3BPUA 5GNDA 5B42A 1UM1A 2IWQA 2R3YA 4E35A 3VQFA 3RL8A 4Q2OA 3GJ9A 4FGMA 2YT8A 2LC7A 1WF7A 5EYZA 1V1TA 2OGPA 5ILBA 1WHAA 4GVCA 4JOPA 3GGEA 4OAJA 1GQ5A 4XHVA 5E11A 5G1EA 3ID1A 4K6YA 3NCVA 2OQSA 2QKVA 1VA8A 3KDGA 3PV5A 2DM8A 3DJ3A 1Q3PA 5HFEA 3ID3A 2LOBA 1OBYA 4NMPA 3ZRTA 1L6OA 5HFDA 2KA9A 2LUIA 1SOZA 3QIKA 1QAUA 3K50A 5H3JA 4NMTA 1T2MA 4EDJA 2EDPA 4K72A 1I92A 1UITA 2JXOA 1SOTA 5B6LA 1D5GA 2H3MA 2FCFA 2DJTA 1UEPA 2K1ZA 2EDZA 2I04A 2KV8A 1KWAA 1UHPA 2D90A 1MFGA 3PS4A 2DKRA 2GZVA 3CS0A 3DJAA 5FHTA 3VQGA 3FY5A 1IU0A 3QJMA 1Z86A 3CBZA 2ENOA 2HGAA 3GCOA 2RRMA 4KFVA 4O06A 1UJUA 1X45A 1X5NA 1WG6A 1UEZA 2YUYA 4HOPA 3B76A 2BYGA 1RGRA 1RY4A 4GVDA 1FC9A 2P3WA 4JOKA 1N99A 2EJYA 3K82A 1G9OA 1VJ6A 3CC0A 1R6JA 2OMJA 2DC2A 2EEGA 4MPAA 5HEYA 1XZ9A 3KZEA 3EGGC 4JOEA 5GLJA 5HF1A 1VCWA 4Z8JA 5E6PB 3TMHA 3DIWA 2IWPA 4NMOA 2ZPLA 3LNXA 2YUBA 2GEFA 2ZPMA 4NNMA 1VAEA 4E3BA 2OSGA 4PQWA 2EXGA 4AMHA 4F8KA 3KDKA 2OS6A 1MC7A 2PKUA 2KPLA 2L4TA 3PDVA 1KY9A 2R4HA 1WHDA 1WIFA 2YTWA 2AWXA 2AWWA 2V1WA 3R69A 4JORA 1FCFA 1GM1A 4HOPB 4JOJA 1U39A 4JJ0A 1N7EA 5E21A 1P1EA 3STJA 2IWNA 2YT7A 1OBZA 4K78A 2JINA 1BE9A 3O46A 2H3LA 1BFEA 5HFCA 2DLSA 1PDRA 3HPMA 4Q2NA 2LC6A 2I1NA 2L97A 2EV8A 2KPKA 1IU2A 2KJDA 5JXBA 1MFLA 4R2ZA 2Z9IA 1N6DA 4JL7A 2M3MA 4LMMA 3TSVA 2EEHA 3WKMA 2M0UA 1UJVA 2JOAA 2HE4A 3MH6A 3NFLA 3JXTA 4GHNA 3CBYA 4NMVA 3CBXA 3QGLA 5DTHA 3TSWA 2LA8A 5F67A 3I1EA 2Q3GA 1X9ZA 4YDPA 1OBXA 4OEPA 1Q3OA 4UU6A 1FC6A 1TP3A 1GQ4A 1UEWA 2OPGA 4NMSA 2Z17A 1WF8A 1WJLA 2W7RA 1P1DA 4RI0A 3SFJA 1TP5A 3CH8A 2KJKA 1RGWA 5HJ1A 4JOFA 3CYYA 1X8SA 2IWOA 3GDSA 2QT5A 1N7FA 3R0HA 1Y8TA 4P2AB 1WI2A 2WL7A 4P0CA 4OEOA 2UZCA 1X5RA 1YBOA 1UJDA 1WH1A 2JSNA 2PA1A 3PV4A 3RLEA 2DAZA 3LNYA 3ID2A 4K75A 3QJNA 3NGHA 1Y7NA 5HEDA 2VWRA 1V5LA 4Q6SA 1WFGA 1VB7A 5A2PA 5HEBA 1UM7A 4Z33A 1RZXA 2KYLA 2CSSA 1Z87A 1UF1A 3OTPA 4E34A 4H11A 2MX6A 2PNTA 3GSLA 2QG1A 3AXAA 1OZIA 3QO6A 5G1DA 2L4SA 2QBWA 1WFVA 3SUZA 4Q6HA 2X7ZA 4JOHA 3I18A 4WYUA 2Q9VA 4FLNA 5E1YA 5HF4A 4YYXA 1QAVA 3EGHC 1UEQA 3KHFA 2W4FA 1U3BA 3DJ1A 2FNEA 2DLUA 1QLCA 2HE2A 4G69A 5HETA 1V5QA 4K76A 5HFFA 1V62A 2G5MB 1UFXA 4REYA 3ID4A 3HPKA 2REYA 1ZUBA 3OU0A 2DMZA 3HVQC 2EGOA 2VPHA 1TE0A 3QE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV2 A;  2H2C A;  2VZ5 A;  3GDU A;  1W9E A;  5HFB A;  3E17 A;  4NMR A;  1LCY A;  2AIN A;  4JOG A;  4KFW A;  2EAQ A;  3DOR A;  2K20 A;  1NTE A;  2M0Z A;  4NNL A;  1X6D A;  2H2B A;  3MH4 A;  4Q3H A;  2JWE A;  1K32 A;  4Q2Q A;  1QAV B;  3RL7 A;  3WKL A;  1N6F A;  4NXQ A;  1U37 A;  2F0A A;  1N7T A;  1TQ3 A;  2KJP A;  2KL1 A;  2KG2 A;  2EEI A;  1V6B A;  2KOH A;  5E22 A;  2PZD A;  2KAW A;  3SHW A;  2I6V A;  1IHJ A;  2VRF A;  2KBS A;  2M0T A;  3GCN A;  4L8N A;  2CSJ A;  2I0I A;  2QKT A;  3I4W A;  1ZOK A;  1I16 A;  2JRE A;  1X5Q A;  3NFK A;  2KRG A;  4NXR A;  5F3X A;  5I7Z A;  3MH7 A;  2G2L A;  3L4F D;  4NXP A;  5EZ0 A;  2KOJ A;  3GDV A;  2EGN A;  2FE5 A;  2JIK A;  2O2T A;  2EEJ A;  1FC7 A;  2FN5 A;  2KQF A;  1Q7X A;  2EGK A;  5FB8 C;  2M10 A;  1NF3 C;  2EDV A;  3K1R A;  2I4S A;  2OZF A;  4IC6 A;  3SHU A;  2D92 A;  1U38 A;  2F5Y A;  2M0V A;  4NMQ A;  2JIL A;  2VSP A;  5D13 A;  2D8I A;  2QKU A;  2AWU A;  2E7K A;  1KEF A;  2CS5 A;  1W9O A;  3PDZ A;  3TSZ A;  2KOM A;  2EHR A;  2I0L A;  2PDZ A;  4N6X A;  3SOE A;  4UU5 A;  3R68 A;  3KZD A;  4WYT A;  5HDY A;  1M5Z A;  2OCS A;  2PKT A;  4Q2P A;  3QDO A;  1B8Q A;  1N6E A;  2DB5 A;  2RCZ A;  1W9Q A;  3O5N A;  2VSV A;  2V90 A;  2MHO A;  1WI4 A;  3BPU A;  5GND A;  1UM1 A;  2IWQ A;  2R3Y A;  4E35 A;  3VQF A;  3RL8 A;  4Q2O A;  3GJ9 A;  4FGM A;  2YT8 A;  2LC7 A;  1WF7 A;  5EYZ A;  1V1T A;  2OGP A;  1WHA A;  4GVC A;  4JOP A;  3GGE A;  4OAJ A;  1GQ5 A;  4XHV A;  5E11 A;  5G1E A;  3ID1 A;  4K6Y A;  2OQS A;  2QKV A;  1VA8 A;  3PV5 A;  2DM8 A;  3DJ3 A;  1Q3P A;  5HFE A;  3ID3 A;  2LOB A;  1OBY A;  4NMP A;  3ZRT A;  1L6O A;  5HFD A;  2KA9 A;  2LUI A;  1SOZ A;  3QIK A;  1QAU A;  3K50 A;  5H3J A;  4NMT A;  1T2M A;  4EDJ A;  2EDP A;  4K72 A;  1I92 A;  1UIT A;  2JXO A;  1SOT A;  5B6L A;  1D5G A;  2H3M A;  2FCF A;  2DJT A;  1UEP A;  2K1Z A;  2EDZ A;  2I04 A;  2KV8 A;  1KWA A;  1UHP A;  2D90 A;  1MFG A;  3PS4 A;  2DKR A;  2GZV A;  3CS0 A;  3DJA A;  5FHT A;  3VQG A;  3FY5 A;  1IU0 A;  3QJM A;  1Z86 A;  3CBZ A;  2ENO A;  2HGA A;  3GCO A;  2RRM A;  4KFV A;  4O06 A;  1UJU A;  1X45 A;  1X5N A;  1WG6 A;  1UEZ A;  2YUY A;  4HOP A;  3B76 A;  2BYG A;  1RGR A;  1RY4 A;  4GVD A;  1FC9 A;  2P3W A;  4JOK A;  1N99 A;  2EJY A;  3K82 A;  1G9O A;  1VJ6 A;  3CC0 A;  1R6J A;  2OMJ A;  2DC2 A;  2EEG A;  4MPA A;  5HEY A;  1XZ9 A;  3KZE A;  3EGG C;  4JOE A;  5GLJ A;  5HF1 A;  1VCW A;  4Z8J A;  5E6P B;  3TMH A;  3DIW A;  2IWP A;  4NMO A;  2ZPL A;  3LNX A;  2YUB A;  2ZPM A;  4NNM A;  1VAE A;  4E3B A;  2OSG A;  4PQW A;  2EXG A;  4AMH A;  4F8K A;  2OS6 A;  1MC7 A;  2PKU A;  2KPL A;  2L4T A;  3PDV A;  1KY9 A;  2R4H A;  1WHD A;  1WIF A;  2YTW A;  2AWX A;  2AWW A;  2V1W A;  3R69 A;  4JOR A;  1FCF A;  1GM1 A;  4HOP B;  4JOJ A;  1U39 A;  1N7E A;  5E21 A;  1P1E A;  3STJ A;  2IWN A;  2YT7 A;  1OBZ A;  4K78 A;  2JIN A;  1BE9 A;  3O46 A;  2H3L A;  1BFE A;  5HFC A;  2DLS A;  1PDR A;  3HPM A;  4Q2N A;  2LC6 A;  2I1N A;  2L97 A;  2EV8 A;  2KPK A;  1IU2 A;  2KJD A;  5JXB A;  1MFL A;  4R2Z A;  2Z9I A;  1N6D A;  4JL7 A;  2M3M A;  4LMM A;  3TSV A;  2EEH A;  3WKM A;  2M0U A;  1UJV A;  2JOA A;  2HE4 A;  3MH6 A;  3NFL A;  3JXT A;  4GHN A;  3CBY A;  4NMV A;  3CBX A;  3QGL A;  5DTH A;  3TSW A;  2LA8 A;  5F67 A;  3I1E A;  2Q3G A;  4YDP A;  1OBX A;  4OEP A;  1Q3O A;  4UU6 A;  1FC6 A;  1TP3 A;  1GQ4 A;  1UEW A;  2OPG A;  4NMS A;  2Z17 A;  1WF8 A;  1WJL A;  2W7R A;  1P1D A;  4RI0 A;  3SFJ A;  1TP5 A;  3CH8 A;  2KJK A;  1RGW A;  5HJ1 A;  4JOF A;  3CYY A;  1X8S A;  2IWO A;  3GDS A;  2QT5 A;  1N7F A;  3R0H A;  1Y8T A;  4P2A B;  1WI2 A;  2WL7 A;  4P0C A;  4OEO A;  2UZC A;  1X5R A;  1YBO A;  1UJD A;  1WH1 A;  2PA1 A;  3PV4 A;  3RLE A;  2DAZ A;  3LNY A;  3ID2 A;  4K75 A;  3QJN A;  3NGH A;  1Y7N A;  5HED A;  2VWR A;  1V5L A;  4Q6S A;  1WFG A;  1VB7 A;  5A2P A;  5HEB A;  1UM7 A;  4Z33 A;  1RZX A;  2KYL A;  2CSS A;  1Z87 A;  1UF1 A;  3OTP A;  4E34 A;  4H11 A;  2MX6 A;  2PNT A;  3GSL A;  2QG1 A;  3AXA A;  1OZI A;  3QO6 A;  5G1D A;  2L4S A;  2QBW A;  1WFV A;  3SUZ A;  4Q6H A;  2X7Z A;  4JOH A;  3I18 A;  4WYU A;  2Q9V A;  5E1Y A;  5HF4 A;  4YYX A;  1QAV A;  3EGH C;  1UEQ A;  3KHF A;  2W4F A;  1U3B A;  3DJ1 A;  2FNE A;  2DLU A;  1QLC A;  2HE2 A;  4G69 A;  5HET A;  1V5Q A;  4K76 A;  5HFF A;  1V62 A;  2G5M B;  1UFX A;  4REY A;  3ID4 A;  3HPK A;  2REY A;  1ZUB A;  3OU0 A;  2DMZ A;  3HVQ C;  2EGO A;  2VPH A;  1TE0 A;  3QE1 A; 
#chains in the Genus database with same CATH topology
 5IL9 A;  3PV2 A;  2H2C A;  2VZ5 A;  3GDU A;  1W9E A;  5HFB A;  3E17 A;  4NMR A;  1LCY A;  2AIN A;  4JOG A;  4KFW A;  2EAQ A;  3DOR A;  2K20 A;  1NTE A;  2M0Z A;  4NNL A;  1X6D A;  2H2B A;  3MH4 A;  4Q3H A;  2JWE A;  1K32 A;  4Q2Q A;  1QAV B;  3RL7 A;  3WKL A;  1N6F A;  3GAB A;  4NXQ A;  1U37 A;  2F0A A;  1N7T A;  1TQ3 A;  2KJP A;  2KL1 A;  2KG2 A;  2EEI A;  1V6B A;  2KOH A;  5E22 A;  2PZD A;  2KAW A;  3SHW A;  2I6V A;  1IHJ A;  4JJ3 A;  2VRF A;  2KBS A;  2M0T A;  3GCN A;  4L8N A;  2CSJ A;  2I0I A;  2QKT A;  3I4W A;  1ZOK A;  1I16 A;  2JRE A;  1X5Q A;  3NFK A;  2KRG A;  4NXR A;  5F3X A;  5I7Z A;  3MH7 A;  2G2L A;  3L4F D;  4NXP A;  5EZ0 A;  2KOJ A;  3GDV A;  2EGN A;  2FE5 A;  2JIK A;  2O2T A;  2EEJ A;  1FC7 A;  2FN5 A;  2KQF A;  1Q7X A;  2EGK A;  5FB8 C;  2M10 A;  1NF3 C;  2EDV A;  2I4S A;  2OZF A;  3K1R A;  4IC6 A;  3SHU A;  2D92 A;  1U38 A;  2F5Y A;  2M0V A;  4NMQ A;  2JIL A;  2VSP A;  5D13 A;  2D8I A;  2QKU A;  2AWU A;  2E7K A;  1KEF A;  2CS5 A;  1W9O A;  3PDZ A;  3TSZ A;  2KOM A;  2EHR A;  2I0L A;  2PDZ A;  4N6X A;  3SOE A;  4UU5 A;  3R68 A;  3KZD A;  4WYT A;  5HDY A;  1M5Z A;  2OCS A;  2PKT A;  4Q2P A;  3QDO A;  1B8Q A;  1N6E A;  2DB5 A;  2RCZ A;  1W9Q A;  3O5N A;  2VSV A;  2V90 A;  2MHO A;  1WI4 A;  3BPU A;  5GND A;  5B42 A;  1UM1 A;  2IWQ A;  2R3Y A;  4E35 A;  3VQF A;  3RL8 A;  4Q2O A;  3GJ9 A;  4FGM A;  2YT8 A;  2LC7 A;  1WF7 A;  5EYZ A;  1V1T A;  2OGP A;  5ILB A;  1WHA A;  4GVC A;  4JOP A;  3GGE A;  4OAJ A;  1GQ5 A;  4XHV A;  5E11 A;  5G1E A;  3ID1 A;  4K6Y A;  3NCV A;  2OQS A;  2QKV A;  1VA8 A;  3KDG A;  3PV5 A;  2DM8 A;  3DJ3 A;  1Q3P A;  5HFE A;  3ID3 A;  2LOB A;  1OBY A;  4NMP A;  3ZRT A;  1L6O A;  5HFD A;  2KA9 A;  2LUI A;  1SOZ A;  3QIK A;  1QAU A;  3K50 A;  5H3J A;  4NMT A;  1T2M A;  4EDJ A;  2EDP A;  4K72 A;  1I92 A;  1UIT A;  2JXO A;  1SOT A;  5B6L A;  1D5G A;  2H3M A;  2FCF A;  2DJT A;  1UEP A;  2K1Z A;  2EDZ A;  2I04 A;  2KV8 A;  1KWA A;  1UHP A;  2D90 A;  1MFG A;  3PS4 A;  2DKR A;  2GZV A;  3CS0 A;  3DJA A;  5FHT A;  3VQG A;  3FY5 A;  1IU0 A;  3QJM A;  1Z86 A;  3CBZ A;  2ENO A;  2HGA A;  3GCO A;  2RRM A;  4KFV A;  4O06 A;  1UJU A;  1X45 A;  1X5N A;  1WG6 A;  1UEZ A;  2YUY A;  4HOP A;  3B76 A;  2BYG A;  1RGR A;  1RY4 A;  4GVD A;  1FC9 A;  2P3W A;  4JOK A;  1N99 A;  2EJY A;  3K82 A;  1G9O A;  1VJ6 A;  3CC0 A;  1R6J A;  2OMJ A;  2DC2 A;  2EEG A;  4MPA A;  5HEY A;  1XZ9 A;  3KZE A;  3EGG C;  4JOE A;  5GLJ A;  5HF1 A;  1VCW A;  4Z8J A;  5E6P B;  3TMH A;  3DIW A;  2IWP A;  4NMO A;  2ZPL A;  3LNX A;  2YUB A;  2GEF A;  2ZPM A;  4NNM A;  1VAE A;  4E3B A;  2OSG A;  4PQW A;  2EXG A;  4AMH A;  4F8K A;  3KDK A;  2OS6 A;  1MC7 A;  2PKU A;  2KPL A;  2L4T A;  3PDV A;  1KY9 A;  2R4H A;  1WHD A;  1WIF A;  2YTW A;  2AWX A;  2AWW A;  2V1W A;  3R69 A;  4JOR A;  1FCF A;  1GM1 A;  4HOP B;  4JOJ A;  1U39 A;  4JJ0 A;  1N7E A;  5E21 A;  1P1E A;  3STJ A;  2IWN A;  2YT7 A;  1OBZ A;  4K78 A;  2JIN A;  1BE9 A;  3O46 A;  2H3L A;  1BFE A;  5HFC A;  2DLS A;  1PDR A;  3HPM A;  4Q2N A;  2LC6 A;  2I1N A;  2L97 A;  2EV8 A;  2KPK A;  1IU2 A;  2KJD A;  5JXB A;  1MFL A;  4R2Z A;  2Z9I A;  1N6D A;  4JL7 A;  2M3M A;  4LMM A;  3TSV A;  2EEH A;  3WKM A;  2M0U A;  1UJV A;  2JOA A;  2HE4 A;  3MH6 A;  3NFL A;  3JXT A;  4GHN A;  3CBY A;  4NMV A;  3CBX A;  3QGL A;  5DTH A;  3TSW A;  2LA8 A;  5F67 A;  3I1E A;  2Q3G A;  1X9Z A;  4YDP A;  1OBX A;  4OEP A;  1Q3O A;  4UU6 A;  1FC6 A;  1TP3 A;  1GQ4 A;  1UEW A;  2OPG A;  4NMS A;  2Z17 A;  1WF8 A;  1WJL A;  2W7R A;  1P1D A;  4RI0 A;  3SFJ A;  1TP5 A;  3CH8 A;  2KJK A;  1RGW A;  5HJ1 A;  4JOF A;  3CYY A;  1X8S A;  2IWO A;  3GDS A;  2QT5 A;  1N7F A;  3R0H A;  1Y8T A;  4P2A B;  1WI2 A;  2WL7 A;  4P0C A;  4OEO A;  2UZC A;  1X5R A;  1YBO A;  1UJD A;  1WH1 A;  2JSN A;  2PA1 A;  3PV4 A;  3RLE A;  2DAZ A;  3LNY A;  3ID2 A;  4K75 A;  3QJN A;  3NGH A;  1Y7N A;  5HED A;  2VWR A;  1V5L A;  4Q6S A;  1WFG A;  1VB7 A;  5A2P A;  5HEB A;  1UM7 A;  4Z33 A;  1RZX A;  2KYL A;  2CSS A;  1Z87 A;  1UF1 A;  3OTP A;  4E34 A;  4H11 A;  2MX6 A;  2PNT A;  3GSL A;  2QG1 A;  3AXA A;  1OZI A;  3QO6 A;  5G1D A;  2L4S A;  2QBW A;  1WFV A;  3SUZ A;  4Q6H A;  2X7Z A;  4JOH A;  3I18 A;  4WYU A;  2Q9V A;  4FLN A;  5E1Y A;  5HF4 A;  4YYX A;  1QAV A;  3EGH C;  1UEQ A;  3KHF A;  2W4F A;  1U3B A;  3DJ1 A;  2FNE A;  2DLU A;  1QLC A;  2HE2 A;  4G69 A;  5HET A;  1V5Q A;  4K76 A;  5HFF A;  1V62 A;  2G5M B;  1UFX A;  4REY A;  3ID4 A;  3HPK A;  2REY A;  1ZUB A;  3OU0 A;  2DMZ A;  3HVQ C;  2EGO A;  2VPH A;  1TE0 A;  3QE1 A; 
#chains in the Genus database with same CATH homology
 5IL9 A;  3PV2 A;  2H2C A;  2VZ5 A;  3GDU A;  1W9E A;  5HFB A;  3E17 A;  4NMR A;  1LCY A;  2AIN A;  4JOG A;  4KFW A;  2EAQ A;  3DOR A;  2K20 A;  1NTE A;  2M0Z A;  4NNL A;  1X6D A;  2H2B A;  3MH4 A;  4Q3H A;  2JWE A;  1K32 A;  4Q2Q A;  1QAV B;  3RL7 A;  3WKL A;  1N6F A;  3GAB A;  4NXQ A;  1U37 A;  2F0A A;  1N7T A;  1TQ3 A;  2KJP A;  2KL1 A;  2KG2 A;  2EEI A;  1V6B A;  2KOH A;  5E22 A;  2PZD A;  2KAW A;  3SHW A;  2I6V A;  1IHJ A;  4JJ3 A;  2VRF A;  2KBS A;  2M0T A;  3GCN A;  4L8N A;  2CSJ A;  2I0I A;  2QKT A;  3I4W A;  1ZOK A;  1I16 A;  2JRE A;  1X5Q A;  3NFK A;  2KRG A;  4NXR A;  5F3X A;  5I7Z A;  3MH7 A;  2G2L A;  3L4F D;  4NXP A;  5EZ0 A;  2KOJ A;  3GDV A;  2EGN A;  2FE5 A;  2JIK A;  2O2T A;  2EEJ A;  1FC7 A;  2FN5 A;  2KQF A;  1Q7X A;  2EGK A;  5FB8 C;  2M10 A;  1NF3 C;  2EDV A;  2I4S A;  2OZF A;  3K1R A;  4IC6 A;  3SHU A;  2D92 A;  1U38 A;  2F5Y A;  2M0V A;  4NMQ A;  2JIL A;  2VSP A;  5D13 A;  2D8I A;  2QKU A;  2AWU A;  2E7K A;  1KEF A;  2CS5 A;  1W9O A;  3PDZ A;  3TSZ A;  2KOM A;  2EHR A;  2I0L A;  2PDZ A;  4N6X A;  3SOE A;  4UU5 A;  3R68 A;  3KZD A;  4WYT A;  5HDY A;  1M5Z A;  2OCS A;  2PKT A;  4Q2P A;  3QDO A;  1B8Q A;  1N6E A;  2DB5 A;  2RCZ A;  1W9Q A;  3O5N A;  2VSV A;  2V90 A;  2MHO A;  1WI4 A;  3BPU A;  5GND A;  5B42 A;  1UM1 A;  2IWQ A;  2R3Y A;  4E35 A;  3VQF A;  3RL8 A;  4Q2O A;  3GJ9 A;  4FGM A;  2YT8 A;  2LC7 A;  1WF7 A;  5EYZ A;  1V1T A;  2OGP A;  5ILB A;  1WHA A;  4GVC A;  4JOP A;  3GGE A;  4OAJ A;  1GQ5 A;  4XHV A;  5E11 A;  5G1E A;  3ID1 A;  4K6Y A;  3NCV A;  2OQS A;  2QKV A;  1VA8 A;  3KDG A;  3PV5 A;  2DM8 A;  3DJ3 A;  1Q3P A;  5HFE A;  3ID3 A;  2LOB A;  1OBY A;  4NMP A;  3ZRT A;  1L6O A;  5HFD A;  2KA9 A;  2LUI A;  1SOZ A;  3QIK A;  1QAU A;  3K50 A;  5H3J A;  4NMT A;  1T2M A;  4EDJ A;  2EDP A;  4K72 A;  1I92 A;  1UIT A;  2JXO A;  1SOT A;  5B6L A;  1D5G A;  2H3M A;  2FCF A;  2DJT A;  1UEP A;  2K1Z A;  2EDZ A;  2I04 A;  2KV8 A;  1KWA A;  1UHP A;  2D90 A;  1MFG A;  3PS4 A;  2DKR A;  2GZV A;  3CS0 A;  3DJA A;  5FHT A;  3VQG A;  3FY5 A;  1IU0 A;  3QJM A;  1Z86 A;  3CBZ A;  2ENO A;  2HGA A;  3GCO A;  2RRM A;  4KFV A;  4O06 A;  1UJU A;  1X45 A;  1X5N A;  1WG6 A;  1UEZ A;  2YUY A;  4HOP A;  3B76 A;  2BYG A;  1RGR A;  1RY4 A;  4GVD A;  1FC9 A;  2P3W A;  4JOK A;  1N99 A;  2EJY A;  3K82 A;  1G9O A;  1VJ6 A;  3CC0 A;  1R6J A;  2OMJ A;  2DC2 A;  2EEG A;  4MPA A;  5HEY A;  1XZ9 A;  3KZE A;  3EGG C;  4JOE A;  5GLJ A;  5HF1 A;  1VCW A;  4Z8J A;  5E6P B;  3TMH A;  3DIW A;  2IWP A;  4NMO A;  2ZPL A;  3LNX A;  2YUB A;  2GEF A;  2ZPM A;  4NNM A;  1VAE A;  4E3B A;  2OSG A;  4PQW A;  2EXG A;  4AMH A;  4F8K A;  3KDK A;  2OS6 A;  1MC7 A;  2PKU A;  2KPL A;  2L4T A;  3PDV A;  1KY9 A;  2R4H A;  1WHD A;  1WIF A;  2YTW A;  2AWX A;  2AWW A;  2V1W A;  3R69 A;  4JOR A;  1FCF A;  1GM1 A;  4HOP B;  4JOJ A;  1U39 A;  4JJ0 A;  1N7E A;  5E21 A;  1P1E A;  3STJ A;  2IWN A;  2YT7 A;  1OBZ A;  4K78 A;  2JIN A;  1BE9 A;  3O46 A;  2H3L A;  1BFE A;  5HFC A;  2DLS A;  1PDR A;  3HPM A;  4Q2N A;  2LC6 A;  2I1N A;  2L97 A;  2EV8 A;  2KPK A;  1IU2 A;  2KJD A;  5JXB A;  1MFL A;  4R2Z A;  2Z9I A;  1N6D A;  4JL7 A;  2M3M A;  4LMM A;  3TSV A;  2EEH A;  3WKM A;  2M0U A;  1UJV A;  2JOA A;  2HE4 A;  3MH6 A;  3NFL A;  3JXT A;  4GHN A;  3CBY A;  4NMV A;  3CBX A;  3QGL A;  5DTH A;  3TSW A;  2LA8 A;  5F67 A;  3I1E A;  2Q3G A;  1X9Z A;  4YDP A;  1OBX A;  4OEP A;  1Q3O A;  4UU6 A;  1FC6 A;  1TP3 A;  1GQ4 A;  1UEW A;  2OPG A;  4NMS A;  2Z17 A;  1WF8 A;  1WJL A;  2W7R A;  1P1D A;  4RI0 A;  3SFJ A;  1TP5 A;  3CH8 A;  2KJK A;  1RGW A;  5HJ1 A;  4JOF A;  3CYY A;  1X8S A;  2IWO A;  3GDS A;  2QT5 A;  1N7F A;  3R0H A;  1Y8T A;  4P2A B;  1WI2 A;  2WL7 A;  4P0C A;  4OEO A;  2UZC A;  1X5R A;  1YBO A;  1UJD A;  1WH1 A;  2JSN A;  2PA1 A;  3PV4 A;  3RLE A;  2DAZ A;  3LNY A;  3ID2 A;  4K75 A;  3QJN A;  3NGH A;  1Y7N A;  5HED A;  2VWR A;  1V5L A;  4Q6S A;  1WFG A;  1VB7 A;  5A2P A;  5HEB A;  1UM7 A;  4Z33 A;  1RZX A;  2KYL A;  2CSS A;  1Z87 A;  1UF1 A;  3OTP A;  4E34 A;  4H11 A;  2MX6 A;  2PNT A;  3GSL A;  2QG1 A;  3AXA A;  1OZI A;  3QO6 A;  5G1D A;  2L4S A;  2QBW A;  1WFV A;  3SUZ A;  4Q6H A;  2X7Z A;  4JOH A;  3I18 A;  4WYU A;  2Q9V A;  4FLN A;  5E1Y A;  5HF4 A;  4YYX A;  1QAV A;  3EGH C;  1UEQ A;  3KHF A;  2W4F A;  1U3B A;  3DJ1 A;  2FNE A;  2DLU A;  1QLC A;  2HE2 A;  4G69 A;  5HET A;  1V5Q A;  4K76 A;  5HFF A;  1V62 A;  2G5M B;  1UFX A;  4REY A;  3ID4 A;  3HPK A;  2REY A;  1ZUB A;  3OU0 A;  2DMZ A;  3HVQ C;  2EGO A;  2VPH A;  1TE0 A;  3QE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...