1TP5A

Crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic density protein 95
publication title Structure of the third PDZ domain of PSD-95 protein complexed with KKETWV peptide ligand
rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1tp5A00
3SOEA 2RCZA 4NMSA 3HVQC 1U37A 2BYGA 2W7RA 2PDZA 1V6BA 3DJAA 4KFWA 1RGWA 4JOGA 5HF4A 1QAVB 1WFGA 2KOHA 1VB7A 2YT8A 1MFGA 2DAZA 5GLJA 1U3BA 2EGOA 2W4FA 2I0LA 3MH7A 4WYTA 3GJ9A 1KY9A 1D5GA 2DC2A 1UJUA 2YUBA 2G5MB 1VAEA 1UF1A 3SUZA 1V62A 4NXQA 4OAJA 1V1TA 3ID2A 4H11A 2O2TA 1GQ4A 4GHNA 2KYLA 3QO6A 4JOPA 4Q6SA 1X5RA 2V1WA 5HF1A 3PDZA 5HEDA 1QLCA 4Q2OA 2OGPA 4JOKA 2M0TA 5F67A 1Q3OA 5G1EA 1RY4A 2DLUA 1WHDA 1OBYA 1I16A 2KOMA 2JIKA 1NF3C 4E3BA 2OMJA 3LNXA 1W9OA 4AMHA 3SFJA 2R4HA 4YDPA 4KFVA 1Y7NA 1FC6A 1MFLA 3AXAA 3O46A 5DTHA 2DKRA 4G69A 3QGLA 5EZ0A 4Z8JA 4MPAA 5I7ZA 5E6PB 1RZXA 3EGGC 2L4SA 3RL7A 5HEYA 2EGKA 3SHUA 2JWEA 3GDSA 1V5LA 4Z33A 1KWAA 2QKVA 1Z87A 1X8SA 1LCYA 3KZEA 5G1DA 3NGHA 4REYA 3RLEA 1PDRA 4K72A 1K32A 2I6VA 3QIKA 2L4TA 1WFVA 2DM8A 4Q2NA 3CBYA 1UHPA 3I1EA 1WIFA 1P1DA 3CYYA 2QBWA 1TP5A 2AINA 2OPGA 1RGRA 4JOJA 1FC7A 3K50A 4NMTA 2EAQA 2KJDA 4N6XA 1WJLA 1UITA 1GQ5A 3CBXA 4O06A 3QDOA 3CBZA 3NFLA 2IWOA 4XHVA 1WI2A 4L8NA 4E35A 5JXBA 2HGAA 3MH6A 3QJMA 1ZOKA 4Q2QA 1OZIA 3K82A 3VQFA 1Q7XA 3TMHA 2I4SA 3QJNA 3QE1A 1MC7A 4RI0A 5E21A 3KHFA 2DB5A 1SOZA 1WG6A 2GZVA 4EDJA 1UJVA 1NTEA 2EJYA 2IWQA 5HFEA 2EDVA 5GNDA 2OQSA 1FCFA 5HFDA 3I18A 3CH8A 3GCOA 4JL7A 2Z9IA 2EXGA 3OTPA 1WF7A 3TSVA 4PQWA 5F3XA 1BFEA 2QT5A 4WYUA 1U39A 4JORA 3CS0A 3L4FD 2D90A 2HE4A 2KOJA 3B76A 1WF8A 2KAWA 5HFBA 2Z17A 2DLSA 4JOEA 4NMQA 5A2PA 1Q3PA 4UU6A 3R68A 2VPHA 2R3YA 1V5QA 2VSPA 2ENOA 3MH4A 3RL8A 1G9OA 5E11A 3GDVA 2KJKA 2DJTA 2D92A 2EHRA 2LOBA 4GVDA 1N99A 2E7KA 2IWPA 3FY5A 3PV5A 4P2AB 1OBZA 2D8IA 1IU0A 2OS6A 1N6EA 1N7FA 3BPUA 5H3JA 1VJ6A 3GSLA 4F8KA 2RRMA 5HJ1A 3HPMA 5HDYA 4NMVA 3I4WA 3SHWA 2IWNA 4NNMA 1W9EA 5E22A 4Q6HA 2L97A 2EEHA 1UEPA 2Q9VA 3ID3A 3ID4A 3WKLA 2WL7A 2QKUA 2KG2A 3CC0A 1QAUA 2EDZA 1X5QA 1IHJA 3DIWA 3VQGA 1ZUBA 1N7EA 2EGNA 3LNYA 4FGMA 2CS5A 5FHTA 2JXOA 2F5YA 2M3MA 2Q3GA 3ID1A 1T2MA 2I0IA 2I1NA 1R6JA 3GCNA 1UM1A 4K78A 5HEBA 2KA9A 1B8QA 1UEZA 4K75A 2LUIA 2MX6A 4HOPB 3DJ3A 2KQFA 2JREA 1U38A 1WH1A 4NNLA 1W9QA 3DORA 1M5ZA 2FNEA 4HOPA 2M10A 2VZ5A 4K76A 1VA8A 3K1RA 4IC6A 2KBSA 1X45A 2CSJA 4NMRA 4NXPA 2FE5A 3PS4A 2EV8A 2KJPA 1X6DA 1N6FA 3KZDA 5FB8C 2PZDA 1L6OA 2M0UA 2LA8A 4R2ZA 2H2CA 4LMMA 1IU2A 2JOAA 2YUYA 1KEFA 2KRGA 3E17A 1QAVA 1N6DA 1OBXA 2P3WA 2YT7A 4NMPA 2ZPLA 5E1YA 2JILA 3HPKA 2KPKA 2PKTA 2MHOA 5HETA 4P0CA 1Y8TA 5HFFA 1YBOA 5EYZA 2EEJA 3GDUA 4OEOA 4NXRA 2YTWA 1UJDA 2UZCA 3EGHC 1N7TA 3R0HA 2AWXA 2K1ZA 3STJA 1P1EA 4JOFA 3O5NA 2REYA 2OZFA 2EDPA 4YYXA 2F0AA 2LC6A 2PKUA 4JOHA 1FC9A 4UU5A 1TQ3A 3TSWA 2M0VA 2KPLA 1Z86A 3PV2A 2JINA 3OU0A 3PV4A 3NFKA 3WKMA 2M0ZA 2VSVA 4GVCA 2DMZA 2H3MA 2HE2A 3GGEA 5B6LA 5D13A 1SOTA 4K6YA 4OEPA 2ZPMA 3R69A 2QKTA 2G2LA 1WHAA 1UM7A 2VRFA 2X7ZA 2H3LA 1GM1A 3DJ1A 2EEGA 2AWWA 1XZ9A 2K20A 2OCSA 2V90A 2EEIA 1TE0A 1UEQA 3ZRTA 4E34A 1VCWA 2H2BA 2QG1A 1X5NA 4Q3HA 3PDVA 2AWUA 1BE9A 2VWRA 2PA1A 1UFXA 2KL1A 2LC7A 5HFCA 1TP3A 2PNTA 2KV8A 4Q2PA 3JXTA 2FN5A 4NMOA 3TSZA 1WI4A 1UEWA 1I92A 2OSGA 2FCFA 2I04A 2CSSA
chains in the Genus database with same CATH superfamily
3SOEA 2RCZA 4NMSA 3HVQC 1U37A 2BYGA 2W7RA 2PDZA 1V6BA 3DJAA 2GEFA 4KFWA 1RGWA 4JOGA 5HF4A 1QAVB 1WFGA 2KOHA 1VB7A 2YT8A 1MFGA 2DAZA 5GLJA 1U3BA 2EGOA 2W4FA 2I0LA 3MH7A 4WYTA 3GJ9A 1KY9A 1D5GA 2DC2A 1UJUA 2YUBA 2G5MB 1VAEA 1UF1A 3SUZA 1V62A 4NXQA 4OAJA 1V1TA 3ID2A 4H11A 2O2TA 1GQ4A 4GHNA 2KYLA 3QO6A 4JOPA 4Q6SA 1X5RA 2V1WA 5HF1A 3PDZA 5HEDA 1QLCA 4Q2OA 2OGPA 4JOKA 2M0TA 5F67A 1Q3OA 5G1EA 1RY4A 2DLUA 1WHDA 1OBYA 1I16A 2KOMA 4JJ3A 2JIKA 1NF3C 4E3BA 2OMJA 3LNXA 1W9OA 4AMHA 3SFJA 2R4HA 4YDPA 4KFVA 1Y7NA 1FC6A 1MFLA 3AXAA 3O46A 5DTHA 2DKRA 4G69A 3QGLA 5EZ0A 4Z8JA 4MPAA 5I7ZA 5E6PB 1RZXA 3EGGC 2L4SA 3RL7A 5HEYA 2EGKA 3SHUA 2JWEA 3GDSA 1V5LA 4Z33A 1KWAA 2QKVA 1Z87A 1X8SA 1LCYA 3KZEA 5G1DA 3NGHA 4REYA 3RLEA 1PDRA 4FLNA 1K32A 4K72A 2I6VA 3QIKA 5ILBA 2L4TA 1WFVA 2DM8A 4Q2NA 3CBYA 1UHPA 3I1EA 1WIFA 1P1DA 3CYYA 2QBWA 1TP5A 2AINA 2OPGA 1RGRA 4JOJA 1FC7A 3K50A 4NMTA 2EAQA 2KJDA 4N6XA 1WJLA 1UITA 1GQ5A 3CBXA 4O06A 3QDOA 3CBZA 3NFLA 2IWOA 4XHVA 1WI2A 4L8NA 4E35A 5JXBA 2HGAA 3MH6A 3QJMA 1ZOKA 4Q2QA 1OZIA 3K82A 3VQFA 1Q7XA 3TMHA 2I4SA 3QJNA 3QE1A 1MC7A 4RI0A 5E21A 3KHFA 2DB5A 1SOZA 1WG6A 2GZVA 4EDJA 1UJVA 1NTEA 2EJYA 2IWQA 5HFEA 2EDVA 5GNDA 2OQSA 1FCFA 5HFDA 3I18A 3CH8A 3GCOA 4JL7A 2JSNA 2Z9IA 2EXGA 3OTPA 1WF7A 3TSVA 4PQWA 5F3XA 1BFEA 2QT5A 4WYUA 1U39A 4JORA 3CS0A 3L4FD 2D90A 2HE4A 2KOJA 3B76A 1WF8A 2KAWA 5HFBA 2Z17A 2DLSA 4JOEA 4NMQA 5A2PA 1Q3PA 4UU6A 3R68A 2VPHA 2R3YA 1V5QA 2VSPA 2ENOA 3MH4A 3RL8A 1G9OA 5E11A 3GDVA 2KJKA 2DJTA 2D92A 2EHRA 2LOBA 4GVDA 1N99A 2E7KA 2IWPA 3FY5A 3PV5A 4P2AB 1OBZA 2D8IA 1IU0A 2OS6A 1N6EA 1N7FA 3BPUA 5H3JA 1VJ6A 3GSLA 4F8KA 2RRMA 5HJ1A 3HPMA 5HDYA 5IL9A 4NMVA 3I4WA 3SHWA 2IWNA 4NNMA 1W9EA 5E22A 4Q6HA 2L97A 3KDGA 2EEHA 1UEPA 2Q9VA 3NCVA 3ID3A 3ID4A 3WKLA 2WL7A 2QKUA 2KG2A 3CC0A 1QAUA 2EDZA 1X5QA 1IHJA 3DIWA 3VQGA 1ZUBA 1N7EA 2EGNA 3LNYA 4FGMA 2CS5A 5FHTA 2JXOA 2F5YA 2M3MA 2Q3GA 3ID1A 1T2MA 2I0IA 2I1NA 1R6JA 3GCNA 1UM1A 4K78A 5HEBA 2KA9A 1B8QA 1UEZA 4K75A 2LUIA 2MX6A 4HOPB 3DJ3A 2KQFA 2JREA 1U38A 1WH1A 4NNLA 1W9QA 3DORA 1M5ZA 2FNEA 4HOPA 2M10A 2VZ5A 4K76A 1VA8A 3K1RA 4IC6A 2KBSA 1X45A 2CSJA 4NMRA 4NXPA 2FE5A 3PS4A 2EV8A 2KJPA 1X6DA 1N6FA 3KZDA 5FB8C 2PZDA 1L6OA 2M0UA 2LA8A 4R2ZA 2H2CA 4LMMA 1IU2A 2JOAA 2YUYA 1KEFA 2KRGA 3E17A 1QAVA 1N6DA 1OBXA 2P3WA 2YT7A 4NMPA 2ZPLA 5E1YA 2JILA 3HPKA 3KDKA 2KPKA 2PKTA 2MHOA 5HETA 4P0CA 1Y8TA 5HFFA 1YBOA 5EYZA 2EEJA 3GDUA 5B42A 4OEOA 4NXRA 2YTWA 1UJDA 2UZCA 3EGHC 1N7TA 3GABA 3R0HA 2AWXA 2K1ZA 3STJA 1P1EA 4JOFA 3O5NA 1X9ZA 2REYA 2OZFA 2EDPA 4YYXA 2F0AA 2LC6A 2PKUA 4JOHA 1FC9A 4UU5A 1TQ3A 3TSWA 2M0VA 2KPLA 1Z86A 3PV2A 2JINA 3OU0A 3PV4A 3NFKA 3WKMA 2M0ZA 2VSVA 4GVCA 2DMZA 2H3MA 2HE2A 3GGEA 5B6LA 5D13A 1SOTA 4K6YA 4OEPA 2ZPMA 3R69A 2QKTA 2G2LA 1WHAA 1UM7A 2VRFA 2X7ZA 2H3LA 1GM1A 3DJ1A 4JJ0A 2EEGA 2AWWA 1XZ9A 2K20A 2OCSA 2V90A 2EEIA 1TE0A 1UEQA 3ZRTA 4E34A 1VCWA 2H2BA 2QG1A 1X5NA 4Q3HA 3PDVA 2AWUA 1BE9A 2VWRA 2PA1A 1UFXA 2KL1A 2LC7A 5HFCA 1TP3A 2PNTA 2KV8A 4Q2PA 3JXTA 2FN5A 4NMOA 3TSZA 1WI4A 1UEWA 1I92A 2OSGA 2FCFA 2I04A 2CSSA
chains in the Genus database with same CATH topology
3SOEA 2RCZA 4NMSA 3HVQC 1U37A 2BYGA 2W7RA 2PDZA 1V6BA 3DJAA 2GEFA 4KFWA 1RGWA 4JOGA 5HF4A 1QAVB 1WFGA 2KOHA 1VB7A 2YT8A 1MFGA 2DAZA 5GLJA 1U3BA 2EGOA 2W4FA 2I0LA 3MH7A 4WYTA 3GJ9A 1KY9A 1D5GA 2DC2A 1UJUA 2YUBA 2G5MB 1VAEA 1UF1A 3SUZA 1V62A 4NXQA 4OAJA 1V1TA 3ID2A 4H11A 2O2TA 1GQ4A 4GHNA 2KYLA 3QO6A 4JOPA 4Q6SA 1X5RA 2V1WA 5HF1A 3PDZA 5HEDA 1QLCA 4Q2OA 2OGPA 4JOKA 2M0TA 5F67A 1Q3OA 5G1EA 1RY4A 2DLUA 1WHDA 1OBYA 1I16A 2KOMA 4JJ3A 2JIKA 1NF3C 4E3BA 2OMJA 3LNXA 1W9OA 4AMHA 3SFJA 2R4HA 4YDPA 4KFVA 1Y7NA 1FC6A 1MFLA 3AXAA 3O46A 5DTHA 2DKRA 4G69A 3QGLA 5EZ0A 4Z8JA 4MPAA 5I7ZA 5E6PB 1RZXA 3EGGC 2L4SA 3RL7A 5HEYA 2EGKA 3SHUA 2JWEA 3GDSA 1V5LA 4Z33A 1KWAA 2QKVA 1Z87A 1X8SA 1LCYA 3KZEA 5G1DA 3NGHA 4REYA 3RLEA 1PDRA 4FLNA 1K32A 4K72A 2I6VA 3QIKA 5ILBA 2L4TA 1WFVA 2DM8A 4Q2NA 3CBYA 1UHPA 3I1EA 1WIFA 1P1DA 3CYYA 2QBWA 1TP5A 2AINA 2OPGA 1RGRA 4JOJA 1FC7A 3K50A 4NMTA 2EAQA 2KJDA 4N6XA 1WJLA 1UITA 1GQ5A 3CBXA 4O06A 3QDOA 3CBZA 3NFLA 2IWOA 4XHVA 1WI2A 4L8NA 4E35A 5JXBA 2HGAA 3MH6A 3QJMA 1ZOKA 4Q2QA 1OZIA 3K82A 3VQFA 1Q7XA 3TMHA 2I4SA 3QJNA 3QE1A 1MC7A 4RI0A 5E21A 3KHFA 2DB5A 1SOZA 1WG6A 2GZVA 4EDJA 1UJVA 1NTEA 2EJYA 2IWQA 5HFEA 2EDVA 5GNDA 2OQSA 1FCFA 5HFDA 3I18A 3CH8A 3GCOA 4JL7A 2JSNA 2Z9IA 2EXGA 3OTPA 1WF7A 3TSVA 4PQWA 5F3XA 1BFEA 2QT5A 4WYUA 1U39A 4JORA 3CS0A 3L4FD 2D90A 2HE4A 2KOJA 3B76A 1WF8A 2KAWA 5HFBA 2Z17A 2DLSA 4JOEA 4NMQA 5A2PA 1Q3PA 4UU6A 3R68A 2VPHA 2R3YA 1V5QA 2VSPA 2ENOA 3MH4A 3RL8A 1G9OA 5E11A 3GDVA 2KJKA 2DJTA 2D92A 2EHRA 2LOBA 4GVDA 1N99A 2E7KA 2IWPA 3FY5A 3PV5A 4P2AB 1OBZA 2D8IA 1IU0A 2OS6A 1N6EA 1N7FA 3BPUA 5H3JA 1VJ6A 3GSLA 4F8KA 2RRMA 5HJ1A 3HPMA 5HDYA 5IL9A 4NMVA 3I4WA 3SHWA 2IWNA 4NNMA 1W9EA 5E22A 4Q6HA 2L97A 3KDGA 2EEHA 1UEPA 2Q9VA 3NCVA 3ID3A 3ID4A 3WKLA 2WL7A 2QKUA 2KG2A 3CC0A 1QAUA 2EDZA 1X5QA 1IHJA 3DIWA 3VQGA 1ZUBA 1N7EA 2EGNA 3LNYA 4FGMA 2CS5A 5FHTA 2JXOA 2F5YA 2M3MA 2Q3GA 3ID1A 1T2MA 2I0IA 2I1NA 1R6JA 3GCNA 1UM1A 4K78A 5HEBA 2KA9A 1B8QA 1UEZA 4K75A 2LUIA 2MX6A 4HOPB 3DJ3A 2KQFA 2JREA 1U38A 1WH1A 4NNLA 1W9QA 3DORA 1M5ZA 2FNEA 4HOPA 2M10A 2VZ5A 4K76A 1VA8A 3K1RA 4IC6A 2KBSA 1X45A 2CSJA 4NMRA 4NXPA 2FE5A 3PS4A 2EV8A 2KJPA 1X6DA 1N6FA 3KZDA 5FB8C 2PZDA 1L6OA 2M0UA 2LA8A 4R2ZA 2H2CA 4LMMA 1IU2A 2JOAA 2YUYA 1KEFA 2KRGA 3E17A 1QAVA 1N6DA 1OBXA 2P3WA 2YT7A 4NMPA 2ZPLA 5E1YA 2JILA 3HPKA 3KDKA 2KPKA 2PKTA 2MHOA 5HETA 4P0CA 1Y8TA 5HFFA 1YBOA 5EYZA 2EEJA 3GDUA 5B42A 4OEOA 4NXRA 2YTWA 1UJDA 2UZCA 3EGHC 1N7TA 3GABA 3R0HA 2AWXA 2K1ZA 3STJA 1P1EA 4JOFA 3O5NA 1X9ZA 2REYA 2OZFA 2EDPA 4YYXA 2F0AA 2LC6A 2PKUA 4JOHA 1FC9A 4UU5A 1TQ3A 3TSWA 2M0VA 2KPLA 1Z86A 3PV2A 2JINA 3OU0A 3PV4A 3NFKA 3WKMA 2M0ZA 2VSVA 4GVCA 2DMZA 2H3MA 2HE2A 3GGEA 5B6LA 5D13A 1SOTA 4K6YA 4OEPA 2ZPMA 3R69A 2QKTA 2G2LA 1WHAA 1UM7A 2VRFA 2X7ZA 2H3LA 1GM1A 3DJ1A 4JJ0A 2EEGA 2AWWA 1XZ9A 2K20A 2OCSA 2V90A 2EEIA 1TE0A 1UEQA 3ZRTA 4E34A 1VCWA 2H2BA 2QG1A 1X5NA 4Q3HA 3PDVA 2AWUA 1BE9A 2VWRA 2PA1A 1UFXA 2KL1A 2LC7A 5HFCA 1TP3A 2PNTA 2KV8A 4Q2PA 3JXTA 2FN5A 4NMOA 3TSZA 1WI4A 1UEWA 1I92A 2OSGA 2FCFA 2I04A 2CSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOE A;  2RCZ A;  4NMS A;  3HVQ C;  1U37 A;  2BYG A;  2W7R A;  2PDZ A;  1V6B A;  3DJA A;  4KFW A;  1RGW A;  4JOG A;  5HF4 A;  1QAV B;  1WFG A;  2KOH A;  1VB7 A;  2YT8 A;  1MFG A;  2DAZ A;  5GLJ A;  1U3B A;  2EGO A;  2W4F A;  2I0L A;  3MH7 A;  4WYT A;  3GJ9 A;  1KY9 A;  1D5G A;  2DC2 A;  1UJU A;  2YUB A;  2G5M B;  1VAE A;  1UF1 A;  3SUZ A;  1V62 A;  4NXQ A;  4OAJ A;  1V1T A;  3ID2 A;  4H11 A;  2O2T A;  1GQ4 A;  4GHN A;  2KYL A;  3QO6 A;  4JOP A;  4Q6S A;  1X5R A;  2V1W A;  5HF1 A;  3PDZ A;  5HED A;  1QLC A;  4Q2O A;  2OGP A;  4JOK A;  2M0T A;  5F67 A;  1Q3O A;  5G1E A;  1RY4 A;  2DLU A;  1WHD A;  1OBY A;  1I16 A;  2KOM A;  2JIK A;  1NF3 C;  4E3B A;  2OMJ A;  3LNX A;  1W9O A;  4AMH A;  3SFJ A;  2R4H A;  4YDP A;  4KFV A;  1Y7N A;  1FC6 A;  1MFL A;  3AXA A;  3O46 A;  5DTH A;  2DKR A;  4G69 A;  3QGL A;  5EZ0 A;  4Z8J A;  4MPA A;  5I7Z A;  5E6P B;  1RZX A;  3EGG C;  2L4S A;  3RL7 A;  5HEY A;  2EGK A;  3SHU A;  2JWE A;  3GDS A;  1V5L A;  4Z33 A;  1KWA A;  2QKV A;  1Z87 A;  1X8S A;  1LCY A;  3KZE A;  5G1D A;  3NGH A;  4REY A;  3RLE A;  1PDR A;  4K72 A;  1K32 A;  2I6V A;  3QIK A;  2L4T A;  1WFV A;  2DM8 A;  4Q2N A;  3CBY A;  1UHP A;  3I1E A;  1WIF A;  1P1D A;  3CYY A;  2QBW A;  1TP5 A;  2AIN A;  2OPG A;  1RGR A;  4JOJ A;  1FC7 A;  3K50 A;  4NMT A;  2EAQ A;  2KJD A;  4N6X A;  1WJL A;  1UIT A;  1GQ5 A;  3CBX A;  4O06 A;  3QDO A;  3CBZ A;  3NFL A;  2IWO A;  4XHV A;  1WI2 A;  4L8N A;  4E35 A;  5JXB A;  2HGA A;  3MH6 A;  3QJM A;  1ZOK A;  4Q2Q A;  1OZI A;  3K82 A;  3VQF A;  1Q7X A;  3TMH A;  2I4S A;  3QJN A;  3QE1 A;  1MC7 A;  4RI0 A;  5E21 A;  3KHF A;  2DB5 A;  1SOZ A;  1WG6 A;  2GZV A;  4EDJ A;  1UJV A;  1NTE A;  2EJY A;  2IWQ A;  5HFE A;  2EDV A;  5GND A;  2OQS A;  1FCF A;  5HFD A;  3I18 A;  3CH8 A;  3GCO A;  4JL7 A;  2Z9I A;  2EXG A;  3OTP A;  1WF7 A;  3TSV A;  4PQW A;  5F3X A;  1BFE A;  2QT5 A;  4WYU A;  1U39 A;  4JOR A;  3CS0 A;  3L4F D;  2D90 A;  2HE4 A;  2KOJ A;  3B76 A;  1WF8 A;  2KAW A;  5HFB A;  2Z17 A;  2DLS A;  4JOE A;  4NMQ A;  5A2P A;  1Q3P A;  4UU6 A;  3R68 A;  2VPH A;  2R3Y A;  1V5Q A;  2VSP A;  2ENO A;  3MH4 A;  3RL8 A;  1G9O A;  5E11 A;  3GDV A;  2KJK A;  2DJT A;  2D92 A;  2EHR A;  2LOB A;  4GVD A;  1N99 A;  2E7K A;  2IWP A;  3FY5 A;  3PV5 A;  4P2A B;  1OBZ A;  2D8I A;  1IU0 A;  2OS6 A;  1N6E A;  1N7F A;  3BPU A;  5H3J A;  1VJ6 A;  3GSL A;  4F8K A;  2RRM A;  5HJ1 A;  3HPM A;  5HDY A;  4NMV A;  3I4W A;  3SHW A;  2IWN A;  4NNM A;  1W9E A;  5E22 A;  4Q6H A;  2L97 A;  2EEH A;  1UEP A;  2Q9V A;  3ID3 A;  3ID4 A;  3WKL A;  2WL7 A;  2QKU A;  2KG2 A;  3CC0 A;  1QAU A;  2EDZ A;  1X5Q A;  1IHJ A;  3DIW A;  3VQG A;  1ZUB A;  1N7E A;  2EGN A;  3LNY A;  4FGM A;  2CS5 A;  5FHT A;  2JXO A;  2F5Y A;  2M3M A;  2Q3G A;  3ID1 A;  1T2M A;  2I0I A;  2I1N A;  1R6J A;  3GCN A;  1UM1 A;  4K78 A;  5HEB A;  2KA9 A;  1B8Q A;  1UEZ A;  4K75 A;  2LUI A;  2MX6 A;  4HOP B;  3DJ3 A;  2KQF A;  2JRE A;  1U38 A;  1WH1 A;  4NNL A;  1W9Q A;  3DOR A;  1M5Z A;  2FNE A;  4HOP A;  2M10 A;  2VZ5 A;  4K76 A;  1VA8 A;  3K1R A;  4IC6 A;  2KBS A;  1X45 A;  2CSJ A;  4NMR A;  4NXP A;  2FE5 A;  3PS4 A;  2EV8 A;  2KJP A;  1X6D A;  1N6F A;  3KZD A;  5FB8 C;  2PZD A;  1L6O A;  2M0U A;  2LA8 A;  4R2Z A;  2H2C A;  4LMM A;  1IU2 A;  2JOA A;  2YUY A;  1KEF A;  2KRG A;  3E17 A;  1QAV A;  1N6D A;  1OBX A;  2P3W A;  2YT7 A;  4NMP A;  2ZPL A;  5E1Y A;  2JIL A;  3HPK A;  2KPK A;  2PKT A;  2MHO A;  5HET A;  4P0C A;  1Y8T A;  5HFF A;  1YBO A;  5EYZ A;  2EEJ A;  3GDU A;  4OEO A;  4NXR A;  2YTW A;  1UJD A;  2UZC A;  3EGH C;  1N7T A;  3R0H A;  2AWX A;  2K1Z A;  3STJ A;  1P1E A;  4JOF A;  3O5N A;  2REY A;  2OZF A;  2EDP A;  4YYX A;  2F0A A;  2LC6 A;  2PKU A;  4JOH A;  1FC9 A;  4UU5 A;  1TQ3 A;  3TSW A;  2M0V A;  2KPL A;  1Z86 A;  3PV2 A;  2JIN A;  3OU0 A;  3PV4 A;  3NFK A;  3WKM A;  2M0Z A;  2VSV A;  4GVC A;  2DMZ A;  2H3M A;  2HE2 A;  3GGE A;  5B6L A;  5D13 A;  1SOT A;  4K6Y A;  4OEP A;  2ZPM A;  3R69 A;  2QKT A;  2G2L A;  1WHA A;  1UM7 A;  2VRF A;  2X7Z A;  2H3L A;  1GM1 A;  3DJ1 A;  2EEG A;  2AWW A;  1XZ9 A;  2K20 A;  2OCS A;  2V90 A;  2EEI A;  1TE0 A;  1UEQ A;  3ZRT A;  4E34 A;  1VCW A;  2H2B A;  2QG1 A;  1X5N A;  4Q3H A;  3PDV A;  2AWU A;  1BE9 A;  2VWR A;  2PA1 A;  1UFX A;  2KL1 A;  2LC7 A;  5HFC A;  1TP3 A;  2PNT A;  2KV8 A;  4Q2P A;  3JXT A;  2FN5 A;  4NMO A;  3TSZ A;  1WI4 A;  1UEW A;  1I92 A;  2OSG A;  2FCF A;  2I04 A;  2CSS A; 
#chains in the Genus database with same CATH topology
 3SOE A;  2RCZ A;  4NMS A;  3HVQ C;  1U37 A;  2BYG A;  2W7R A;  2PDZ A;  1V6B A;  3DJA A;  2GEF A;  4KFW A;  1RGW A;  4JOG A;  5HF4 A;  1QAV B;  1WFG A;  2KOH A;  1VB7 A;  2YT8 A;  1MFG A;  2DAZ A;  5GLJ A;  1U3B A;  2EGO A;  2W4F A;  2I0L A;  3MH7 A;  4WYT A;  3GJ9 A;  1KY9 A;  1D5G A;  2DC2 A;  1UJU A;  2YUB A;  2G5M B;  1VAE A;  1UF1 A;  3SUZ A;  1V62 A;  4NXQ A;  4OAJ A;  1V1T A;  3ID2 A;  4H11 A;  2O2T A;  1GQ4 A;  4GHN A;  2KYL A;  3QO6 A;  4JOP A;  4Q6S A;  1X5R A;  2V1W A;  5HF1 A;  3PDZ A;  5HED A;  1QLC A;  4Q2O A;  2OGP A;  4JOK A;  2M0T A;  5F67 A;  1Q3O A;  5G1E A;  1RY4 A;  2DLU A;  1WHD A;  1OBY A;  1I16 A;  2KOM A;  4JJ3 A;  2JIK A;  1NF3 C;  4E3B A;  2OMJ A;  3LNX A;  1W9O A;  4AMH A;  3SFJ A;  2R4H A;  4YDP A;  4KFV A;  1Y7N A;  1FC6 A;  1MFL A;  3AXA A;  3O46 A;  5DTH A;  2DKR A;  4G69 A;  3QGL A;  5EZ0 A;  4Z8J A;  4MPA A;  5I7Z A;  5E6P B;  1RZX A;  3EGG C;  2L4S A;  3RL7 A;  5HEY A;  2EGK A;  3SHU A;  2JWE A;  3GDS A;  1V5L A;  4Z33 A;  1KWA A;  2QKV A;  1Z87 A;  1X8S A;  1LCY A;  3KZE A;  5G1D A;  3NGH A;  4REY A;  3RLE A;  1PDR A;  4FLN A;  1K32 A;  4K72 A;  2I6V A;  3QIK A;  5ILB A;  2L4T A;  1WFV A;  2DM8 A;  4Q2N A;  3CBY A;  1UHP A;  3I1E A;  1WIF A;  1P1D A;  3CYY A;  2QBW A;  1TP5 A;  2AIN A;  2OPG A;  1RGR A;  4JOJ A;  1FC7 A;  3K50 A;  4NMT A;  2EAQ A;  2KJD A;  4N6X A;  1WJL A;  1UIT A;  1GQ5 A;  3CBX A;  4O06 A;  3QDO A;  3CBZ A;  3NFL A;  2IWO A;  4XHV A;  1WI2 A;  4L8N A;  4E35 A;  5JXB A;  2HGA A;  3MH6 A;  3QJM A;  1ZOK A;  4Q2Q A;  1OZI A;  3K82 A;  3VQF A;  1Q7X A;  3TMH A;  2I4S A;  3QJN A;  3QE1 A;  1MC7 A;  4RI0 A;  5E21 A;  3KHF A;  2DB5 A;  1SOZ A;  1WG6 A;  2GZV A;  4EDJ A;  1UJV A;  1NTE A;  2EJY A;  2IWQ A;  5HFE A;  2EDV A;  5GND A;  2OQS A;  1FCF A;  5HFD A;  3I18 A;  3CH8 A;  3GCO A;  4JL7 A;  2JSN A;  2Z9I A;  2EXG A;  3OTP A;  1WF7 A;  3TSV A;  4PQW A;  5F3X A;  1BFE A;  2QT5 A;  4WYU A;  1U39 A;  4JOR A;  3CS0 A;  3L4F D;  2D90 A;  2HE4 A;  2KOJ A;  3B76 A;  1WF8 A;  2KAW A;  5HFB A;  2Z17 A;  2DLS A;  4JOE A;  4NMQ A;  5A2P A;  1Q3P A;  4UU6 A;  3R68 A;  2VPH A;  2R3Y A;  1V5Q A;  2VSP A;  2ENO A;  3MH4 A;  3RL8 A;  1G9O A;  5E11 A;  3GDV A;  2KJK A;  2DJT A;  2D92 A;  2EHR A;  2LOB A;  4GVD A;  1N99 A;  2E7K A;  2IWP A;  3FY5 A;  3PV5 A;  4P2A B;  1OBZ A;  2D8I A;  1IU0 A;  2OS6 A;  1N6E A;  1N7F A;  3BPU A;  5H3J A;  1VJ6 A;  3GSL A;  4F8K A;  2RRM A;  5HJ1 A;  3HPM A;  5HDY A;  5IL9 A;  4NMV A;  3I4W A;  3SHW A;  2IWN A;  4NNM A;  1W9E A;  5E22 A;  4Q6H A;  2L97 A;  3KDG A;  2EEH A;  1UEP A;  2Q9V A;  3NCV A;  3ID3 A;  3ID4 A;  3WKL A;  2WL7 A;  2QKU A;  2KG2 A;  3CC0 A;  1QAU A;  2EDZ A;  1X5Q A;  1IHJ A;  3DIW A;  3VQG A;  1ZUB A;  1N7E A;  2EGN A;  3LNY A;  4FGM A;  2CS5 A;  5FHT A;  2JXO A;  2F5Y A;  2M3M A;  2Q3G A;  3ID1 A;  1T2M A;  2I0I A;  2I1N A;  1R6J A;  3GCN A;  1UM1 A;  4K78 A;  5HEB A;  2KA9 A;  1B8Q A;  1UEZ A;  4K75 A;  2LUI A;  2MX6 A;  4HOP B;  3DJ3 A;  2KQF A;  2JRE A;  1U38 A;  1WH1 A;  4NNL A;  1W9Q A;  3DOR A;  1M5Z A;  2FNE A;  4HOP A;  2M10 A;  2VZ5 A;  4K76 A;  1VA8 A;  3K1R A;  4IC6 A;  2KBS A;  1X45 A;  2CSJ A;  4NMR A;  4NXP A;  2FE5 A;  3PS4 A;  2EV8 A;  2KJP A;  1X6D A;  1N6F A;  3KZD A;  5FB8 C;  2PZD A;  1L6O A;  2M0U A;  2LA8 A;  4R2Z A;  2H2C A;  4LMM A;  1IU2 A;  2JOA A;  2YUY A;  1KEF A;  2KRG A;  3E17 A;  1QAV A;  1N6D A;  1OBX A;  2P3W A;  2YT7 A;  4NMP A;  2ZPL A;  5E1Y A;  2JIL A;  3HPK A;  3KDK A;  2KPK A;  2PKT A;  2MHO A;  5HET A;  4P0C A;  1Y8T A;  5HFF A;  1YBO A;  5EYZ A;  2EEJ A;  3GDU A;  5B42 A;  4OEO A;  4NXR A;  2YTW A;  1UJD A;  2UZC A;  3EGH C;  1N7T A;  3GAB A;  3R0H A;  2AWX A;  2K1Z A;  3STJ A;  1P1E A;  4JOF A;  3O5N A;  1X9Z A;  2REY A;  2OZF A;  2EDP A;  4YYX A;  2F0A A;  2LC6 A;  2PKU A;  4JOH A;  1FC9 A;  4UU5 A;  1TQ3 A;  3TSW A;  2M0V A;  2KPL A;  1Z86 A;  3PV2 A;  2JIN A;  3OU0 A;  3PV4 A;  3NFK A;  3WKM A;  2M0Z A;  2VSV A;  4GVC A;  2DMZ A;  2H3M A;  2HE2 A;  3GGE A;  5B6L A;  5D13 A;  1SOT A;  4K6Y A;  4OEP A;  2ZPM A;  3R69 A;  2QKT A;  2G2L A;  1WHA A;  1UM7 A;  2VRF A;  2X7Z A;  2H3L A;  1GM1 A;  3DJ1 A;  4JJ0 A;  2EEG A;  2AWW A;  1XZ9 A;  2K20 A;  2OCS A;  2V90 A;  2EEI A;  1TE0 A;  1UEQ A;  3ZRT A;  4E34 A;  1VCW A;  2H2B A;  2QG1 A;  1X5N A;  4Q3H A;  3PDV A;  2AWU A;  1BE9 A;  2VWR A;  2PA1 A;  1UFX A;  2KL1 A;  2LC7 A;  5HFC A;  1TP3 A;  2PNT A;  2KV8 A;  4Q2P A;  3JXT A;  2FN5 A;  4NMO A;  3TSZ A;  1WI4 A;  1UEW A;  1I92 A;  2OSG A;  2FCF A;  2I04 A;  2CSS A; 
#chains in the Genus database with same CATH homology
 3SOE A;  2RCZ A;  4NMS A;  3HVQ C;  1U37 A;  2BYG A;  2W7R A;  2PDZ A;  1V6B A;  3DJA A;  2GEF A;  4KFW A;  1RGW A;  4JOG A;  5HF4 A;  1QAV B;  1WFG A;  2KOH A;  1VB7 A;  2YT8 A;  1MFG A;  2DAZ A;  5GLJ A;  1U3B A;  2EGO A;  2W4F A;  2I0L A;  3MH7 A;  4WYT A;  3GJ9 A;  1KY9 A;  1D5G A;  2DC2 A;  1UJU A;  2YUB A;  2G5M B;  1VAE A;  1UF1 A;  3SUZ A;  1V62 A;  4NXQ A;  4OAJ A;  1V1T A;  3ID2 A;  4H11 A;  2O2T A;  1GQ4 A;  4GHN A;  2KYL A;  3QO6 A;  4JOP A;  4Q6S A;  1X5R A;  2V1W A;  5HF1 A;  3PDZ A;  5HED A;  1QLC A;  4Q2O A;  2OGP A;  4JOK A;  2M0T A;  5F67 A;  1Q3O A;  5G1E A;  1RY4 A;  2DLU A;  1WHD A;  1OBY A;  1I16 A;  2KOM A;  4JJ3 A;  2JIK A;  1NF3 C;  4E3B A;  2OMJ A;  3LNX A;  1W9O A;  4AMH A;  3SFJ A;  2R4H A;  4YDP A;  4KFV A;  1Y7N A;  1FC6 A;  1MFL A;  3AXA A;  3O46 A;  5DTH A;  2DKR A;  4G69 A;  3QGL A;  5EZ0 A;  4Z8J A;  4MPA A;  5I7Z A;  5E6P B;  1RZX A;  3EGG C;  2L4S A;  3RL7 A;  5HEY A;  2EGK A;  3SHU A;  2JWE A;  3GDS A;  1V5L A;  4Z33 A;  1KWA A;  2QKV A;  1Z87 A;  1X8S A;  1LCY A;  3KZE A;  5G1D A;  3NGH A;  4REY A;  3RLE A;  1PDR A;  4FLN A;  1K32 A;  4K72 A;  2I6V A;  3QIK A;  5ILB A;  2L4T A;  1WFV A;  2DM8 A;  4Q2N A;  3CBY A;  1UHP A;  3I1E A;  1WIF A;  1P1D A;  3CYY A;  2QBW A;  1TP5 A;  2AIN A;  2OPG A;  1RGR A;  4JOJ A;  1FC7 A;  3K50 A;  4NMT A;  2EAQ A;  2KJD A;  4N6X A;  1WJL A;  1UIT A;  1GQ5 A;  3CBX A;  4O06 A;  3QDO A;  3CBZ A;  3NFL A;  2IWO A;  4XHV A;  1WI2 A;  4L8N A;  4E35 A;  5JXB A;  2HGA A;  3MH6 A;  3QJM A;  1ZOK A;  4Q2Q A;  1OZI A;  3K82 A;  3VQF A;  1Q7X A;  3TMH A;  2I4S A;  3QJN A;  3QE1 A;  1MC7 A;  4RI0 A;  5E21 A;  3KHF A;  2DB5 A;  1SOZ A;  1WG6 A;  2GZV A;  4EDJ A;  1UJV A;  1NTE A;  2EJY A;  2IWQ A;  5HFE A;  2EDV A;  5GND A;  2OQS A;  1FCF A;  5HFD A;  3I18 A;  3CH8 A;  3GCO A;  4JL7 A;  2JSN A;  2Z9I A;  2EXG A;  3OTP A;  1WF7 A;  3TSV A;  4PQW A;  5F3X A;  1BFE A;  2QT5 A;  4WYU A;  1U39 A;  4JOR A;  3CS0 A;  3L4F D;  2D90 A;  2HE4 A;  2KOJ A;  3B76 A;  1WF8 A;  2KAW A;  5HFB A;  2Z17 A;  2DLS A;  4JOE A;  4NMQ A;  5A2P A;  1Q3P A;  4UU6 A;  3R68 A;  2VPH A;  2R3Y A;  1V5Q A;  2VSP A;  2ENO A;  3MH4 A;  3RL8 A;  1G9O A;  5E11 A;  3GDV A;  2KJK A;  2DJT A;  2D92 A;  2EHR A;  2LOB A;  4GVD A;  1N99 A;  2E7K A;  2IWP A;  3FY5 A;  3PV5 A;  4P2A B;  1OBZ A;  2D8I A;  1IU0 A;  2OS6 A;  1N6E A;  1N7F A;  3BPU A;  5H3J A;  1VJ6 A;  3GSL A;  4F8K A;  2RRM A;  5HJ1 A;  3HPM A;  5HDY A;  5IL9 A;  4NMV A;  3I4W A;  3SHW A;  2IWN A;  4NNM A;  1W9E A;  5E22 A;  4Q6H A;  2L97 A;  3KDG A;  2EEH A;  1UEP A;  2Q9V A;  3NCV A;  3ID3 A;  3ID4 A;  3WKL A;  2WL7 A;  2QKU A;  2KG2 A;  3CC0 A;  1QAU A;  2EDZ A;  1X5Q A;  1IHJ A;  3DIW A;  3VQG A;  1ZUB A;  1N7E A;  2EGN A;  3LNY A;  4FGM A;  2CS5 A;  5FHT A;  2JXO A;  2F5Y A;  2M3M A;  2Q3G A;  3ID1 A;  1T2M A;  2I0I A;  2I1N A;  1R6J A;  3GCN A;  1UM1 A;  4K78 A;  5HEB A;  2KA9 A;  1B8Q A;  1UEZ A;  4K75 A;  2LUI A;  2MX6 A;  4HOP B;  3DJ3 A;  2KQF A;  2JRE A;  1U38 A;  1WH1 A;  4NNL A;  1W9Q A;  3DOR A;  1M5Z A;  2FNE A;  4HOP A;  2M10 A;  2VZ5 A;  4K76 A;  1VA8 A;  3K1R A;  4IC6 A;  2KBS A;  1X45 A;  2CSJ A;  4NMR A;  4NXP A;  2FE5 A;  3PS4 A;  2EV8 A;  2KJP A;  1X6D A;  1N6F A;  3KZD A;  5FB8 C;  2PZD A;  1L6O A;  2M0U A;  2LA8 A;  4R2Z A;  2H2C A;  4LMM A;  1IU2 A;  2JOA A;  2YUY A;  1KEF A;  2KRG A;  3E17 A;  1QAV A;  1N6D A;  1OBX A;  2P3W A;  2YT7 A;  4NMP A;  2ZPL A;  5E1Y A;  2JIL A;  3HPK A;  3KDK A;  2KPK A;  2PKT A;  2MHO A;  5HET A;  4P0C A;  1Y8T A;  5HFF A;  1YBO A;  5EYZ A;  2EEJ A;  3GDU A;  5B42 A;  4OEO A;  4NXR A;  2YTW A;  1UJD A;  2UZC A;  3EGH C;  1N7T A;  3GAB A;  3R0H A;  2AWX A;  2K1Z A;  3STJ A;  1P1E A;  4JOF A;  3O5N A;  1X9Z A;  2REY A;  2OZF A;  2EDP A;  4YYX A;  2F0A A;  2LC6 A;  2PKU A;  4JOH A;  1FC9 A;  4UU5 A;  1TQ3 A;  3TSW A;  2M0V A;  2KPL A;  1Z86 A;  3PV2 A;  2JIN A;  3OU0 A;  3PV4 A;  3NFK A;  3WKM A;  2M0Z A;  2VSV A;  4GVC A;  2DMZ A;  2H3M A;  2HE2 A;  3GGE A;  5B6L A;  5D13 A;  1SOT A;  4K6Y A;  4OEP A;  2ZPM A;  3R69 A;  2QKT A;  2G2L A;  1WHA A;  1UM7 A;  2VRF A;  2X7Z A;  2H3L A;  1GM1 A;  3DJ1 A;  4JJ0 A;  2EEG A;  2AWW A;  1XZ9 A;  2K20 A;  2OCS A;  2V90 A;  2EEI A;  1TE0 A;  1UEQ A;  3ZRT A;  4E34 A;  1VCW A;  2H2B A;  2QG1 A;  1X5N A;  4Q3H A;  3PDV A;  2AWU A;  1BE9 A;  2VWR A;  2PA1 A;  1UFX A;  2KL1 A;  2LC7 A;  5HFC A;  1TP3 A;  2PNT A;  2KV8 A;  4Q2P A;  3JXT A;  2FN5 A;  4NMO A;  3TSZ A;  1WI4 A;  1UEW A;  1I92 A;  2OSG A;  2FCF A;  2I04 A;  2CSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...