5EZ0A

Crystal structure of the ptpn4 pdz domain complexed with the pdz binding motif of the mitogen activated protein kinase p38gamma.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
90
Chain Sequence
PHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCGELMLLVRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase non-receptor type 4
publication title Molecular Basis of the Interaction of the Human Protein Tyrosine Phosphatase Non-receptor Type 4 (PTPN4) with the Mitogen-activated Protein Kinase p38 gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 90
sequence length 94
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5ez0A00
1K32A 5JXBA 1XZ9A 2O2TA 4PQWA 1Q3OA 2EEIA 2DJTA 4UU6A 5GLJA 3CBZA 1RGWA 4JOHA 2W7RA 4NMPA 3CC0A 2I6VA 1B8QA 1U38A 4Q2PA 2VZ5A 4HOPA 4Z8JA 1WHDA 1WF8A 3JXTA 2DMZA 1SOZA 3VQFA 1UJUA 2KBSA 2IWOA 3GGEA 4Q3HA 1X5RA 2M0VA 2VSPA 4KFVA 3TSVA 3EGHC 1P1DA 2DB5A 1WIFA 1WF7A 2KAWA 2G2LA 5HEDA 5EZ0A 1N7EA 2OSGA 2BYGA 1WI4A 1PDRA 2HE2A 2KOHA 5B6LA 3HPKA 5HDYA 1GM1A 4NMSA 1V62A 3NGHA 2FCFA 2IWQA 2Z17A 2CSJA 2ENOA 1X5NA 2GZVA 2LC7A 1Z87A 1SOTA 2JREA 4NXQA 5GNDA 1U39A 1WFGA 3QDOA 3GSLA 1OZIA 3GCNA 2REYA 2H3LA 2DLUA 2JIKA 2YT7A 3FY5A 4K72A 1T2MA 2IWPA 3R68A 5HFCA 4OEOA 2EDVA 2KPLA 1NTEA 3E17A 4P2AB 2WL7A 2V90A 3OTPA 4OEPA 1MC7A 2QBWA 3GDSA 5E6PB 1RY4A 3NFKA 1W9QA 2F0AA 1IU2A 2PNTA 1FC6A 5E1YA 4Q2QA 1N7FA 2Q3GA 1TQ3A 3KZDA 3BPUA 1KEFA 2MX6A 4NMVA 5EYZA 3ID2A 3I18A 1U3BA 5HETA 2EXGA 1X8SA 3ID4A 1Z86A 4GVDA 4K6YA 3TSWA 2DC2A 2VRFA 3RL8A 2FE5A 3TMHA 1V5QA 3QJNA 2L4SA 4NNLA 2QT5A 1WH1A 1KY9A 1FC9A 1GQ4A 3I1EA 1Q3PA 2OGPA 2PA1A 4G69A 1X5QA 1LCYA 2EDZA 1VCWA 4L8NA 5I7ZA 1OBZA 2KPKA 4JL7A 2RRMA 1U37A 1N6DA 2F5YA 4R2ZA 4REYA 3DJ3A 1UEWA 4LMMA 2EAQA 3DORA 4H11A 2D92A 2Z9IA 3WKMA 2YT8A 4NXRA 3ZRTA 5HJ1A 1RZXA 1WJLA 2EDPA 1ZOKA 1G9OA 3PDVA 4YYXA 3QO6A 2KJKA 1FC7A 1V6BA 2QKVA 3GCOA 3RL7A 4NNMA 1UITA 4N6XA 3SHUA 1UF1A 2JXOA 3MH4A 1Y8TA 3CH8A 2JOAA 4NXPA 5H3JA 5F3XA 3MH7A 1UFXA 3ID3A 1W9EA 2AWUA 4E34A 2EEJA 2OS6A 2Q9VA 1WHAA 3K1RA 4MPAA 1L6OA 5HFDA 4P0CA 2DM8A 2IWNA 1D5GA 2KYLA 5E11A 2DLSA 4OAJA 3ID1A 2I0LA 1MFGA 2MHOA 2CSSA 3SFJA 3SHWA 4FGMA 2FNEA 3VQGA 5HEYA 2QG1A 3R69A 3L4FD 1VJ6A 2H2BA 2K20A 5F67A 2PKTA 2M0ZA 3GDVA 3K82A 1QAVB 1OBYA 5D13A 2RCZA 3HVQC 2KOMA 1MFLA 1VAEA 1UEQA 2KJDA 1IHJA 2H2CA 5FB8C 5HFFA 3K50A 2D8IA 5HFEA 2FN5A 2P3WA 2KA9A 3LNYA 2QKTA 4JOGA 1I92A 2LUIA 4NMQA 4YDPA 3PV4A 2EGNA 4RI0A 2AWWA 5E22A 1UJVA 2OPGA 1RGRA 3CBYA 2EEHA 3QIKA 5FHTA 2OCSA 4JORA 3KZEA 3PS4A 4K75A 4Q6HA 1GQ5A 1UHPA 1WI2A 4Z33A 3QJMA 2LC6A 3AXAA 2EGKA 2JINA 1TP3A 2M10A 2VWRA 2JILA 2DAZA 2M0UA 2ZPLA 3R0HA 5HF4A 1Q7XA 1VB7A 1V5LA 4HOPB 2W4FA 2PDZA 2PKUA 1UM7A 2G5MB 1UEZA 1N7TA 4IC6A 4JOKA 2KV8A 2KJPA 1UM1A 2H3MA 2HGAA 5G1DA 1TP5A 1VA8A 2VSVA 4NMOA 1TE0A 4NMRA 2OZFA 3EGGC 1M5ZA 2DKRA 2OQSA 4GVCA 4K76A 2R4HA 3STJA 2X7ZA 2KRGA 3LNXA 4UU5A 1KWAA 2L4TA 1WFVA 2L97A 3PV2A 2JWEA 2EJYA 3PDZA 1BE9A 3PV5A 1QLCA 4Q2OA 2EHRA 1BFEA 2KQFA 2I0IA 3DJ1A 4WYUA 2EEGA 4Q2NA 4EDJA 1OBXA 3QE1A 2D90A 5HFBA 5HF1A 2KOJA 1V1TA 4Q6SA 2I4SA 2M0TA 2M3MA 1W9OA 1FCFA 4JOEA 3CS0A 1R6JA 1QAUA 2LA8A 1X45A 4AMHA 2LOBA 2EGOA 3TSZA 3MH6A 3RLEA 3OU0A 2HE4A 3DIWA 3NFLA 3WKLA 4E3BA 2KL1A 4E35A 4JOJA 5G1EA 1UEPA 1P1EA 5HEBA 3CBXA 2KG2A 2OMJA 2QKUA 2E7KA 1WG6A 2YUYA 4NMTA 1YBOA 3KHFA 2V1WA 3DJAA 3QGLA 4KFWA 1N99A 2UZCA 1UJDA 3GDUA 2PZDA 1IU0A 2I04A 2ZPMA 3HPMA 4GHNA 3SUZA 5DTHA 1QAVA 4F8KA 1X6DA 2AINA 1N6FA 2EV8A 1N6EA 2YUBA 4JOPA 5E21A 4O06A 3O46A 4JOFA 4XHVA 2K1ZA 4WYTA 2R3YA 1ZUBA 1NF3C 3O5NA 3GJ9A 4K78A 5A2PA 3I4WA 3CYYA 2AWXA 1I16A 2YTWA 1Y7NA 3B76A 2CS5A 2VPHA 2I1NA 3SOEA
chains in the Genus database with same CATH superfamily
1K32A 5JXBA 1XZ9A 2O2TA 4PQWA 1Q3OA 2EEIA 2DJTA 4UU6A 5GLJA 3CBZA 1RGWA 4JOHA 2W7RA 4NMPA 3CC0A 2I6VA 1B8QA 1U38A 4Q2PA 2VZ5A 4HOPA 4Z8JA 1WHDA 1WF8A 3JXTA 2DMZA 1SOZA 3VQFA 1UJUA 2KBSA 2IWOA 3GGEA 4Q3HA 1X5RA 2M0VA 2VSPA 4KFVA 3TSVA 3EGHC 1P1DA 2DB5A 1WIFA 1WF7A 2KAWA 2G2LA 5HEDA 5EZ0A 1N7EA 2OSGA 2BYGA 1WI4A 1PDRA 2HE2A 2KOHA 3NCVA 5B6LA 3HPKA 5HDYA 1GM1A 4NMSA 1V62A 3NGHA 2FCFA 2IWQA 2Z17A 2CSJA 2ENOA 1X5NA 2GZVA 2LC7A 1Z87A 1SOTA 2JREA 4NXQA 5GNDA 1U39A 1WFGA 3QDOA 3GSLA 1OZIA 3GCNA 2REYA 2H3LA 2DLUA 2JIKA 2YT7A 3FY5A 4K72A 1T2MA 2IWPA 3R68A 5HFCA 4OEOA 2EDVA 2KPLA 1NTEA 3E17A 4P2AB 2WL7A 2V90A 3OTPA 4OEPA 1MC7A 2QBWA 3GDSA 5E6PB 2GEFA 1RY4A 3NFKA 2JSNA 1W9QA 2F0AA 1IU2A 2PNTA 1FC6A 5E1YA 3KDKA 4Q2QA 1N7FA 2Q3GA 1TQ3A 3KZDA 3BPUA 1KEFA 2MX6A 4NMVA 5EYZA 3ID2A 3I18A 1U3BA 5HETA 2EXGA 1X8SA 3ID4A 1Z86A 4GVDA 4K6YA 3TSWA 2DC2A 2VRFA 3RL8A 2FE5A 3TMHA 1V5QA 3QJNA 2L4SA 4NNLA 2QT5A 1WH1A 1KY9A 1FC9A 1GQ4A 3I1EA 1Q3PA 2OGPA 2PA1A 4G69A 1X5QA 1LCYA 2EDZA 1VCWA 4L8NA 5I7ZA 1OBZA 2KPKA 4JL7A 2RRMA 1U37A 3KDGA 1N6DA 2F5YA 4R2ZA 4REYA 3DJ3A 1UEWA 4LMMA 2EAQA 3DORA 4H11A 2D92A 2Z9IA 3WKMA 2YT8A 4NXRA 3ZRTA 5HJ1A 1RZXA 1WJLA 2EDPA 1ZOKA 1G9OA 3PDVA 4YYXA 3QO6A 2KJKA 1FC7A 1V6BA 2QKVA 3GCOA 3RL7A 4NNMA 1UITA 4N6XA 3SHUA 1UF1A 2JXOA 3MH4A 1Y8TA 1X9ZA 3CH8A 2JOAA 4NXPA 5H3JA 5F3XA 3MH7A 1UFXA 3ID3A 1W9EA 2AWUA 4E34A 2EEJA 2OS6A 2Q9VA 1WHAA 3K1RA 4JJ3A 4MPAA 1L6OA 5HFDA 4P0CA 2DM8A 2IWNA 1D5GA 2KYLA 5E11A 2DLSA 4OAJA 3ID1A 2I0LA 5IL9A 1MFGA 2MHOA 2CSSA 3SFJA 3SHWA 4FGMA 2FNEA 3VQGA 5HEYA 2QG1A 3R69A 3L4FD 1VJ6A 2H2BA 2K20A 5F67A 2PKTA 2M0ZA 3GDVA 3K82A 1QAVB 1OBYA 5D13A 2RCZA 3HVQC 2KOMA 1MFLA 1VAEA 1UEQA 2KJDA 1IHJA 2H2CA 5FB8C 5HFFA 3K50A 2D8IA 5HFEA 2FN5A 2P3WA 2KA9A 3LNYA 2QKTA 4JOGA 1I92A 2LUIA 4NMQA 4YDPA 3PV4A 2EGNA 4RI0A 2AWWA 5E22A 1UJVA 2OPGA 1RGRA 3CBYA 2EEHA 3QIKA 5FHTA 2OCSA 4JORA 3KZEA 3PS4A 4K75A 4Q6HA 1GQ5A 1UHPA 1WI2A 4Z33A 3QJMA 2LC6A 3AXAA 2EGKA 2JINA 1TP3A 2M10A 2VWRA 2JILA 2DAZA 2M0UA 2ZPLA 3R0HA 5HF4A 1Q7XA 1VB7A 1V5LA 4HOPB 2W4FA 2PDZA 2PKUA 1UM7A 2G5MB 1UEZA 1N7TA 4IC6A 4JOKA 2KV8A 2KJPA 1UM1A 2H3MA 2HGAA 5G1DA 1TP5A 1VA8A 2VSVA 4NMOA 1TE0A 4NMRA 2OZFA 3EGGC 1M5ZA 2DKRA 2OQSA 4GVCA 4K76A 2R4HA 3STJA 2X7ZA 2KRGA 3LNXA 4UU5A 1KWAA 2L4TA 1WFVA 2L97A 3PV2A 2JWEA 2EJYA 3PDZA 1BE9A 3PV5A 1QLCA 4Q2OA 2EHRA 1BFEA 2KQFA 2I0IA 3DJ1A 4WYUA 2EEGA 4Q2NA 4EDJA 1OBXA 3QE1A 2D90A 5HFBA 5HF1A 2KOJA 1V1TA 4Q6SA 2I4SA 2M0TA 2M3MA 1W9OA 1FCFA 4JOEA 3CS0A 1R6JA 1QAUA 2LA8A 1X45A 4AMHA 2LOBA 4JJ0A 2EGOA 3TSZA 3MH6A 3RLEA 3GABA 3OU0A 2HE4A 3DIWA 3NFLA 3WKLA 4E3BA 2KL1A 4E35A 4JOJA 5G1EA 1UEPA 1P1EA 5HEBA 3CBXA 2KG2A 2OMJA 2QKUA 5ILBA 2E7KA 1WG6A 2YUYA 4NMTA 1YBOA 3KHFA 2V1WA 3DJAA 3QGLA 4KFWA 1N99A 2UZCA 1UJDA 3GDUA 2PZDA 1IU0A 2I04A 2ZPMA 3HPMA 4GHNA 3SUZA 5DTHA 1QAVA 4F8KA 1X6DA 2AINA 1N6FA 2EV8A 1N6EA 2YUBA 4JOPA 5E21A 4O06A 3O46A 4JOFA 4XHVA 2K1ZA 4WYTA 2R3YA 1ZUBA 1NF3C 3O5NA 3GJ9A 4K78A 5A2PA 3I4WA 3CYYA 2AWXA 1I16A 5B42A 2YTWA 1Y7NA 4FLNA 3B76A 2CS5A 2VPHA 2I1NA 3SOEA
chains in the Genus database with same CATH topology
1K32A 5JXBA 1XZ9A 2O2TA 4PQWA 1Q3OA 2EEIA 2DJTA 4UU6A 5GLJA 3CBZA 1RGWA 4JOHA 2W7RA 4NMPA 3CC0A 2I6VA 1B8QA 1U38A 4Q2PA 2VZ5A 4HOPA 4Z8JA 1WHDA 1WF8A 3JXTA 2DMZA 1SOZA 3VQFA 1UJUA 2KBSA 2IWOA 3GGEA 4Q3HA 1X5RA 2M0VA 2VSPA 4KFVA 3TSVA 3EGHC 1P1DA 2DB5A 1WIFA 1WF7A 2KAWA 2G2LA 5HEDA 5EZ0A 1N7EA 2OSGA 2BYGA 1WI4A 1PDRA 2HE2A 2KOHA 3NCVA 5B6LA 3HPKA 5HDYA 1GM1A 4NMSA 1V62A 3NGHA 2FCFA 2IWQA 2Z17A 2CSJA 2ENOA 1X5NA 2GZVA 2LC7A 1Z87A 1SOTA 2JREA 4NXQA 5GNDA 1U39A 1WFGA 3QDOA 3GSLA 1OZIA 3GCNA 2REYA 2H3LA 2DLUA 2JIKA 2YT7A 3FY5A 4K72A 1T2MA 2IWPA 3R68A 5HFCA 4OEOA 2EDVA 2KPLA 1NTEA 3E17A 4P2AB 2WL7A 2V90A 3OTPA 4OEPA 1MC7A 2QBWA 3GDSA 5E6PB 2GEFA 1RY4A 3NFKA 2JSNA 1W9QA 2F0AA 1IU2A 2PNTA 1FC6A 5E1YA 3KDKA 4Q2QA 1N7FA 2Q3GA 1TQ3A 3KZDA 3BPUA 1KEFA 2MX6A 4NMVA 5EYZA 3ID2A 3I18A 1U3BA 5HETA 2EXGA 1X8SA 3ID4A 1Z86A 4GVDA 4K6YA 3TSWA 2DC2A 2VRFA 3RL8A 2FE5A 3TMHA 1V5QA 3QJNA 2L4SA 4NNLA 2QT5A 1WH1A 1KY9A 1FC9A 1GQ4A 3I1EA 1Q3PA 2OGPA 2PA1A 4G69A 1X5QA 1LCYA 2EDZA 1VCWA 4L8NA 5I7ZA 1OBZA 2KPKA 4JL7A 2RRMA 1U37A 3KDGA 1N6DA 2F5YA 4R2ZA 4REYA 3DJ3A 1UEWA 4LMMA 2EAQA 3DORA 4H11A 2D92A 2Z9IA 3WKMA 2YT8A 4NXRA 3ZRTA 5HJ1A 1RZXA 1WJLA 2EDPA 1ZOKA 1G9OA 3PDVA 4YYXA 3QO6A 2KJKA 1FC7A 1V6BA 2QKVA 3GCOA 3RL7A 4NNMA 1UITA 4N6XA 3SHUA 1UF1A 2JXOA 3MH4A 1Y8TA 1X9ZA 3CH8A 2JOAA 4NXPA 5H3JA 5F3XA 3MH7A 1UFXA 3ID3A 1W9EA 2AWUA 4E34A 2EEJA 2OS6A 2Q9VA 1WHAA 3K1RA 4JJ3A 4MPAA 1L6OA 5HFDA 4P0CA 2DM8A 2IWNA 1D5GA 2KYLA 5E11A 2DLSA 4OAJA 3ID1A 2I0LA 5IL9A 1MFGA 2MHOA 2CSSA 3SFJA 3SHWA 4FGMA 2FNEA 3VQGA 5HEYA 2QG1A 3R69A 3L4FD 1VJ6A 2H2BA 2K20A 5F67A 2PKTA 2M0ZA 3GDVA 3K82A 1QAVB 1OBYA 5D13A 2RCZA 3HVQC 2KOMA 1MFLA 1VAEA 1UEQA 2KJDA 1IHJA 2H2CA 5FB8C 5HFFA 3K50A 2D8IA 5HFEA 2FN5A 2P3WA 2KA9A 3LNYA 2QKTA 4JOGA 1I92A 2LUIA 4NMQA 4YDPA 3PV4A 2EGNA 4RI0A 2AWWA 5E22A 1UJVA 2OPGA 1RGRA 3CBYA 2EEHA 3QIKA 5FHTA 2OCSA 4JORA 3KZEA 3PS4A 4K75A 4Q6HA 1GQ5A 1UHPA 1WI2A 4Z33A 3QJMA 2LC6A 3AXAA 2EGKA 2JINA 1TP3A 2M10A 2VWRA 2JILA 2DAZA 2M0UA 2ZPLA 3R0HA 5HF4A 1Q7XA 1VB7A 1V5LA 4HOPB 2W4FA 2PDZA 2PKUA 1UM7A 2G5MB 1UEZA 1N7TA 4IC6A 4JOKA 2KV8A 2KJPA 1UM1A 2H3MA 2HGAA 5G1DA 1TP5A 1VA8A 2VSVA 4NMOA 1TE0A 4NMRA 2OZFA 3EGGC 1M5ZA 2DKRA 2OQSA 4GVCA 4K76A 2R4HA 3STJA 2X7ZA 2KRGA 3LNXA 4UU5A 1KWAA 2L4TA 1WFVA 2L97A 3PV2A 2JWEA 2EJYA 3PDZA 1BE9A 3PV5A 1QLCA 4Q2OA 2EHRA 1BFEA 2KQFA 2I0IA 3DJ1A 4WYUA 2EEGA 4Q2NA 4EDJA 1OBXA 3QE1A 2D90A 5HFBA 5HF1A 2KOJA 1V1TA 4Q6SA 2I4SA 2M0TA 2M3MA 1W9OA 1FCFA 4JOEA 3CS0A 1R6JA 1QAUA 2LA8A 1X45A 4AMHA 2LOBA 4JJ0A 2EGOA 3TSZA 3MH6A 3RLEA 3GABA 3OU0A 2HE4A 3DIWA 3NFLA 3WKLA 4E3BA 2KL1A 4E35A 4JOJA 5G1EA 1UEPA 1P1EA 5HEBA 3CBXA 2KG2A 2OMJA 2QKUA 5ILBA 2E7KA 1WG6A 2YUYA 4NMTA 1YBOA 3KHFA 2V1WA 3DJAA 3QGLA 4KFWA 1N99A 2UZCA 1UJDA 3GDUA 2PZDA 1IU0A 2I04A 2ZPMA 3HPMA 4GHNA 3SUZA 5DTHA 1QAVA 4F8KA 1X6DA 2AINA 1N6FA 2EV8A 1N6EA 2YUBA 4JOPA 5E21A 4O06A 3O46A 4JOFA 4XHVA 2K1ZA 4WYTA 2R3YA 1ZUBA 1NF3C 3O5NA 3GJ9A 4K78A 5A2PA 3I4WA 3CYYA 2AWXA 1I16A 5B42A 2YTWA 1Y7NA 4FLNA 3B76A 2CS5A 2VPHA 2I1NA 3SOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K32 A;  5JXB A;  1XZ9 A;  2O2T A;  4PQW A;  1Q3O A;  2EEI A;  2DJT A;  4UU6 A;  5GLJ A;  3CBZ A;  1RGW A;  4JOH A;  2W7R A;  4NMP A;  3CC0 A;  2I6V A;  1B8Q A;  1U38 A;  4Q2P A;  2VZ5 A;  4HOP A;  4Z8J A;  1WHD A;  1WF8 A;  3JXT A;  2DMZ A;  1SOZ A;  3VQF A;  1UJU A;  2KBS A;  2IWO A;  3GGE A;  4Q3H A;  1X5R A;  2M0V A;  2VSP A;  4KFV A;  3TSV A;  3EGH C;  1P1D A;  2DB5 A;  1WIF A;  1WF7 A;  2KAW A;  2G2L A;  5HED A;  5EZ0 A;  1N7E A;  2OSG A;  2BYG A;  1WI4 A;  1PDR A;  2HE2 A;  2KOH A;  5B6L A;  3HPK A;  5HDY A;  1GM1 A;  4NMS A;  1V62 A;  3NGH A;  2FCF A;  2IWQ A;  2Z17 A;  2CSJ A;  2ENO A;  1X5N A;  2GZV A;  2LC7 A;  1Z87 A;  1SOT A;  2JRE A;  4NXQ A;  5GND A;  1U39 A;  1WFG A;  3QDO A;  3GSL A;  1OZI A;  3GCN A;  2REY A;  2H3L A;  2DLU A;  2JIK A;  2YT7 A;  3FY5 A;  4K72 A;  1T2M A;  2IWP A;  3R68 A;  5HFC A;  4OEO A;  2EDV A;  2KPL A;  1NTE A;  3E17 A;  4P2A B;  2WL7 A;  2V90 A;  3OTP A;  4OEP A;  1MC7 A;  2QBW A;  3GDS A;  5E6P B;  1RY4 A;  3NFK A;  1W9Q A;  2F0A A;  1IU2 A;  2PNT A;  1FC6 A;  5E1Y A;  4Q2Q A;  1N7F A;  2Q3G A;  1TQ3 A;  3KZD A;  3BPU A;  1KEF A;  2MX6 A;  4NMV A;  5EYZ A;  3ID2 A;  3I18 A;  1U3B A;  5HET A;  2EXG A;  1X8S A;  3ID4 A;  1Z86 A;  4GVD A;  4K6Y A;  3TSW A;  2DC2 A;  2VRF A;  3RL8 A;  2FE5 A;  3TMH A;  1V5Q A;  3QJN A;  2L4S A;  4NNL A;  2QT5 A;  1WH1 A;  1KY9 A;  1FC9 A;  1GQ4 A;  3I1E A;  1Q3P A;  2OGP A;  2PA1 A;  4G69 A;  1X5Q A;  1LCY A;  2EDZ A;  1VCW A;  4L8N A;  5I7Z A;  1OBZ A;  2KPK A;  4JL7 A;  2RRM A;  1U37 A;  1N6D A;  2F5Y A;  4R2Z A;  4REY A;  3DJ3 A;  1UEW A;  4LMM A;  2EAQ A;  3DOR A;  4H11 A;  2D92 A;  2Z9I A;  3WKM A;  2YT8 A;  4NXR A;  3ZRT A;  5HJ1 A;  1RZX A;  1WJL A;  2EDP A;  1ZOK A;  1G9O A;  3PDV A;  4YYX A;  3QO6 A;  2KJK A;  1FC7 A;  1V6B A;  2QKV A;  3GCO A;  3RL7 A;  4NNM A;  1UIT A;  4N6X A;  3SHU A;  1UF1 A;  2JXO A;  3MH4 A;  1Y8T A;  3CH8 A;  2JOA A;  4NXP A;  5H3J A;  5F3X A;  3MH7 A;  1UFX A;  3ID3 A;  1W9E A;  2AWU A;  4E34 A;  2EEJ A;  2OS6 A;  2Q9V A;  1WHA A;  3K1R A;  4MPA A;  1L6O A;  5HFD A;  4P0C A;  2DM8 A;  2IWN A;  1D5G A;  2KYL A;  5E11 A;  2DLS A;  4OAJ A;  3ID1 A;  2I0L A;  1MFG A;  2MHO A;  2CSS A;  3SFJ A;  3SHW A;  4FGM A;  2FNE A;  3VQG A;  5HEY A;  2QG1 A;  3R69 A;  3L4F D;  1VJ6 A;  2H2B A;  2K20 A;  5F67 A;  2PKT A;  2M0Z A;  3GDV A;  3K82 A;  1QAV B;  1OBY A;  5D13 A;  2RCZ A;  3HVQ C;  2KOM A;  1MFL A;  1VAE A;  1UEQ A;  2KJD A;  1IHJ A;  2H2C A;  5FB8 C;  5HFF A;  3K50 A;  2D8I A;  5HFE A;  2FN5 A;  2P3W A;  2KA9 A;  3LNY A;  2QKT A;  4JOG A;  1I92 A;  2LUI A;  4NMQ A;  4YDP A;  3PV4 A;  2EGN A;  4RI0 A;  2AWW A;  5E22 A;  1UJV A;  2OPG A;  1RGR A;  3CBY A;  2EEH A;  3QIK A;  5FHT A;  2OCS A;  4JOR A;  3KZE A;  3PS4 A;  4K75 A;  4Q6H A;  1GQ5 A;  1UHP A;  1WI2 A;  4Z33 A;  3QJM A;  2LC6 A;  3AXA A;  2EGK A;  2JIN A;  1TP3 A;  2M10 A;  2VWR A;  2JIL A;  2DAZ A;  2M0U A;  2ZPL A;  3R0H A;  5HF4 A;  1Q7X A;  1VB7 A;  1V5L A;  4HOP B;  2W4F A;  2PDZ A;  2PKU A;  1UM7 A;  2G5M B;  1UEZ A;  1N7T A;  4IC6 A;  4JOK A;  2KV8 A;  2KJP A;  1UM1 A;  2H3M A;  2HGA A;  5G1D A;  1TP5 A;  1VA8 A;  2VSV A;  4NMO A;  1TE0 A;  4NMR A;  2OZF A;  3EGG C;  1M5Z A;  2DKR A;  2OQS A;  4GVC A;  4K76 A;  2R4H A;  3STJ A;  2X7Z A;  2KRG A;  3LNX A;  4UU5 A;  1KWA A;  2L4T A;  1WFV A;  2L97 A;  3PV2 A;  2JWE A;  2EJY A;  3PDZ A;  1BE9 A;  3PV5 A;  1QLC A;  4Q2O A;  2EHR A;  1BFE A;  2KQF A;  2I0I A;  3DJ1 A;  4WYU A;  2EEG A;  4Q2N A;  4EDJ A;  1OBX A;  3QE1 A;  2D90 A;  5HFB A;  5HF1 A;  2KOJ A;  1V1T A;  4Q6S A;  2I4S A;  2M0T A;  2M3M A;  1W9O A;  1FCF A;  4JOE A;  3CS0 A;  1R6J A;  1QAU A;  2LA8 A;  1X45 A;  4AMH A;  2LOB A;  2EGO A;  3TSZ A;  3MH6 A;  3RLE A;  3OU0 A;  2HE4 A;  3DIW A;  3NFL A;  3WKL A;  4E3B A;  2KL1 A;  4E35 A;  4JOJ A;  5G1E A;  1UEP A;  1P1E A;  5HEB A;  3CBX A;  2KG2 A;  2OMJ A;  2QKU A;  2E7K A;  1WG6 A;  2YUY A;  4NMT A;  1YBO A;  3KHF A;  2V1W A;  3DJA A;  3QGL A;  4KFW A;  1N99 A;  2UZC A;  1UJD A;  3GDU A;  2PZD A;  1IU0 A;  2I04 A;  2ZPM A;  3HPM A;  4GHN A;  3SUZ A;  5DTH A;  1QAV A;  4F8K A;  1X6D A;  2AIN A;  1N6F A;  2EV8 A;  1N6E A;  2YUB A;  4JOP A;  5E21 A;  4O06 A;  3O46 A;  4JOF A;  4XHV A;  2K1Z A;  4WYT A;  2R3Y A;  1ZUB A;  1NF3 C;  3O5N A;  3GJ9 A;  4K78 A;  5A2P A;  3I4W A;  3CYY A;  2AWX A;  1I16 A;  2YTW A;  1Y7N A;  3B76 A;  2CS5 A;  2VPH A;  2I1N A;  3SOE A; 
#chains in the Genus database with same CATH topology
 1K32 A;  5JXB A;  1XZ9 A;  2O2T A;  4PQW A;  1Q3O A;  2EEI A;  2DJT A;  4UU6 A;  5GLJ A;  3CBZ A;  1RGW A;  4JOH A;  2W7R A;  4NMP A;  3CC0 A;  2I6V A;  1B8Q A;  1U38 A;  4Q2P A;  2VZ5 A;  4HOP A;  4Z8J A;  1WHD A;  1WF8 A;  3JXT A;  2DMZ A;  1SOZ A;  3VQF A;  1UJU A;  2KBS A;  2IWO A;  3GGE A;  4Q3H A;  1X5R A;  2M0V A;  2VSP A;  4KFV A;  3TSV A;  3EGH C;  1P1D A;  2DB5 A;  1WIF A;  1WF7 A;  2KAW A;  2G2L A;  5HED A;  5EZ0 A;  1N7E A;  2OSG A;  2BYG A;  1WI4 A;  1PDR A;  2HE2 A;  2KOH A;  3NCV A;  5B6L A;  3HPK A;  5HDY A;  1GM1 A;  4NMS A;  1V62 A;  3NGH A;  2FCF A;  2IWQ A;  2Z17 A;  2CSJ A;  2ENO A;  1X5N A;  2GZV A;  2LC7 A;  1Z87 A;  1SOT A;  2JRE A;  4NXQ A;  5GND A;  1U39 A;  1WFG A;  3QDO A;  3GSL A;  1OZI A;  3GCN A;  2REY A;  2H3L A;  2DLU A;  2JIK A;  2YT7 A;  3FY5 A;  4K72 A;  1T2M A;  2IWP A;  3R68 A;  5HFC A;  4OEO A;  2EDV A;  2KPL A;  1NTE A;  3E17 A;  4P2A B;  2WL7 A;  2V90 A;  3OTP A;  4OEP A;  1MC7 A;  2QBW A;  3GDS A;  5E6P B;  2GEF A;  1RY4 A;  3NFK A;  2JSN A;  1W9Q A;  2F0A A;  1IU2 A;  2PNT A;  1FC6 A;  5E1Y A;  3KDK A;  4Q2Q A;  1N7F A;  2Q3G A;  1TQ3 A;  3KZD A;  3BPU A;  1KEF A;  2MX6 A;  4NMV A;  5EYZ A;  3ID2 A;  3I18 A;  1U3B A;  5HET A;  2EXG A;  1X8S A;  3ID4 A;  1Z86 A;  4GVD A;  4K6Y A;  3TSW A;  2DC2 A;  2VRF A;  3RL8 A;  2FE5 A;  3TMH A;  1V5Q A;  3QJN A;  2L4S A;  4NNL A;  2QT5 A;  1WH1 A;  1KY9 A;  1FC9 A;  1GQ4 A;  3I1E A;  1Q3P A;  2OGP A;  2PA1 A;  4G69 A;  1X5Q A;  1LCY A;  2EDZ A;  1VCW A;  4L8N A;  5I7Z A;  1OBZ A;  2KPK A;  4JL7 A;  2RRM A;  1U37 A;  3KDG A;  1N6D A;  2F5Y A;  4R2Z A;  4REY A;  3DJ3 A;  1UEW A;  4LMM A;  2EAQ A;  3DOR A;  4H11 A;  2D92 A;  2Z9I A;  3WKM A;  2YT8 A;  4NXR A;  3ZRT A;  5HJ1 A;  1RZX A;  1WJL A;  2EDP A;  1ZOK A;  1G9O A;  3PDV A;  4YYX A;  3QO6 A;  2KJK A;  1FC7 A;  1V6B A;  2QKV A;  3GCO A;  3RL7 A;  4NNM A;  1UIT A;  4N6X A;  3SHU A;  1UF1 A;  2JXO A;  3MH4 A;  1Y8T A;  1X9Z A;  3CH8 A;  2JOA A;  4NXP A;  5H3J A;  5F3X A;  3MH7 A;  1UFX A;  3ID3 A;  1W9E A;  2AWU A;  4E34 A;  2EEJ A;  2OS6 A;  2Q9V A;  1WHA A;  3K1R A;  4JJ3 A;  4MPA A;  1L6O A;  5HFD A;  4P0C A;  2DM8 A;  2IWN A;  1D5G A;  2KYL A;  5E11 A;  2DLS A;  4OAJ A;  3ID1 A;  2I0L A;  5IL9 A;  1MFG A;  2MHO A;  2CSS A;  3SFJ A;  3SHW A;  4FGM A;  2FNE A;  3VQG A;  5HEY A;  2QG1 A;  3R69 A;  3L4F D;  1VJ6 A;  2H2B A;  2K20 A;  5F67 A;  2PKT A;  2M0Z A;  3GDV A;  3K82 A;  1QAV B;  1OBY A;  5D13 A;  2RCZ A;  3HVQ C;  2KOM A;  1MFL A;  1VAE A;  1UEQ A;  2KJD A;  1IHJ A;  2H2C A;  5FB8 C;  5HFF A;  3K50 A;  2D8I A;  5HFE A;  2FN5 A;  2P3W A;  2KA9 A;  3LNY A;  2QKT A;  4JOG A;  1I92 A;  2LUI A;  4NMQ A;  4YDP A;  3PV4 A;  2EGN A;  4RI0 A;  2AWW A;  5E22 A;  1UJV A;  2OPG A;  1RGR A;  3CBY A;  2EEH A;  3QIK A;  5FHT A;  2OCS A;  4JOR A;  3KZE A;  3PS4 A;  4K75 A;  4Q6H A;  1GQ5 A;  1UHP A;  1WI2 A;  4Z33 A;  3QJM A;  2LC6 A;  3AXA A;  2EGK A;  2JIN A;  1TP3 A;  2M10 A;  2VWR A;  2JIL A;  2DAZ A;  2M0U A;  2ZPL A;  3R0H A;  5HF4 A;  1Q7X A;  1VB7 A;  1V5L A;  4HOP B;  2W4F A;  2PDZ A;  2PKU A;  1UM7 A;  2G5M B;  1UEZ A;  1N7T A;  4IC6 A;  4JOK A;  2KV8 A;  2KJP A;  1UM1 A;  2H3M A;  2HGA A;  5G1D A;  1TP5 A;  1VA8 A;  2VSV A;  4NMO A;  1TE0 A;  4NMR A;  2OZF A;  3EGG C;  1M5Z A;  2DKR A;  2OQS A;  4GVC A;  4K76 A;  2R4H A;  3STJ A;  2X7Z A;  2KRG A;  3LNX A;  4UU5 A;  1KWA A;  2L4T A;  1WFV A;  2L97 A;  3PV2 A;  2JWE A;  2EJY A;  3PDZ A;  1BE9 A;  3PV5 A;  1QLC A;  4Q2O A;  2EHR A;  1BFE A;  2KQF A;  2I0I A;  3DJ1 A;  4WYU A;  2EEG A;  4Q2N A;  4EDJ A;  1OBX A;  3QE1 A;  2D90 A;  5HFB A;  5HF1 A;  2KOJ A;  1V1T A;  4Q6S A;  2I4S A;  2M0T A;  2M3M A;  1W9O A;  1FCF A;  4JOE A;  3CS0 A;  1R6J A;  1QAU A;  2LA8 A;  1X45 A;  4AMH A;  2LOB A;  4JJ0 A;  2EGO A;  3TSZ A;  3MH6 A;  3RLE A;  3GAB A;  3OU0 A;  2HE4 A;  3DIW A;  3NFL A;  3WKL A;  4E3B A;  2KL1 A;  4E35 A;  4JOJ A;  5G1E A;  1UEP A;  1P1E A;  5HEB A;  3CBX A;  2KG2 A;  2OMJ A;  2QKU A;  5ILB A;  2E7K A;  1WG6 A;  2YUY A;  4NMT A;  1YBO A;  3KHF A;  2V1W A;  3DJA A;  3QGL A;  4KFW A;  1N99 A;  2UZC A;  1UJD A;  3GDU A;  2PZD A;  1IU0 A;  2I04 A;  2ZPM A;  3HPM A;  4GHN A;  3SUZ A;  5DTH A;  1QAV A;  4F8K A;  1X6D A;  2AIN A;  1N6F A;  2EV8 A;  1N6E A;  2YUB A;  4JOP A;  5E21 A;  4O06 A;  3O46 A;  4JOF A;  4XHV A;  2K1Z A;  4WYT A;  2R3Y A;  1ZUB A;  1NF3 C;  3O5N A;  3GJ9 A;  4K78 A;  5A2P A;  3I4W A;  3CYY A;  2AWX A;  1I16 A;  5B42 A;  2YTW A;  1Y7N A;  4FLN A;  3B76 A;  2CS5 A;  2VPH A;  2I1N A;  3SOE A; 
#chains in the Genus database with same CATH homology
 1K32 A;  5JXB A;  1XZ9 A;  2O2T A;  4PQW A;  1Q3O A;  2EEI A;  2DJT A;  4UU6 A;  5GLJ A;  3CBZ A;  1RGW A;  4JOH A;  2W7R A;  4NMP A;  3CC0 A;  2I6V A;  1B8Q A;  1U38 A;  4Q2P A;  2VZ5 A;  4HOP A;  4Z8J A;  1WHD A;  1WF8 A;  3JXT A;  2DMZ A;  1SOZ A;  3VQF A;  1UJU A;  2KBS A;  2IWO A;  3GGE A;  4Q3H A;  1X5R A;  2M0V A;  2VSP A;  4KFV A;  3TSV A;  3EGH C;  1P1D A;  2DB5 A;  1WIF A;  1WF7 A;  2KAW A;  2G2L A;  5HED A;  5EZ0 A;  1N7E A;  2OSG A;  2BYG A;  1WI4 A;  1PDR A;  2HE2 A;  2KOH A;  3NCV A;  5B6L A;  3HPK A;  5HDY A;  1GM1 A;  4NMS A;  1V62 A;  3NGH A;  2FCF A;  2IWQ A;  2Z17 A;  2CSJ A;  2ENO A;  1X5N A;  2GZV A;  2LC7 A;  1Z87 A;  1SOT A;  2JRE A;  4NXQ A;  5GND A;  1U39 A;  1WFG A;  3QDO A;  3GSL A;  1OZI A;  3GCN A;  2REY A;  2H3L A;  2DLU A;  2JIK A;  2YT7 A;  3FY5 A;  4K72 A;  1T2M A;  2IWP A;  3R68 A;  5HFC A;  4OEO A;  2EDV A;  2KPL A;  1NTE A;  3E17 A;  4P2A B;  2WL7 A;  2V90 A;  3OTP A;  4OEP A;  1MC7 A;  2QBW A;  3GDS A;  5E6P B;  2GEF A;  1RY4 A;  3NFK A;  2JSN A;  1W9Q A;  2F0A A;  1IU2 A;  2PNT A;  1FC6 A;  5E1Y A;  3KDK A;  4Q2Q A;  1N7F A;  2Q3G A;  1TQ3 A;  3KZD A;  3BPU A;  1KEF A;  2MX6 A;  4NMV A;  5EYZ A;  3ID2 A;  3I18 A;  1U3B A;  5HET A;  2EXG A;  1X8S A;  3ID4 A;  1Z86 A;  4GVD A;  4K6Y A;  3TSW A;  2DC2 A;  2VRF A;  3RL8 A;  2FE5 A;  3TMH A;  1V5Q A;  3QJN A;  2L4S A;  4NNL A;  2QT5 A;  1WH1 A;  1KY9 A;  1FC9 A;  1GQ4 A;  3I1E A;  1Q3P A;  2OGP A;  2PA1 A;  4G69 A;  1X5Q A;  1LCY A;  2EDZ A;  1VCW A;  4L8N A;  5I7Z A;  1OBZ A;  2KPK A;  4JL7 A;  2RRM A;  1U37 A;  3KDG A;  1N6D A;  2F5Y A;  4R2Z A;  4REY A;  3DJ3 A;  1UEW A;  4LMM A;  2EAQ A;  3DOR A;  4H11 A;  2D92 A;  2Z9I A;  3WKM A;  2YT8 A;  4NXR A;  3ZRT A;  5HJ1 A;  1RZX A;  1WJL A;  2EDP A;  1ZOK A;  1G9O A;  3PDV A;  4YYX A;  3QO6 A;  2KJK A;  1FC7 A;  1V6B A;  2QKV A;  3GCO A;  3RL7 A;  4NNM A;  1UIT A;  4N6X A;  3SHU A;  1UF1 A;  2JXO A;  3MH4 A;  1Y8T A;  1X9Z A;  3CH8 A;  2JOA A;  4NXP A;  5H3J A;  5F3X A;  3MH7 A;  1UFX A;  3ID3 A;  1W9E A;  2AWU A;  4E34 A;  2EEJ A;  2OS6 A;  2Q9V A;  1WHA A;  3K1R A;  4JJ3 A;  4MPA A;  1L6O A;  5HFD A;  4P0C A;  2DM8 A;  2IWN A;  1D5G A;  2KYL A;  5E11 A;  2DLS A;  4OAJ A;  3ID1 A;  2I0L A;  5IL9 A;  1MFG A;  2MHO A;  2CSS A;  3SFJ A;  3SHW A;  4FGM A;  2FNE A;  3VQG A;  5HEY A;  2QG1 A;  3R69 A;  3L4F D;  1VJ6 A;  2H2B A;  2K20 A;  5F67 A;  2PKT A;  2M0Z A;  3GDV A;  3K82 A;  1QAV B;  1OBY A;  5D13 A;  2RCZ A;  3HVQ C;  2KOM A;  1MFL A;  1VAE A;  1UEQ A;  2KJD A;  1IHJ A;  2H2C A;  5FB8 C;  5HFF A;  3K50 A;  2D8I A;  5HFE A;  2FN5 A;  2P3W A;  2KA9 A;  3LNY A;  2QKT A;  4JOG A;  1I92 A;  2LUI A;  4NMQ A;  4YDP A;  3PV4 A;  2EGN A;  4RI0 A;  2AWW A;  5E22 A;  1UJV A;  2OPG A;  1RGR A;  3CBY A;  2EEH A;  3QIK A;  5FHT A;  2OCS A;  4JOR A;  3KZE A;  3PS4 A;  4K75 A;  4Q6H A;  1GQ5 A;  1UHP A;  1WI2 A;  4Z33 A;  3QJM A;  2LC6 A;  3AXA A;  2EGK A;  2JIN A;  1TP3 A;  2M10 A;  2VWR A;  2JIL A;  2DAZ A;  2M0U A;  2ZPL A;  3R0H A;  5HF4 A;  1Q7X A;  1VB7 A;  1V5L A;  4HOP B;  2W4F A;  2PDZ A;  2PKU A;  1UM7 A;  2G5M B;  1UEZ A;  1N7T A;  4IC6 A;  4JOK A;  2KV8 A;  2KJP A;  1UM1 A;  2H3M A;  2HGA A;  5G1D A;  1TP5 A;  1VA8 A;  2VSV A;  4NMO A;  1TE0 A;  4NMR A;  2OZF A;  3EGG C;  1M5Z A;  2DKR A;  2OQS A;  4GVC A;  4K76 A;  2R4H A;  3STJ A;  2X7Z A;  2KRG A;  3LNX A;  4UU5 A;  1KWA A;  2L4T A;  1WFV A;  2L97 A;  3PV2 A;  2JWE A;  2EJY A;  3PDZ A;  1BE9 A;  3PV5 A;  1QLC A;  4Q2O A;  2EHR A;  1BFE A;  2KQF A;  2I0I A;  3DJ1 A;  4WYU A;  2EEG A;  4Q2N A;  4EDJ A;  1OBX A;  3QE1 A;  2D90 A;  5HFB A;  5HF1 A;  2KOJ A;  1V1T A;  4Q6S A;  2I4S A;  2M0T A;  2M3M A;  1W9O A;  1FCF A;  4JOE A;  3CS0 A;  1R6J A;  1QAU A;  2LA8 A;  1X45 A;  4AMH A;  2LOB A;  4JJ0 A;  2EGO A;  3TSZ A;  3MH6 A;  3RLE A;  3GAB A;  3OU0 A;  2HE4 A;  3DIW A;  3NFL A;  3WKL A;  4E3B A;  2KL1 A;  4E35 A;  4JOJ A;  5G1E A;  1UEP A;  1P1E A;  5HEB A;  3CBX A;  2KG2 A;  2OMJ A;  2QKU A;  5ILB A;  2E7K A;  1WG6 A;  2YUY A;  4NMT A;  1YBO A;  3KHF A;  2V1W A;  3DJA A;  3QGL A;  4KFW A;  1N99 A;  2UZC A;  1UJD A;  3GDU A;  2PZD A;  1IU0 A;  2I04 A;  2ZPM A;  3HPM A;  4GHN A;  3SUZ A;  5DTH A;  1QAV A;  4F8K A;  1X6D A;  2AIN A;  1N6F A;  2EV8 A;  1N6E A;  2YUB A;  4JOP A;  5E21 A;  4O06 A;  3O46 A;  4JOF A;  4XHV A;  2K1Z A;  4WYT A;  2R3Y A;  1ZUB A;  1NF3 C;  3O5N A;  3GJ9 A;  4K78 A;  5A2P A;  3I4W A;  3CYY A;  2AWX A;  1I16 A;  5B42 A;  2YTW A;  1Y7N A;  4FLN A;  3B76 A;  2CS5 A;  2VPH A;  2I1N A;  3SOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...