2PZDA

Crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
106
Chain Sequence
RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTGWTMFWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease HTRA2
publication title Structural and functional analysis of the ligand specificity of the HtrA2/Omi PDZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 25
structure length 106
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2pzdA01
3PDVA 1QLCA 1Z87A 2CSSA 1U37A 1VJ6A 2H2CA 1X45A 2OQSA 2Q3GA 5HETA 4NMVA 4IC6A 2PKUA 5I7ZA 1M5ZA 1WI2A 1V5QA 2VWRA 4GVCA 3I1EA 2L97A 1U3BA 4OEOA 2JREA 1IHJA 2ZPLA 3DJAA 2EXGA 2I0IA 4NNMA 2DC2A 1N99A 4KFVA 2YTWA 2KL1A 1N7EA 3CYYA 3CH8A 4K72A 2JINA 2VPHA 1R6JA 2IWNA 4NMTA 2YT7A 1UF1A 3GGEA 3OU0A 4EDJA 1UEWA 2KA9A 2VSPA 1W9QA 4UU5A 2KOHA 2R3YA 3BPUA 4FGMA 2KQFA 1U38A 3LNXA 4HOPB 3VQGA 2D90A 3EGHC 5E22A 2AINA 1WI4A 3WKLA 4Q3HA 4NMOA 3TSVA 3WKMA 4UU6A 5G1DA 1Y8TA 4JOKA 1OBXA 4JORA 4G69A 4E34A 1KY9A 3SUZA 4NXQA 1L6OA 4OEPA 3KZEA 2I6VA 3GJ9A 1SOTA 4K78A 1TP3A 1Q3PA 3O5NA 4OAJA 5HFDA 5B6LA 1P1EA 2OS6A 1X5NA 2K20A 1WF7A 2OCSA 2LC7A 3PV5A 5EYZA 2DJTA 3VQFA 1NTEA 4JOJA 2EGNA 5FB8C 5G1EA 2L4TA 4RI0A 5HF1A 2FE5A 3CC0A 4JOGA 1BE9A 2F0AA 3JXTA 1UM1A 1T2MA 2VSVA 1ZUBA 3GSLA 2KPLA 3K50A 4KFWA 1FC7A 3ID3A 2KAWA 1XZ9A 5DTHA 1FC9A 4REYA 1ZOKA 2VZ5A 3PDZA 1P1DA 2HE4A 1UEPA 1K32A 2DMZA 2AWWA 1GM1A 1N7FA 1D5GA 4NMPA 5HEYA 3SOEA 1V6BA 1WIFA 4Q2PA 1N6EA 2H3LA 1LCYA 3I4WA 4PQWA 4K76A 4Z33A 2OMJA 4HOPA 2D8IA 4JOHA 4P2AB 5HFBA 2Z17A 2YUYA 2M3MA 4NMRA 1UITA 2QKTA 2UZCA 4Q2OA 1UEQA 1WHDA 4Z8JA 5E1YA 2IWQA 3K82A 4E3BA 3RL7A 4NXRA 2JWEA 2HE2A 1Q3OA 1MFLA 1X8SA 3SHUA 2AWUA 3HVQC 3ID4A 3RL8A 3CBYA 4Q6SA 1RGWA 1UJVA 2FNEA 2H2BA 3GDUA 1V5LA 2MHOA 3NFKA 1TE0A 1WH1A 4NMSA 1X5RA 2V1WA 5HFEA 4MPAA 1Y7NA 2DKRA 4JOFA 2EDZA 2P3WA 1VA8A 1N6DA 3DJ3A 2KJKA 3QO6A 1KWAA 4NXPA 2IWOA 3TSWA 1WHAA 3R69A 2FCFA 2G2LA 4K75A 5HJ1A 2M0UA 3CS0A 2KJDA 5HDYA 2QKUA 1WG6A 1WJLA 2IWPA 2KOMA 3ID1A 2JIKA 2VRFA 1G9OA 1BFEA 2E7KA 4GHNA 2W7RA 5F67A 2EEHA 3B76A 2LOBA 2V90A 2EHRA 3R0HA 3GDSA 1MFGA 3LNYA 3K1RA 2QG1A 3AXAA 2OGPA 3SHWA 2RCZA 2M0VA 2PA1A 2MX6A 1WFVA 4GVDA 1QAVB 1FC6A 3TSZA 1UM7A 1V1TA 2WL7A 3QJNA 2JOAA 2I4SA 4YDPA 3E17A 2O2TA 5D13A 3SFJA 2RRMA 5HEBA 5HFFA 5JXBA 1X6DA 2QBWA 4O06A 3PV4A 2DM8A 2K1ZA 2R4HA 4WYUA 4E35A 2F5YA 2KYLA 5EZ0A 4Q2NA 3QIKA 2PNTA 1KEFA 1IU0A 1GQ5A 3QE1A 3CBXA 1FCFA 5E6PB 2KPKA 1V62A 3HPMA 2PZDA 1OBYA 2EDVA 1RZXA 2YT8A 3I18A 1NF3C 2PKTA 3DORA 2EJYA 4JOPA 1W9EA 1N6FA 2EGOA 3NFLA 2H3MA 2Z9IA 5H3JA 2KOJA 2FN5A 1I92A 1UJDA 1UFXA 4JOEA 2I0LA 4YYXA 2KG2A 1B8QA 1RGRA 2EEIA 2YUBA 3FY5A 4JL7A 4Q2QA 1PDRA 2JILA 3KZDA 1OZIA 2X7ZA 1QAUA 5GNDA 2LUIA 2KRGA 2CSJA 5FHTA 2OZFA 2PDZA 3L4FD 2DLUA 1UHPA 3DIWA 3DJ1A 2ENOA 2ZPMA 3GCNA 5HF4A 2EAQA 1SOZA 2KJPA 1U39A 2KV8A 3R68A 2EV8A 4XHVA 3MH4A 3ID2A 2DB5A 3QDOA 2BYGA 1I16A 2GZVA 3ZRTA 1QAVA 4NMQA 3QGLA 3MH7A 3PV2A 3O46A 2D92A 4P0CA 3CBZA 4F8KA 3GCOA 3PS4A 1Q7XA 3NGHA 2L4SA 4NNLA 3STJA 3GDVA 2QT5A 2I1NA 1IU2A 4WYTA 2EGKA 1GQ4A 4R2ZA 2LA8A 5F3XA 3KHFA 2DLSA 2M10A 1RY4A 4AMHA 3QJMA 2HGAA 2LC6A 1UEZA 1TP5A 1WF8A 2KBSA 2OSGA 1Z86A 1VB7A 3HPKA 4LMMA 5E21A 5HFCA 1VAEA 2REYA 1TQ3A 3RLEA 5GLJA 5E11A 2M0ZA 2CS5A 3MH6A 1W9OA 1WFGA 5A2PA 3EGGC 2G5MB 2QKVA 4Q6HA 4H11A 2OPGA 2EEJA 1X5QA 2EDPA 2I04A 1YBOA 2JXOA 4K6YA 2EEGA 1VCWA 1N7TA 2W4FA 1MC7A 5HEDA 2AWXA 4L8NA 1UJUA 2M0TA 2Q9VA 3OTPA 3TMHA 2DAZA 4N6XA 1OBZA
chains in the Genus database with same CATH superfamily
3PDVA 1QLCA 1Z87A 2CSSA 1U37A 1VJ6A 2H2CA 1X45A 2OQSA 2Q3GA 5HETA 4NMVA 4IC6A 2PKUA 5I7ZA 1M5ZA 1WI2A 1V5QA 2VWRA 4GVCA 3I1EA 2L97A 1U3BA 4OEOA 2JREA 1IHJA 2ZPLA 3DJAA 2EXGA 2I0IA 4NNMA 2DC2A 1N99A 4KFVA 2YTWA 2KL1A 1N7EA 3CYYA 3CH8A 4K72A 2JINA 2VPHA 1R6JA 2IWNA 4NMTA 2YT7A 1UF1A 3GGEA 3OU0A 4EDJA 1UEWA 2KA9A 2VSPA 1W9QA 4UU5A 2KOHA 2R3YA 3BPUA 4FGMA 2KQFA 1U38A 3LNXA 4HOPB 3VQGA 2D90A 3EGHC 5E22A 2AINA 1WI4A 3WKLA 4Q3HA 4NMOA 3TSVA 3WKMA 4UU6A 4JJ3A 5G1DA 5IL9A 1Y8TA 4JOKA 1OBXA 4JORA 4G69A 4E34A 1KY9A 3SUZA 4NXQA 1L6OA 4OEPA 3KZEA 1X9ZA 2I6VA 3GJ9A 1SOTA 4K78A 1TP3A 1Q3PA 3O5NA 4OAJA 5HFDA 5B6LA 1P1EA 2OS6A 1X5NA 2K20A 1WF7A 2OCSA 2LC7A 3PV5A 5EYZA 2DJTA 3VQFA 1NTEA 4JOJA 2EGNA 5FB8C 5G1EA 2L4TA 4RI0A 5HF1A 2FE5A 3CC0A 4JOGA 1BE9A 2F0AA 3JXTA 1UM1A 1T2MA 2VSVA 1ZUBA 3GSLA 2KPLA 3K50A 4KFWA 3KDKA 1FC7A 3ID3A 2KAWA 1XZ9A 5DTHA 1FC9A 4REYA 1ZOKA 2VZ5A 3PDZA 1P1DA 2HE4A 1UEPA 1K32A 2DMZA 2AWWA 1GM1A 1N7FA 1D5GA 4NMPA 5HEYA 3SOEA 1V6BA 1WIFA 4Q2PA 1N6EA 2H3LA 1LCYA 3I4WA 4PQWA 4K76A 4Z33A 2OMJA 4HOPA 2D8IA 4JOHA 4P2AB 5HFBA 2Z17A 2YUYA 2M3MA 4NMRA 1UITA 2QKTA 4JJ0A 2UZCA 4Q2OA 1UEQA 1WHDA 4Z8JA 5E1YA 2IWQA 3K82A 4E3BA 3RL7A 4NXRA 2JWEA 2HE2A 1Q3OA 1MFLA 1X8SA 3SHUA 2AWUA 3HVQC 3ID4A 3RL8A 3CBYA 4Q6SA 1RGWA 1UJVA 2FNEA 2H2BA 3GDUA 1V5LA 2MHOA 3NFKA 1TE0A 1WH1A 4NMSA 1X5RA 2V1WA 5HFEA 4MPAA 1Y7NA 2DKRA 4JOFA 2EDZA 2GEFA 2P3WA 1VA8A 1N6DA 3DJ3A 2KJKA 3QO6A 1KWAA 4NXPA 2IWOA 3TSWA 1WHAA 3R69A 2FCFA 2G2LA 4K75A 5HJ1A 2M0UA 3CS0A 2KJDA 5HDYA 3NCVA 2QKUA 1WG6A 1WJLA 2IWPA 2KOMA 3ID1A 2JIKA 2VRFA 1G9OA 1BFEA 2E7KA 4GHNA 2W7RA 5F67A 2EEHA 3B76A 2LOBA 2V90A 2EHRA 2JSNA 3R0HA 3GDSA 1MFGA 3LNYA 3K1RA 2QG1A 3AXAA 2OGPA 3SHWA 3GABA 2RCZA 2M0VA 2PA1A 2MX6A 1WFVA 4GVDA 1QAVB 1FC6A 3TSZA 1UM7A 1V1TA 2WL7A 3QJNA 2JOAA 2I4SA 4YDPA 3E17A 2O2TA 5D13A 3SFJA 2RRMA 5HEBA 5HFFA 5JXBA 1X6DA 2QBWA 4O06A 3PV4A 2DM8A 2K1ZA 2R4HA 4WYUA 4E35A 2F5YA 2KYLA 5EZ0A 4Q2NA 3QIKA 2PNTA 1KEFA 1IU0A 1GQ5A 3QE1A 3CBXA 1FCFA 3KDGA 5E6PB 2KPKA 1V62A 3HPMA 2PZDA 1OBYA 2EDVA 1RZXA 2YT8A 3I18A 1NF3C 2PKTA 3DORA 2EJYA 5B42A 4JOPA 1W9EA 1N6FA 2EGOA 3NFLA 2H3MA 2Z9IA 5H3JA 2KOJA 2FN5A 1I92A 1UJDA 1UFXA 4FLNA 4JOEA 2I0LA 4YYXA 2KG2A 1B8QA 1RGRA 2EEIA 2YUBA 3FY5A 4JL7A 4Q2QA 1PDRA 2JILA 3KZDA 1OZIA 2X7ZA 1QAUA 5GNDA 2LUIA 2KRGA 2CSJA 5FHTA 2OZFA 2PDZA 3L4FD 2DLUA 1UHPA 3DIWA 3DJ1A 2ENOA 2ZPMA 3GCNA 5HF4A 2EAQA 1SOZA 2KJPA 1U39A 2KV8A 3R68A 2EV8A 4XHVA 3MH4A 3ID2A 2DB5A 3QDOA 2BYGA 1I16A 2GZVA 3ZRTA 1QAVA 4NMQA 3QGLA 3MH7A 3PV2A 3O46A 2D92A 4P0CA 3CBZA 4F8KA 3GCOA 3PS4A 1Q7XA 3NGHA 2L4SA 4NNLA 3STJA 3GDVA 2QT5A 2I1NA 1IU2A 4WYTA 2EGKA 1GQ4A 4R2ZA 2LA8A 5F3XA 3KHFA 2DLSA 2M10A 1RY4A 4AMHA 3QJMA 2HGAA 2LC6A 1UEZA 1TP5A 1WF8A 2KBSA 2OSGA 1Z86A 1VB7A 3HPKA 4LMMA 5E21A 5HFCA 1VAEA 2REYA 1TQ3A 3RLEA 5GLJA 5ILBA 5E11A 2M0ZA 2CS5A 3MH6A 1W9OA 1WFGA 5A2PA 3EGGC 2G5MB 2QKVA 4Q6HA 4H11A 2OPGA 2EEJA 1X5QA 2EDPA 2I04A 1YBOA 2JXOA 4K6YA 2EEGA 1VCWA 1N7TA 2W4FA 1MC7A 5HEDA 2AWXA 4L8NA 1UJUA 2M0TA 2Q9VA 3OTPA 3TMHA 2DAZA 4N6XA 1OBZA
chains in the Genus database with same CATH topology
3PDVA 1QLCA 1Z87A 2CSSA 1U37A 1VJ6A 2H2CA 1X45A 2OQSA 2Q3GA 5HETA 4NMVA 4IC6A 2PKUA 5I7ZA 1M5ZA 1WI2A 1V5QA 2VWRA 4GVCA 3I1EA 2L97A 1U3BA 4OEOA 2JREA 1IHJA 2ZPLA 3DJAA 2EXGA 2I0IA 4NNMA 2DC2A 1N99A 4KFVA 2YTWA 2KL1A 1N7EA 3CYYA 3CH8A 4K72A 2JINA 2VPHA 1R6JA 2IWNA 4NMTA 2YT7A 1UF1A 3GGEA 3OU0A 4EDJA 1UEWA 2KA9A 2VSPA 1W9QA 4UU5A 2KOHA 2R3YA 3BPUA 4FGMA 2KQFA 1U38A 3LNXA 4HOPB 3VQGA 2D90A 3EGHC 5E22A 2AINA 1WI4A 3WKLA 4Q3HA 4NMOA 3TSVA 3WKMA 4UU6A 4JJ3A 5G1DA 5IL9A 1Y8TA 4JOKA 1OBXA 4JORA 4G69A 4E34A 1KY9A 3SUZA 4NXQA 1L6OA 4OEPA 3KZEA 1X9ZA 2I6VA 3GJ9A 1SOTA 4K78A 1TP3A 1Q3PA 3O5NA 4OAJA 5HFDA 5B6LA 1P1EA 2OS6A 1X5NA 2K20A 1WF7A 2OCSA 2LC7A 3PV5A 5EYZA 2DJTA 3VQFA 1NTEA 4JOJA 2EGNA 5FB8C 5G1EA 2L4TA 4RI0A 5HF1A 2FE5A 3CC0A 4JOGA 1BE9A 2F0AA 3JXTA 1UM1A 1T2MA 2VSVA 1ZUBA 3GSLA 2KPLA 3K50A 4KFWA 3KDKA 1FC7A 3ID3A 2KAWA 1XZ9A 5DTHA 1FC9A 4REYA 1ZOKA 2VZ5A 3PDZA 1P1DA 2HE4A 1UEPA 1K32A 2DMZA 2AWWA 1GM1A 1N7FA 1D5GA 4NMPA 5HEYA 3SOEA 1V6BA 1WIFA 4Q2PA 1N6EA 2H3LA 1LCYA 3I4WA 4PQWA 4K76A 4Z33A 2OMJA 4HOPA 2D8IA 4JOHA 4P2AB 5HFBA 2Z17A 2YUYA 2M3MA 4NMRA 1UITA 2QKTA 4JJ0A 2UZCA 4Q2OA 1UEQA 1WHDA 4Z8JA 5E1YA 2IWQA 3K82A 4E3BA 3RL7A 4NXRA 2JWEA 2HE2A 1Q3OA 1MFLA 1X8SA 3SHUA 2AWUA 3HVQC 3ID4A 3RL8A 3CBYA 4Q6SA 1RGWA 1UJVA 2FNEA 2H2BA 3GDUA 1V5LA 2MHOA 3NFKA 1TE0A 1WH1A 4NMSA 1X5RA 2V1WA 5HFEA 4MPAA 1Y7NA 2DKRA 4JOFA 2EDZA 2GEFA 2P3WA 1VA8A 1N6DA 3DJ3A 2KJKA 3QO6A 1KWAA 4NXPA 2IWOA 3TSWA 1WHAA 3R69A 2FCFA 2G2LA 4K75A 5HJ1A 2M0UA 3CS0A 2KJDA 5HDYA 3NCVA 2QKUA 1WG6A 1WJLA 2IWPA 2KOMA 3ID1A 2JIKA 2VRFA 1G9OA 1BFEA 2E7KA 4GHNA 2W7RA 5F67A 2EEHA 3B76A 2LOBA 2V90A 2EHRA 2JSNA 3R0HA 3GDSA 1MFGA 3LNYA 3K1RA 2QG1A 3AXAA 2OGPA 3SHWA 3GABA 2RCZA 2M0VA 2PA1A 2MX6A 1WFVA 4GVDA 1QAVB 1FC6A 3TSZA 1UM7A 1V1TA 2WL7A 3QJNA 2JOAA 2I4SA 4YDPA 3E17A 2O2TA 5D13A 3SFJA 2RRMA 5HEBA 5HFFA 5JXBA 1X6DA 2QBWA 4O06A 3PV4A 2DM8A 2K1ZA 2R4HA 4WYUA 4E35A 2F5YA 2KYLA 5EZ0A 4Q2NA 3QIKA 2PNTA 1KEFA 1IU0A 1GQ5A 3QE1A 3CBXA 1FCFA 3KDGA 5E6PB 2KPKA 1V62A 3HPMA 2PZDA 1OBYA 2EDVA 1RZXA 2YT8A 3I18A 1NF3C 2PKTA 3DORA 2EJYA 5B42A 4JOPA 1W9EA 1N6FA 2EGOA 3NFLA 2H3MA 2Z9IA 5H3JA 2KOJA 2FN5A 1I92A 1UJDA 1UFXA 4FLNA 4JOEA 2I0LA 4YYXA 2KG2A 1B8QA 1RGRA 2EEIA 2YUBA 3FY5A 4JL7A 4Q2QA 1PDRA 2JILA 3KZDA 1OZIA 2X7ZA 1QAUA 5GNDA 2LUIA 2KRGA 2CSJA 5FHTA 2OZFA 2PDZA 3L4FD 2DLUA 1UHPA 3DIWA 3DJ1A 2ENOA 2ZPMA 3GCNA 5HF4A 2EAQA 1SOZA 2KJPA 1U39A 2KV8A 3R68A 2EV8A 4XHVA 3MH4A 3ID2A 2DB5A 3QDOA 2BYGA 1I16A 2GZVA 3ZRTA 1QAVA 4NMQA 3QGLA 3MH7A 3PV2A 3O46A 2D92A 4P0CA 3CBZA 4F8KA 3GCOA 3PS4A 1Q7XA 3NGHA 2L4SA 4NNLA 3STJA 3GDVA 2QT5A 2I1NA 1IU2A 4WYTA 2EGKA 1GQ4A 4R2ZA 2LA8A 5F3XA 3KHFA 2DLSA 2M10A 1RY4A 4AMHA 3QJMA 2HGAA 2LC6A 1UEZA 1TP5A 1WF8A 2KBSA 2OSGA 1Z86A 1VB7A 3HPKA 4LMMA 5E21A 5HFCA 1VAEA 2REYA 1TQ3A 3RLEA 5GLJA 5ILBA 5E11A 2M0ZA 2CS5A 3MH6A 1W9OA 1WFGA 5A2PA 3EGGC 2G5MB 2QKVA 4Q6HA 4H11A 2OPGA 2EEJA 1X5QA 2EDPA 2I04A 1YBOA 2JXOA 4K6YA 2EEGA 1VCWA 1N7TA 2W4FA 1MC7A 5HEDA 2AWXA 4L8NA 1UJUA 2M0TA 2Q9VA 3OTPA 3TMHA 2DAZA 4N6XA 1OBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDV A;  1QLC A;  1Z87 A;  2CSS A;  1U37 A;  1VJ6 A;  2H2C A;  1X45 A;  2OQS A;  2Q3G A;  5HET A;  4NMV A;  4IC6 A;  2PKU A;  5I7Z A;  1M5Z A;  1WI2 A;  1V5Q A;  2VWR A;  4GVC A;  3I1E A;  2L97 A;  1U3B A;  4OEO A;  2JRE A;  1IHJ A;  2ZPL A;  3DJA A;  2EXG A;  2I0I A;  4NNM A;  2DC2 A;  1N99 A;  4KFV A;  2YTW A;  2KL1 A;  1N7E A;  3CYY A;  3CH8 A;  4K72 A;  2JIN A;  2VPH A;  1R6J A;  2IWN A;  4NMT A;  2YT7 A;  1UF1 A;  3GGE A;  3OU0 A;  4EDJ A;  1UEW A;  2KA9 A;  2VSP A;  1W9Q A;  4UU5 A;  2KOH A;  2R3Y A;  3BPU A;  4FGM A;  2KQF A;  1U38 A;  3LNX A;  4HOP B;  3VQG A;  2D90 A;  3EGH C;  5E22 A;  2AIN A;  1WI4 A;  3WKL A;  4Q3H A;  4NMO A;  3TSV A;  3WKM A;  4UU6 A;  5G1D A;  1Y8T A;  4JOK A;  1OBX A;  4JOR A;  4G69 A;  4E34 A;  1KY9 A;  3SUZ A;  4NXQ A;  1L6O A;  4OEP A;  3KZE A;  2I6V A;  3GJ9 A;  1SOT A;  4K78 A;  1TP3 A;  1Q3P A;  3O5N A;  4OAJ A;  5HFD A;  5B6L A;  1P1E A;  2OS6 A;  1X5N A;  2K20 A;  1WF7 A;  2OCS A;  2LC7 A;  3PV5 A;  5EYZ A;  2DJT A;  3VQF A;  1NTE A;  4JOJ A;  2EGN A;  5FB8 C;  5G1E A;  2L4T A;  4RI0 A;  5HF1 A;  2FE5 A;  3CC0 A;  4JOG A;  1BE9 A;  2F0A A;  3JXT A;  1UM1 A;  1T2M A;  2VSV A;  1ZUB A;  3GSL A;  2KPL A;  3K50 A;  4KFW A;  1FC7 A;  3ID3 A;  2KAW A;  1XZ9 A;  5DTH A;  1FC9 A;  4REY A;  1ZOK A;  2VZ5 A;  3PDZ A;  1P1D A;  2HE4 A;  1UEP A;  1K32 A;  2DMZ A;  2AWW A;  1GM1 A;  1N7F A;  1D5G A;  4NMP A;  5HEY A;  3SOE A;  1V6B A;  1WIF A;  4Q2P A;  1N6E A;  2H3L A;  1LCY A;  3I4W A;  4PQW A;  4K76 A;  4Z33 A;  2OMJ A;  4HOP A;  2D8I A;  4JOH A;  4P2A B;  5HFB A;  2Z17 A;  2YUY A;  2M3M A;  4NMR A;  1UIT A;  2QKT A;  2UZC A;  4Q2O A;  1UEQ A;  1WHD A;  4Z8J A;  5E1Y A;  2IWQ A;  3K82 A;  4E3B A;  3RL7 A;  4NXR A;  2JWE A;  2HE2 A;  1Q3O A;  1MFL A;  1X8S A;  3SHU A;  2AWU A;  3HVQ C;  3ID4 A;  3RL8 A;  3CBY A;  4Q6S A;  1RGW A;  1UJV A;  2FNE A;  2H2B A;  3GDU A;  1V5L A;  2MHO A;  3NFK A;  1TE0 A;  1WH1 A;  4NMS A;  1X5R A;  2V1W A;  5HFE A;  4MPA A;  1Y7N A;  2DKR A;  4JOF A;  2EDZ A;  2P3W A;  1VA8 A;  1N6D A;  3DJ3 A;  2KJK A;  3QO6 A;  1KWA A;  4NXP A;  2IWO A;  3TSW A;  1WHA A;  3R69 A;  2FCF A;  2G2L A;  4K75 A;  5HJ1 A;  2M0U A;  3CS0 A;  2KJD A;  5HDY A;  2QKU A;  1WG6 A;  1WJL A;  2IWP A;  2KOM A;  3ID1 A;  2JIK A;  2VRF A;  1G9O A;  1BFE A;  2E7K A;  4GHN A;  2W7R A;  5F67 A;  2EEH A;  3B76 A;  2LOB A;  2V90 A;  2EHR A;  3R0H A;  3GDS A;  1MFG A;  3LNY A;  3K1R A;  2QG1 A;  3AXA A;  2OGP A;  3SHW A;  2RCZ A;  2M0V A;  2PA1 A;  2MX6 A;  1WFV A;  4GVD A;  1QAV B;  1FC6 A;  3TSZ A;  1UM7 A;  1V1T A;  2WL7 A;  3QJN A;  2JOA A;  2I4S A;  4YDP A;  3E17 A;  2O2T A;  5D13 A;  3SFJ A;  2RRM A;  5HEB A;  5HFF A;  5JXB A;  1X6D A;  2QBW A;  4O06 A;  3PV4 A;  2DM8 A;  2K1Z A;  2R4H A;  4WYU A;  4E35 A;  2F5Y A;  2KYL A;  5EZ0 A;  4Q2N A;  3QIK A;  2PNT A;  1KEF A;  1IU0 A;  1GQ5 A;  3QE1 A;  3CBX A;  1FCF A;  5E6P B;  2KPK A;  1V62 A;  3HPM A;  2PZD A;  1OBY A;  2EDV A;  1RZX A;  2YT8 A;  3I18 A;  1NF3 C;  2PKT A;  3DOR A;  2EJY A;  4JOP A;  1W9E A;  1N6F A;  2EGO A;  3NFL A;  2H3M A;  2Z9I A;  5H3J A;  2KOJ A;  2FN5 A;  1I92 A;  1UJD A;  1UFX A;  4JOE A;  2I0L A;  4YYX A;  2KG2 A;  1B8Q A;  1RGR A;  2EEI A;  2YUB A;  3FY5 A;  4JL7 A;  4Q2Q A;  1PDR A;  2JIL A;  3KZD A;  1OZI A;  2X7Z A;  1QAU A;  5GND A;  2LUI A;  2KRG A;  2CSJ A;  5FHT A;  2OZF A;  2PDZ A;  3L4F D;  2DLU A;  1UHP A;  3DIW A;  3DJ1 A;  2ENO A;  2ZPM A;  3GCN A;  5HF4 A;  2EAQ A;  1SOZ A;  2KJP A;  1U39 A;  2KV8 A;  3R68 A;  2EV8 A;  4XHV A;  3MH4 A;  3ID2 A;  2DB5 A;  3QDO A;  2BYG A;  1I16 A;  2GZV A;  3ZRT A;  1QAV A;  4NMQ A;  3QGL A;  3MH7 A;  3PV2 A;  3O46 A;  2D92 A;  4P0C A;  3CBZ A;  4F8K A;  3GCO A;  3PS4 A;  1Q7X A;  3NGH A;  2L4S A;  4NNL A;  3STJ A;  3GDV A;  2QT5 A;  2I1N A;  1IU2 A;  4WYT A;  2EGK A;  1GQ4 A;  4R2Z A;  2LA8 A;  5F3X A;  3KHF A;  2DLS A;  2M10 A;  1RY4 A;  4AMH A;  3QJM A;  2HGA A;  2LC6 A;  1UEZ A;  1TP5 A;  1WF8 A;  2KBS A;  2OSG A;  1Z86 A;  1VB7 A;  3HPK A;  4LMM A;  5E21 A;  5HFC A;  1VAE A;  2REY A;  1TQ3 A;  3RLE A;  5GLJ A;  5E11 A;  2M0Z A;  2CS5 A;  3MH6 A;  1W9O A;  1WFG A;  5A2P A;  3EGG C;  2G5M B;  2QKV A;  4Q6H A;  4H11 A;  2OPG A;  2EEJ A;  1X5Q A;  2EDP A;  2I04 A;  1YBO A;  2JXO A;  4K6Y A;  2EEG A;  1VCW A;  1N7T A;  2W4F A;  1MC7 A;  5HED A;  2AWX A;  4L8N A;  1UJU A;  2M0T A;  2Q9V A;  3OTP A;  3TMH A;  2DAZ A;  4N6X A;  1OBZ A; 
#chains in the Genus database with same CATH topology
 3PDV A;  1QLC A;  1Z87 A;  2CSS A;  1U37 A;  1VJ6 A;  2H2C A;  1X45 A;  2OQS A;  2Q3G A;  5HET A;  4NMV A;  4IC6 A;  2PKU A;  5I7Z A;  1M5Z A;  1WI2 A;  1V5Q A;  2VWR A;  4GVC A;  3I1E A;  2L97 A;  1U3B A;  4OEO A;  2JRE A;  1IHJ A;  2ZPL A;  3DJA A;  2EXG A;  2I0I A;  4NNM A;  2DC2 A;  1N99 A;  4KFV A;  2YTW A;  2KL1 A;  1N7E A;  3CYY A;  3CH8 A;  4K72 A;  2JIN A;  2VPH A;  1R6J A;  2IWN A;  4NMT A;  2YT7 A;  1UF1 A;  3GGE A;  3OU0 A;  4EDJ A;  1UEW A;  2KA9 A;  2VSP A;  1W9Q A;  4UU5 A;  2KOH A;  2R3Y A;  3BPU A;  4FGM A;  2KQF A;  1U38 A;  3LNX A;  4HOP B;  3VQG A;  2D90 A;  3EGH C;  5E22 A;  2AIN A;  1WI4 A;  3WKL A;  4Q3H A;  4NMO A;  3TSV A;  3WKM A;  4UU6 A;  4JJ3 A;  5G1D A;  5IL9 A;  1Y8T A;  4JOK A;  1OBX A;  4JOR A;  4G69 A;  4E34 A;  1KY9 A;  3SUZ A;  4NXQ A;  1L6O A;  4OEP A;  3KZE A;  1X9Z A;  2I6V A;  3GJ9 A;  1SOT A;  4K78 A;  1TP3 A;  1Q3P A;  3O5N A;  4OAJ A;  5HFD A;  5B6L A;  1P1E A;  2OS6 A;  1X5N A;  2K20 A;  1WF7 A;  2OCS A;  2LC7 A;  3PV5 A;  5EYZ A;  2DJT A;  3VQF A;  1NTE A;  4JOJ A;  2EGN A;  5FB8 C;  5G1E A;  2L4T A;  4RI0 A;  5HF1 A;  2FE5 A;  3CC0 A;  4JOG A;  1BE9 A;  2F0A A;  3JXT A;  1UM1 A;  1T2M A;  2VSV A;  1ZUB A;  3GSL A;  2KPL A;  3K50 A;  4KFW A;  3KDK A;  1FC7 A;  3ID3 A;  2KAW A;  1XZ9 A;  5DTH A;  1FC9 A;  4REY A;  1ZOK A;  2VZ5 A;  3PDZ A;  1P1D A;  2HE4 A;  1UEP A;  1K32 A;  2DMZ A;  2AWW A;  1GM1 A;  1N7F A;  1D5G A;  4NMP A;  5HEY A;  3SOE A;  1V6B A;  1WIF A;  4Q2P A;  1N6E A;  2H3L A;  1LCY A;  3I4W A;  4PQW A;  4K76 A;  4Z33 A;  2OMJ A;  4HOP A;  2D8I A;  4JOH A;  4P2A B;  5HFB A;  2Z17 A;  2YUY A;  2M3M A;  4NMR A;  1UIT A;  2QKT A;  4JJ0 A;  2UZC A;  4Q2O A;  1UEQ A;  1WHD A;  4Z8J A;  5E1Y A;  2IWQ A;  3K82 A;  4E3B A;  3RL7 A;  4NXR A;  2JWE A;  2HE2 A;  1Q3O A;  1MFL A;  1X8S A;  3SHU A;  2AWU A;  3HVQ C;  3ID4 A;  3RL8 A;  3CBY A;  4Q6S A;  1RGW A;  1UJV A;  2FNE A;  2H2B A;  3GDU A;  1V5L A;  2MHO A;  3NFK A;  1TE0 A;  1WH1 A;  4NMS A;  1X5R A;  2V1W A;  5HFE A;  4MPA A;  1Y7N A;  2DKR A;  4JOF A;  2EDZ A;  2GEF A;  2P3W A;  1VA8 A;  1N6D A;  3DJ3 A;  2KJK A;  3QO6 A;  1KWA A;  4NXP A;  2IWO A;  3TSW A;  1WHA A;  3R69 A;  2FCF A;  2G2L A;  4K75 A;  5HJ1 A;  2M0U A;  3CS0 A;  2KJD A;  5HDY A;  3NCV A;  2QKU A;  1WG6 A;  1WJL A;  2IWP A;  2KOM A;  3ID1 A;  2JIK A;  2VRF A;  1G9O A;  1BFE A;  2E7K A;  4GHN A;  2W7R A;  5F67 A;  2EEH A;  3B76 A;  2LOB A;  2V90 A;  2EHR A;  2JSN A;  3R0H A;  3GDS A;  1MFG A;  3LNY A;  3K1R A;  2QG1 A;  3AXA A;  2OGP A;  3SHW A;  3GAB A;  2RCZ A;  2M0V A;  2PA1 A;  2MX6 A;  1WFV A;  4GVD A;  1QAV B;  1FC6 A;  3TSZ A;  1UM7 A;  1V1T A;  2WL7 A;  3QJN A;  2JOA A;  2I4S A;  4YDP A;  3E17 A;  2O2T A;  5D13 A;  3SFJ A;  2RRM A;  5HEB A;  5HFF A;  5JXB A;  1X6D A;  2QBW A;  4O06 A;  3PV4 A;  2DM8 A;  2K1Z A;  2R4H A;  4WYU A;  4E35 A;  2F5Y A;  2KYL A;  5EZ0 A;  4Q2N A;  3QIK A;  2PNT A;  1KEF A;  1IU0 A;  1GQ5 A;  3QE1 A;  3CBX A;  1FCF A;  3KDG A;  5E6P B;  2KPK A;  1V62 A;  3HPM A;  2PZD A;  1OBY A;  2EDV A;  1RZX A;  2YT8 A;  3I18 A;  1NF3 C;  2PKT A;  3DOR A;  2EJY A;  5B42 A;  4JOP A;  1W9E A;  1N6F A;  2EGO A;  3NFL A;  2H3M A;  2Z9I A;  5H3J A;  2KOJ A;  2FN5 A;  1I92 A;  1UJD A;  1UFX A;  4FLN A;  4JOE A;  2I0L A;  4YYX A;  2KG2 A;  1B8Q A;  1RGR A;  2EEI A;  2YUB A;  3FY5 A;  4JL7 A;  4Q2Q A;  1PDR A;  2JIL A;  3KZD A;  1OZI A;  2X7Z A;  1QAU A;  5GND A;  2LUI A;  2KRG A;  2CSJ A;  5FHT A;  2OZF A;  2PDZ A;  3L4F D;  2DLU A;  1UHP A;  3DIW A;  3DJ1 A;  2ENO A;  2ZPM A;  3GCN A;  5HF4 A;  2EAQ A;  1SOZ A;  2KJP A;  1U39 A;  2KV8 A;  3R68 A;  2EV8 A;  4XHV A;  3MH4 A;  3ID2 A;  2DB5 A;  3QDO A;  2BYG A;  1I16 A;  2GZV A;  3ZRT A;  1QAV A;  4NMQ A;  3QGL A;  3MH7 A;  3PV2 A;  3O46 A;  2D92 A;  4P0C A;  3CBZ A;  4F8K A;  3GCO A;  3PS4 A;  1Q7X A;  3NGH A;  2L4S A;  4NNL A;  3STJ A;  3GDV A;  2QT5 A;  2I1N A;  1IU2 A;  4WYT A;  2EGK A;  1GQ4 A;  4R2Z A;  2LA8 A;  5F3X A;  3KHF A;  2DLS A;  2M10 A;  1RY4 A;  4AMH A;  3QJM A;  2HGA A;  2LC6 A;  1UEZ A;  1TP5 A;  1WF8 A;  2KBS A;  2OSG A;  1Z86 A;  1VB7 A;  3HPK A;  4LMM A;  5E21 A;  5HFC A;  1VAE A;  2REY A;  1TQ3 A;  3RLE A;  5GLJ A;  5ILB A;  5E11 A;  2M0Z A;  2CS5 A;  3MH6 A;  1W9O A;  1WFG A;  5A2P A;  3EGG C;  2G5M B;  2QKV A;  4Q6H A;  4H11 A;  2OPG A;  2EEJ A;  1X5Q A;  2EDP A;  2I04 A;  1YBO A;  2JXO A;  4K6Y A;  2EEG A;  1VCW A;  1N7T A;  2W4F A;  1MC7 A;  5HED A;  2AWX A;  4L8N A;  1UJU A;  2M0T A;  2Q9V A;  3OTP A;  3TMH A;  2DAZ A;  4N6X A;  1OBZ A; 
#chains in the Genus database with same CATH homology
 3PDV A;  1QLC A;  1Z87 A;  2CSS A;  1U37 A;  1VJ6 A;  2H2C A;  1X45 A;  2OQS A;  2Q3G A;  5HET A;  4NMV A;  4IC6 A;  2PKU A;  5I7Z A;  1M5Z A;  1WI2 A;  1V5Q A;  2VWR A;  4GVC A;  3I1E A;  2L97 A;  1U3B A;  4OEO A;  2JRE A;  1IHJ A;  2ZPL A;  3DJA A;  2EXG A;  2I0I A;  4NNM A;  2DC2 A;  1N99 A;  4KFV A;  2YTW A;  2KL1 A;  1N7E A;  3CYY A;  3CH8 A;  4K72 A;  2JIN A;  2VPH A;  1R6J A;  2IWN A;  4NMT A;  2YT7 A;  1UF1 A;  3GGE A;  3OU0 A;  4EDJ A;  1UEW A;  2KA9 A;  2VSP A;  1W9Q A;  4UU5 A;  2KOH A;  2R3Y A;  3BPU A;  4FGM A;  2KQF A;  1U38 A;  3LNX A;  4HOP B;  3VQG A;  2D90 A;  3EGH C;  5E22 A;  2AIN A;  1WI4 A;  3WKL A;  4Q3H A;  4NMO A;  3TSV A;  3WKM A;  4UU6 A;  4JJ3 A;  5G1D A;  5IL9 A;  1Y8T A;  4JOK A;  1OBX A;  4JOR A;  4G69 A;  4E34 A;  1KY9 A;  3SUZ A;  4NXQ A;  1L6O A;  4OEP A;  3KZE A;  1X9Z A;  2I6V A;  3GJ9 A;  1SOT A;  4K78 A;  1TP3 A;  1Q3P A;  3O5N A;  4OAJ A;  5HFD A;  5B6L A;  1P1E A;  2OS6 A;  1X5N A;  2K20 A;  1WF7 A;  2OCS A;  2LC7 A;  3PV5 A;  5EYZ A;  2DJT A;  3VQF A;  1NTE A;  4JOJ A;  2EGN A;  5FB8 C;  5G1E A;  2L4T A;  4RI0 A;  5HF1 A;  2FE5 A;  3CC0 A;  4JOG A;  1BE9 A;  2F0A A;  3JXT A;  1UM1 A;  1T2M A;  2VSV A;  1ZUB A;  3GSL A;  2KPL A;  3K50 A;  4KFW A;  3KDK A;  1FC7 A;  3ID3 A;  2KAW A;  1XZ9 A;  5DTH A;  1FC9 A;  4REY A;  1ZOK A;  2VZ5 A;  3PDZ A;  1P1D A;  2HE4 A;  1UEP A;  1K32 A;  2DMZ A;  2AWW A;  1GM1 A;  1N7F A;  1D5G A;  4NMP A;  5HEY A;  3SOE A;  1V6B A;  1WIF A;  4Q2P A;  1N6E A;  2H3L A;  1LCY A;  3I4W A;  4PQW A;  4K76 A;  4Z33 A;  2OMJ A;  4HOP A;  2D8I A;  4JOH A;  4P2A B;  5HFB A;  2Z17 A;  2YUY A;  2M3M A;  4NMR A;  1UIT A;  2QKT A;  4JJ0 A;  2UZC A;  4Q2O A;  1UEQ A;  1WHD A;  4Z8J A;  5E1Y A;  2IWQ A;  3K82 A;  4E3B A;  3RL7 A;  4NXR A;  2JWE A;  2HE2 A;  1Q3O A;  1MFL A;  1X8S A;  3SHU A;  2AWU A;  3HVQ C;  3ID4 A;  3RL8 A;  3CBY A;  4Q6S A;  1RGW A;  1UJV A;  2FNE A;  2H2B A;  3GDU A;  1V5L A;  2MHO A;  3NFK A;  1TE0 A;  1WH1 A;  4NMS A;  1X5R A;  2V1W A;  5HFE A;  4MPA A;  1Y7N A;  2DKR A;  4JOF A;  2EDZ A;  2GEF A;  2P3W A;  1VA8 A;  1N6D A;  3DJ3 A;  2KJK A;  3QO6 A;  1KWA A;  4NXP A;  2IWO A;  3TSW A;  1WHA A;  3R69 A;  2FCF A;  2G2L A;  4K75 A;  5HJ1 A;  2M0U A;  3CS0 A;  2KJD A;  5HDY A;  3NCV A;  2QKU A;  1WG6 A;  1WJL A;  2IWP A;  2KOM A;  3ID1 A;  2JIK A;  2VRF A;  1G9O A;  1BFE A;  2E7K A;  4GHN A;  2W7R A;  5F67 A;  2EEH A;  3B76 A;  2LOB A;  2V90 A;  2EHR A;  2JSN A;  3R0H A;  3GDS A;  1MFG A;  3LNY A;  3K1R A;  2QG1 A;  3AXA A;  2OGP A;  3SHW A;  3GAB A;  2RCZ A;  2M0V A;  2PA1 A;  2MX6 A;  1WFV A;  4GVD A;  1QAV B;  1FC6 A;  3TSZ A;  1UM7 A;  1V1T A;  2WL7 A;  3QJN A;  2JOA A;  2I4S A;  4YDP A;  3E17 A;  2O2T A;  5D13 A;  3SFJ A;  2RRM A;  5HEB A;  5HFF A;  5JXB A;  1X6D A;  2QBW A;  4O06 A;  3PV4 A;  2DM8 A;  2K1Z A;  2R4H A;  4WYU A;  4E35 A;  2F5Y A;  2KYL A;  5EZ0 A;  4Q2N A;  3QIK A;  2PNT A;  1KEF A;  1IU0 A;  1GQ5 A;  3QE1 A;  3CBX A;  1FCF A;  3KDG A;  5E6P B;  2KPK A;  1V62 A;  3HPM A;  2PZD A;  1OBY A;  2EDV A;  1RZX A;  2YT8 A;  3I18 A;  1NF3 C;  2PKT A;  3DOR A;  2EJY A;  5B42 A;  4JOP A;  1W9E A;  1N6F A;  2EGO A;  3NFL A;  2H3M A;  2Z9I A;  5H3J A;  2KOJ A;  2FN5 A;  1I92 A;  1UJD A;  1UFX A;  4FLN A;  4JOE A;  2I0L A;  4YYX A;  2KG2 A;  1B8Q A;  1RGR A;  2EEI A;  2YUB A;  3FY5 A;  4JL7 A;  4Q2Q A;  1PDR A;  2JIL A;  3KZD A;  1OZI A;  2X7Z A;  1QAU A;  5GND A;  2LUI A;  2KRG A;  2CSJ A;  5FHT A;  2OZF A;  2PDZ A;  3L4F D;  2DLU A;  1UHP A;  3DIW A;  3DJ1 A;  2ENO A;  2ZPM A;  3GCN A;  5HF4 A;  2EAQ A;  1SOZ A;  2KJP A;  1U39 A;  2KV8 A;  3R68 A;  2EV8 A;  4XHV A;  3MH4 A;  3ID2 A;  2DB5 A;  3QDO A;  2BYG A;  1I16 A;  2GZV A;  3ZRT A;  1QAV A;  4NMQ A;  3QGL A;  3MH7 A;  3PV2 A;  3O46 A;  2D92 A;  4P0C A;  3CBZ A;  4F8K A;  3GCO A;  3PS4 A;  1Q7X A;  3NGH A;  2L4S A;  4NNL A;  3STJ A;  3GDV A;  2QT5 A;  2I1N A;  1IU2 A;  4WYT A;  2EGK A;  1GQ4 A;  4R2Z A;  2LA8 A;  5F3X A;  3KHF A;  2DLS A;  2M10 A;  1RY4 A;  4AMH A;  3QJM A;  2HGA A;  2LC6 A;  1UEZ A;  1TP5 A;  1WF8 A;  2KBS A;  2OSG A;  1Z86 A;  1VB7 A;  3HPK A;  4LMM A;  5E21 A;  5HFC A;  1VAE A;  2REY A;  1TQ3 A;  3RLE A;  5GLJ A;  5ILB A;  5E11 A;  2M0Z A;  2CS5 A;  3MH6 A;  1W9O A;  1WFG A;  5A2P A;  3EGG C;  2G5M B;  2QKV A;  4Q6H A;  4H11 A;  2OPG A;  2EEJ A;  1X5Q A;  2EDP A;  2I04 A;  1YBO A;  2JXO A;  4K6Y A;  2EEG A;  1VCW A;  1N7T A;  2W4F A;  1MC7 A;  5HED A;  2AWX A;  4L8N A;  1UJU A;  2M0T A;  2Q9V A;  3OTP A;  3TMH A;  2DAZ A;  4N6X A;  1OBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...