4NXRA

Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz domain quadruple mutant (qm) in complex with neurexin-1 peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMMEDFFSQPSVGLLVRTYPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 1
publication title Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 21
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nxrA00
2JINA 1Y8TA 1YBOA 3K50A 2JXOA 4Q2PA 1WHDA 2KRGA 1TE0A 2IWPA 3GDSA 3TMHA 1V1TA 2KL1A 2R3YA 2WL7A 2O2TA 3WKLA 2EAQA 2H3LA 1P1DA 1UJVA 3SHWA 4Q2OA 3CC0A 4NNMA 4JL7A 5HEDA 4MPAA 1QLCA 2D90A 3QJNA 5G1EA 5HJ1A 5HDYA 1G9OA 1L6OA 3KZEA 2LUIA 2I1NA 1FC7A 4Q2NA 1Q3PA 1BE9A 1UEWA 4Z8JA 1MFLA 3KHFA 1NF3C 4Q3HA 1RZXA 3CBYA 4FGMA 2EHRA 2W7RA 3R68A 4WYUA 2M0UA 2OMJA 2QKVA 1SOTA 2EDPA 2PKTA 5E21A 4E35A 2HGAA 2DC2A 4NMPA 3RL8A 3ZRTA 2QKUA 2EEIA 5E11A 3RL7A 2EEJA 2IWNA 3WKMA 2I6VA 1X8SA 3QO6A 5DTHA 2JREA 1TP5A 1WFVA 3MH4A 1OBXA 1WJLA 4GVDA 3SFJA 1KY9A 3R69A 4GHNA 2HE2A 3RLEA 4OEOA 5HEYA 2V90A 4E3BA 2D8IA 4K6YA 1X5RA 1OZIA 1N6DA 4EDJA 3CYYA 4HOPA 2M10A 1VJ6A 4YYXA 1VAEA 4Z33A 1MC7A 1UJDA 3NFLA 1X6DA 1QAUA 3CS0A 3PV2A 2IWOA 3EGHC 2H3MA 4NMQA 4PQWA 1Q3OA 1W9EA 1GQ4A 3DJ1A 1KWAA 2P3WA 4JOEA 1OBZA 1V6BA 2K1ZA 3GJ9A 1XZ9A 2V1WA 1UEPA 3DIWA 3MH7A 1WG6A 2EDVA 3GDUA 3TSZA 3CBZA 5H3JA 1PDRA 2EV8A 2CSSA 2REYA 1UITA 2EDZA 3QDOA 3OU0A 4OEPA 1N99A 2UZCA 2DJTA 4NMVA 3VQGA 5D13A 3K1RA 1VB7A 5G1DA 2ZPLA 2DB5A 5F67A 1K32A 3VQFA 4JORA 1UEQA 4F8KA 2OPGA 1Y7NA 3SUZA 2X7ZA 4P2AB 4NXQA 2FN5A 3KZDA 3B76A 5F3XA 2L4SA 3HPKA 2ENOA 1D5GA 3STJA 3PV4A 2DKRA 2Z17A 4KFWA 2OSGA 4UU6A 2EEGA 3ID2A 2AWXA 1GQ5A 2M0VA 2JOAA 1IU2A 2KOJA 1WFGA 1UFXA 4Q6SA 2M0TA 3DJAA 2Q3GA 2IWQA 1LCYA 1FC6A 3NFKA 5B6LA 5HEBA 3E17A 3PV5A 3QE1A 3R0HA 2H2BA 4Q6HA 2QBWA 3K82A 4GVCA 1N6EA 4WYTA 2D92A 1WI4A 2BYGA 3TSVA 2LC7A 4E34A 2RRMA 4O06A 1WF8A 2VSPA 1WHAA 2QT5A 4KFVA 4K78A 1Z86A 5A2PA 2L97A 3GCNA 4Q2QA 1OBYA 2ZPMA 1UF1A 5HFCA 1X5NA 2PDZA 1Q7XA 1P1EA 4NMTA 2DLSA 2MX6A 4NNLA 1WI2A 3JXTA 2KAWA 2JILA 1FC9A 4NMRA 2DAZA 3OTPA 2KV8A 1QAVA 2CSJA 2KJKA 4JOGA 3GSLA 5GLJA 1UM7A 2K20A 1UHPA 3HVQC 2AWUA 1ZOKA 2F0AA 3DORA 1W9OA 4HOPB 2GZVA 2LA8A 5I7ZA 4UU5A 4YDPA 2I4SA 1WF7A 2KA9A 2Q9VA 3FY5A 2W4FA 2AINA 5E6PB 5EZ0A 2PZDA 1TP3A 1I92A 1SOZA 2QKTA 1FCFA 4NXPA 2OCSA 2F5YA 1UEZA 2QG1A 3I1EA 4K76A 5FB8C 1WH1A 1UM1A 1V5LA 4L8NA 2PKUA 2M3MA 2OS6A 2Z9IA 3CBXA 2OQSA 1RGWA 1TQ3A 4JOFA 4NMOA 3SOEA 3I18A 2HE4A 4K72A 5HFDA 3BPUA 5HF4A 2KOHA 2DLUA 4REYA 2EGNA 1IU0A 2I04A 1T2MA 2EGOA 1U3BA 3O46A 2KJPA 3QGLA 4N6XA 2DM8A 3GCOA 2JIKA 2MHOA 1RGRA 3PDVA 5JXBA 3AXAA 3I4WA 1N6FA 2H2CA 5HFFA 2PA1A 4H11A 3DJ3A 1RY4A 2VPHA 3NGHA 1R6JA 1W9QA 2I0IA 3LNXA 1VA8A 2EEHA 2FCFA 3CH8A 2AWWA 4R2ZA 2KYLA 2FE5A 1MFGA 4RI0A 4NXRA 1GM1A 5E22A 1KEFA 1VCWA 2KG2A 3SHUA 4NMSA 2KPLA 4JOHA 2YUYA 1M5ZA 1V62A 1N7EA 1X5QA 1WIFA 4K75A 2G5MB 2YT8A 1U39A 3PDZA 4XHVA 3ID3A 2LOBA 3L4FD 1X45A 3GGEA 3ID4A 5HFEA 2EJYA 2G2LA 1UJUA 3TSWA 1NTEA 2R4HA 2PNTA 2YUBA 4JOPA 1Z87A 5E1YA 4OAJA 1U38A 3EGGC 4JOJA 4JOKA 2KQFA 2YTWA 1IHJA 3PS4A 2LC6A 1QAVB 4IC6A 2KBSA 5HETA 2KOMA 2OZFA 2L4TA 2EGKA 3ID1A 2VSVA 3HPMA 4AMHA 2FNEA 2VRFA 3QIKA 2JWEA 1U37A 3O5NA 1I16A 5FHTA 2VZ5A 2OGPA 2EXGA 1B8QA 1N7TA 1BFEA 3QJMA 5HF1A 2M0ZA 3LNYA 2I0LA 2YT7A 2VWRA 2DMZA 2RCZA 1ZUBA 3GDVA 2CS5A 4G69A 3MH6A 4LMMA 1V5QA 5GNDA 2KPKA 5EYZA 2KJDA 1N7FA 5HFBA 4P0CA 2E7KA
chains in the Genus database with same CATH superfamily
2JINA 1Y8TA 1YBOA 3K50A 2JXOA 4Q2PA 1WHDA 2KRGA 1TE0A 2IWPA 3GDSA 3TMHA 1V1TA 2KL1A 2R3YA 2WL7A 2O2TA 3WKLA 4JJ0A 2EAQA 2H3LA 1P1DA 1UJVA 3SHWA 4Q2OA 3CC0A 4NNMA 4JL7A 5HEDA 4MPAA 1QLCA 2D90A 3QJNA 5G1EA 5HJ1A 5HDYA 1G9OA 1L6OA 3KZEA 2LUIA 2I1NA 1FC7A 4Q2NA 1Q3PA 1BE9A 1UEWA 4Z8JA 1MFLA 2GEFA 3KHFA 1NF3C 4Q3HA 1RZXA 3CBYA 4FGMA 2EHRA 2W7RA 3R68A 4WYUA 2M0UA 2OMJA 2QKVA 1SOTA 2EDPA 2PKTA 5E21A 4E35A 2HGAA 2DC2A 4NMPA 3RL8A 3ZRTA 2QKUA 2EEIA 5E11A 3RL7A 2EEJA 2IWNA 3WKMA 2I6VA 1X8SA 3QO6A 5DTHA 2JREA 1TP5A 1WFVA 3MH4A 1OBXA 1WJLA 4GVDA 3SFJA 1KY9A 3R69A 4GHNA 2HE2A 3RLEA 4OEOA 5HEYA 5B42A 2V90A 4E3BA 2D8IA 4K6YA 1X5RA 1OZIA 1N6DA 4EDJA 3CYYA 4HOPA 2M10A 1VJ6A 4YYXA 1VAEA 4Z33A 1MC7A 1UJDA 3NFLA 1X6DA 1QAUA 3CS0A 3PV2A 2IWOA 3EGHC 2H3MA 4NMQA 4PQWA 1Q3OA 1W9EA 1GQ4A 3DJ1A 1KWAA 2P3WA 4JOEA 1OBZA 1V6BA 2K1ZA 3GJ9A 1XZ9A 2V1WA 1UEPA 3DIWA 3MH7A 1WG6A 2EDVA 3GDUA 3TSZA 3CBZA 5H3JA 1PDRA 2EV8A 2CSSA 2REYA 1UITA 2EDZA 3QDOA 3OU0A 4OEPA 1N99A 2UZCA 2DJTA 4NMVA 3VQGA 5D13A 3K1RA 1VB7A 5G1DA 2ZPLA 2DB5A 5F67A 1K32A 3VQFA 4JORA 1UEQA 4F8KA 2OPGA 1Y7NA 3SUZA 2X7ZA 4P2AB 4NXQA 2FN5A 3KZDA 3B76A 5F3XA 2L4SA 3HPKA 2ENOA 1D5GA 5ILBA 3STJA 3PV4A 2DKRA 2Z17A 4KFWA 2OSGA 4UU6A 2EEGA 3ID2A 2AWXA 1GQ5A 2M0VA 2JOAA 1IU2A 2KOJA 1WFGA 1UFXA 4Q6SA 2M0TA 3DJAA 2Q3GA 2IWQA 1LCYA 1FC6A 3NFKA 5B6LA 5HEBA 3E17A 3KDKA 3PV5A 3QE1A 3R0HA 2H2BA 4Q6HA 2QBWA 3K82A 4GVCA 1N6EA 4WYTA 2D92A 1WI4A 2BYGA 3TSVA 2LC7A 4E34A 2RRMA 4O06A 1WF8A 2VSPA 1WHAA 2QT5A 4KFVA 2JSNA 4K78A 1Z86A 5A2PA 2L97A 3GCNA 4Q2QA 1OBYA 2ZPMA 1UF1A 5HFCA 1X5NA 2PDZA 1Q7XA 1P1EA 4NMTA 2DLSA 2MX6A 4NNLA 1WI2A 3JXTA 2KAWA 2JILA 1FC9A 4NMRA 2DAZA 3OTPA 2KV8A 1QAVA 2CSJA 2KJKA 4JOGA 3GSLA 5GLJA 1UM7A 2K20A 1UHPA 3HVQC 2AWUA 1ZOKA 2F0AA 3DORA 1W9OA 4HOPB 2GZVA 2LA8A 5I7ZA 4UU5A 4YDPA 4JJ3A 2I4SA 1WF7A 2KA9A 2Q9VA 3FY5A 2W4FA 2AINA 5E6PB 5EZ0A 2PZDA 1TP3A 1I92A 1SOZA 2QKTA 1FCFA 4NXPA 2OCSA 2F5YA 1UEZA 2QG1A 3I1EA 4K76A 5FB8C 1WH1A 1UM1A 1V5LA 4L8NA 2PKUA 5IL9A 2M3MA 2OS6A 2Z9IA 3CBXA 2OQSA 3GABA 1X9ZA 1RGWA 1TQ3A 4JOFA 4NMOA 3SOEA 3I18A 2HE4A 4K72A 5HFDA 3BPUA 5HF4A 2KOHA 2DLUA 4REYA 2EGNA 1IU0A 2I04A 1T2MA 2EGOA 1U3BA 3O46A 2KJPA 3QGLA 4N6XA 2DM8A 4FLNA 3GCOA 2JIKA 2MHOA 1RGRA 3PDVA 5JXBA 3AXAA 3I4WA 1N6FA 2H2CA 5HFFA 2PA1A 4H11A 3DJ3A 1RY4A 2VPHA 3NGHA 1R6JA 1W9QA 2I0IA 3LNXA 1VA8A 2EEHA 2FCFA 3CH8A 2AWWA 4R2ZA 2KYLA 2FE5A 1MFGA 4RI0A 4NXRA 1GM1A 5E22A 1KEFA 1VCWA 2KG2A 3SHUA 4NMSA 2KPLA 4JOHA 2YUYA 1M5ZA 1V62A 1N7EA 1X5QA 1WIFA 4K75A 2G5MB 2YT8A 1U39A 3PDZA 4XHVA 3ID3A 2LOBA 3L4FD 1X45A 3GGEA 3ID4A 5HFEA 2EJYA 2G2LA 1UJUA 3TSWA 1NTEA 2R4HA 2PNTA 2YUBA 4JOPA 1Z87A 5E1YA 4OAJA 1U38A 3EGGC 4JOJA 4JOKA 2KQFA 2YTWA 1IHJA 3PS4A 2LC6A 1QAVB 4IC6A 2KBSA 5HETA 2KOMA 2OZFA 2L4TA 2EGKA 3ID1A 2VSVA 3HPMA 4AMHA 2FNEA 2VRFA 3QIKA 2JWEA 1U37A 3O5NA 3NCVA 1I16A 3KDGA 5FHTA 2VZ5A 2OGPA 2EXGA 1B8QA 1N7TA 1BFEA 3QJMA 5HF1A 2M0ZA 3LNYA 2I0LA 2YT7A 2VWRA 2DMZA 2RCZA 1ZUBA 3GDVA 2CS5A 4G69A 3MH6A 4LMMA 1V5QA 5GNDA 2KPKA 5EYZA 2KJDA 1N7FA 5HFBA 4P0CA 2E7KA
chains in the Genus database with same CATH topology
2JINA 1Y8TA 1YBOA 3K50A 2JXOA 4Q2PA 1WHDA 2KRGA 1TE0A 2IWPA 3GDSA 3TMHA 1V1TA 2KL1A 2R3YA 2WL7A 2O2TA 3WKLA 4JJ0A 2EAQA 2H3LA 1P1DA 1UJVA 3SHWA 4Q2OA 3CC0A 4NNMA 4JL7A 5HEDA 4MPAA 1QLCA 2D90A 3QJNA 5G1EA 5HJ1A 5HDYA 1G9OA 1L6OA 3KZEA 2LUIA 2I1NA 1FC7A 4Q2NA 1Q3PA 1BE9A 1UEWA 4Z8JA 1MFLA 2GEFA 3KHFA 1NF3C 4Q3HA 1RZXA 3CBYA 4FGMA 2EHRA 2W7RA 3R68A 4WYUA 2M0UA 2OMJA 2QKVA 1SOTA 2EDPA 2PKTA 5E21A 4E35A 2HGAA 2DC2A 4NMPA 3RL8A 3ZRTA 2QKUA 2EEIA 5E11A 3RL7A 2EEJA 2IWNA 3WKMA 2I6VA 1X8SA 3QO6A 5DTHA 2JREA 1TP5A 1WFVA 3MH4A 1OBXA 1WJLA 4GVDA 3SFJA 1KY9A 3R69A 4GHNA 2HE2A 3RLEA 4OEOA 5HEYA 5B42A 2V90A 4E3BA 2D8IA 4K6YA 1X5RA 1OZIA 1N6DA 4EDJA 3CYYA 4HOPA 2M10A 1VJ6A 4YYXA 1VAEA 4Z33A 1MC7A 1UJDA 3NFLA 1X6DA 1QAUA 3CS0A 3PV2A 2IWOA 3EGHC 2H3MA 4NMQA 4PQWA 1Q3OA 1W9EA 1GQ4A 3DJ1A 1KWAA 2P3WA 4JOEA 1OBZA 1V6BA 2K1ZA 3GJ9A 1XZ9A 2V1WA 1UEPA 3DIWA 3MH7A 1WG6A 2EDVA 3GDUA 3TSZA 3CBZA 5H3JA 1PDRA 2EV8A 2CSSA 2REYA 1UITA 2EDZA 3QDOA 3OU0A 4OEPA 1N99A 2UZCA 2DJTA 4NMVA 3VQGA 5D13A 3K1RA 1VB7A 5G1DA 2ZPLA 2DB5A 5F67A 1K32A 3VQFA 4JORA 1UEQA 4F8KA 2OPGA 1Y7NA 3SUZA 2X7ZA 4P2AB 4NXQA 2FN5A 3KZDA 3B76A 5F3XA 2L4SA 3HPKA 2ENOA 1D5GA 5ILBA 3STJA 3PV4A 2DKRA 2Z17A 4KFWA 2OSGA 4UU6A 2EEGA 3ID2A 2AWXA 1GQ5A 2M0VA 2JOAA 1IU2A 2KOJA 1WFGA 1UFXA 4Q6SA 2M0TA 3DJAA 2Q3GA 2IWQA 1LCYA 1FC6A 3NFKA 5B6LA 5HEBA 3E17A 3KDKA 3PV5A 3QE1A 3R0HA 2H2BA 4Q6HA 2QBWA 3K82A 4GVCA 1N6EA 4WYTA 2D92A 1WI4A 2BYGA 3TSVA 2LC7A 4E34A 2RRMA 4O06A 1WF8A 2VSPA 1WHAA 2QT5A 4KFVA 2JSNA 4K78A 1Z86A 5A2PA 2L97A 3GCNA 4Q2QA 1OBYA 2ZPMA 1UF1A 5HFCA 1X5NA 2PDZA 1Q7XA 1P1EA 4NMTA 2DLSA 2MX6A 4NNLA 1WI2A 3JXTA 2KAWA 2JILA 1FC9A 4NMRA 2DAZA 3OTPA 2KV8A 1QAVA 2CSJA 2KJKA 4JOGA 3GSLA 5GLJA 1UM7A 2K20A 1UHPA 3HVQC 2AWUA 1ZOKA 2F0AA 3DORA 1W9OA 4HOPB 2GZVA 2LA8A 5I7ZA 4UU5A 4YDPA 4JJ3A 2I4SA 1WF7A 2KA9A 2Q9VA 3FY5A 2W4FA 2AINA 5E6PB 5EZ0A 2PZDA 1TP3A 1I92A 1SOZA 2QKTA 1FCFA 4NXPA 2OCSA 2F5YA 1UEZA 2QG1A 3I1EA 4K76A 5FB8C 1WH1A 1UM1A 1V5LA 4L8NA 2PKUA 5IL9A 2M3MA 2OS6A 2Z9IA 3CBXA 2OQSA 3GABA 1X9ZA 1RGWA 1TQ3A 4JOFA 4NMOA 3SOEA 3I18A 2HE4A 4K72A 5HFDA 3BPUA 5HF4A 2KOHA 2DLUA 4REYA 2EGNA 1IU0A 2I04A 1T2MA 2EGOA 1U3BA 3O46A 2KJPA 3QGLA 4N6XA 2DM8A 4FLNA 3GCOA 2JIKA 2MHOA 1RGRA 3PDVA 5JXBA 3AXAA 3I4WA 1N6FA 2H2CA 5HFFA 2PA1A 4H11A 3DJ3A 1RY4A 2VPHA 3NGHA 1R6JA 1W9QA 2I0IA 3LNXA 1VA8A 2EEHA 2FCFA 3CH8A 2AWWA 4R2ZA 2KYLA 2FE5A 1MFGA 4RI0A 4NXRA 1GM1A 5E22A 1KEFA 1VCWA 2KG2A 3SHUA 4NMSA 2KPLA 4JOHA 2YUYA 1M5ZA 1V62A 1N7EA 1X5QA 1WIFA 4K75A 2G5MB 2YT8A 1U39A 3PDZA 4XHVA 3ID3A 2LOBA 3L4FD 1X45A 3GGEA 3ID4A 5HFEA 2EJYA 2G2LA 1UJUA 3TSWA 1NTEA 2R4HA 2PNTA 2YUBA 4JOPA 1Z87A 5E1YA 4OAJA 1U38A 3EGGC 4JOJA 4JOKA 2KQFA 2YTWA 1IHJA 3PS4A 2LC6A 1QAVB 4IC6A 2KBSA 5HETA 2KOMA 2OZFA 2L4TA 2EGKA 3ID1A 2VSVA 3HPMA 4AMHA 2FNEA 2VRFA 3QIKA 2JWEA 1U37A 3O5NA 3NCVA 1I16A 3KDGA 5FHTA 2VZ5A 2OGPA 2EXGA 1B8QA 1N7TA 1BFEA 3QJMA 5HF1A 2M0ZA 3LNYA 2I0LA 2YT7A 2VWRA 2DMZA 2RCZA 1ZUBA 3GDVA 2CS5A 4G69A 3MH6A 4LMMA 1V5QA 5GNDA 2KPKA 5EYZA 2KJDA 1N7FA 5HFBA 4P0CA 2E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIN A;  1Y8T A;  1YBO A;  3K50 A;  2JXO A;  4Q2P A;  1WHD A;  2KRG A;  1TE0 A;  2IWP A;  3GDS A;  3TMH A;  1V1T A;  2KL1 A;  2R3Y A;  2WL7 A;  2O2T A;  3WKL A;  2EAQ A;  2H3L A;  1P1D A;  1UJV A;  3SHW A;  4Q2O A;  3CC0 A;  4NNM A;  4JL7 A;  5HED A;  4MPA A;  1QLC A;  2D90 A;  3QJN A;  5G1E A;  5HJ1 A;  5HDY A;  1G9O A;  1L6O A;  3KZE A;  2LUI A;  2I1N A;  1FC7 A;  4Q2N A;  1Q3P A;  1BE9 A;  1UEW A;  4Z8J A;  1MFL A;  3KHF A;  1NF3 C;  4Q3H A;  1RZX A;  3CBY A;  4FGM A;  2EHR A;  2W7R A;  3R68 A;  4WYU A;  2M0U A;  2OMJ A;  2QKV A;  1SOT A;  2EDP A;  2PKT A;  5E21 A;  4E35 A;  2HGA A;  2DC2 A;  4NMP A;  3RL8 A;  3ZRT A;  2QKU A;  2EEI A;  5E11 A;  3RL7 A;  2EEJ A;  2IWN A;  3WKM A;  2I6V A;  1X8S A;  3QO6 A;  5DTH A;  2JRE A;  1TP5 A;  1WFV A;  3MH4 A;  1OBX A;  1WJL A;  4GVD A;  3SFJ A;  1KY9 A;  3R69 A;  4GHN A;  2HE2 A;  3RLE A;  4OEO A;  5HEY A;  2V90 A;  4E3B A;  2D8I A;  4K6Y A;  1X5R A;  1OZI A;  1N6D A;  4EDJ A;  3CYY A;  4HOP A;  2M10 A;  1VJ6 A;  4YYX A;  1VAE A;  4Z33 A;  1MC7 A;  1UJD A;  3NFL A;  1X6D A;  1QAU A;  3CS0 A;  3PV2 A;  2IWO A;  3EGH C;  2H3M A;  4NMQ A;  4PQW A;  1Q3O A;  1W9E A;  1GQ4 A;  3DJ1 A;  1KWA A;  2P3W A;  4JOE A;  1OBZ A;  1V6B A;  2K1Z A;  3GJ9 A;  1XZ9 A;  2V1W A;  1UEP A;  3DIW A;  3MH7 A;  1WG6 A;  2EDV A;  3GDU A;  3TSZ A;  3CBZ A;  5H3J A;  1PDR A;  2EV8 A;  2CSS A;  2REY A;  1UIT A;  2EDZ A;  3QDO A;  3OU0 A;  4OEP A;  1N99 A;  2UZC A;  2DJT A;  4NMV A;  3VQG A;  5D13 A;  3K1R A;  1VB7 A;  5G1D A;  2ZPL A;  2DB5 A;  5F67 A;  1K32 A;  3VQF A;  4JOR A;  1UEQ A;  4F8K A;  2OPG A;  1Y7N A;  3SUZ A;  2X7Z A;  4P2A B;  4NXQ A;  2FN5 A;  3KZD A;  3B76 A;  5F3X A;  2L4S A;  3HPK A;  2ENO A;  1D5G A;  3STJ A;  3PV4 A;  2DKR A;  2Z17 A;  4KFW A;  2OSG A;  4UU6 A;  2EEG A;  3ID2 A;  2AWX A;  1GQ5 A;  2M0V A;  2JOA A;  1IU2 A;  2KOJ A;  1WFG A;  1UFX A;  4Q6S A;  2M0T A;  3DJA A;  2Q3G A;  2IWQ A;  1LCY A;  1FC6 A;  3NFK A;  5B6L A;  5HEB A;  3E17 A;  3PV5 A;  3QE1 A;  3R0H A;  2H2B A;  4Q6H A;  2QBW A;  3K82 A;  4GVC A;  1N6E A;  4WYT A;  2D92 A;  1WI4 A;  2BYG A;  3TSV A;  2LC7 A;  4E34 A;  2RRM A;  4O06 A;  1WF8 A;  2VSP A;  1WHA A;  2QT5 A;  4KFV A;  4K78 A;  1Z86 A;  5A2P A;  2L97 A;  3GCN A;  4Q2Q A;  1OBY A;  2ZPM A;  1UF1 A;  5HFC A;  1X5N A;  2PDZ A;  1Q7X A;  1P1E A;  4NMT A;  2DLS A;  2MX6 A;  4NNL A;  1WI2 A;  3JXT A;  2KAW A;  2JIL A;  1FC9 A;  4NMR A;  2DAZ A;  3OTP A;  2KV8 A;  1QAV A;  2CSJ A;  2KJK A;  4JOG A;  3GSL A;  5GLJ A;  1UM7 A;  2K20 A;  1UHP A;  3HVQ C;  2AWU A;  1ZOK A;  2F0A A;  3DOR A;  1W9O A;  4HOP B;  2GZV A;  2LA8 A;  5I7Z A;  4UU5 A;  4YDP A;  2I4S A;  1WF7 A;  2KA9 A;  2Q9V A;  3FY5 A;  2W4F A;  2AIN A;  5E6P B;  5EZ0 A;  2PZD A;  1TP3 A;  1I92 A;  1SOZ A;  2QKT A;  1FCF A;  4NXP A;  2OCS A;  2F5Y A;  1UEZ A;  2QG1 A;  3I1E A;  4K76 A;  5FB8 C;  1WH1 A;  1UM1 A;  1V5L A;  4L8N A;  2PKU A;  2M3M A;  2OS6 A;  2Z9I A;  3CBX A;  2OQS A;  1RGW A;  1TQ3 A;  4JOF A;  4NMO A;  3SOE A;  3I18 A;  2HE4 A;  4K72 A;  5HFD A;  3BPU A;  5HF4 A;  2KOH A;  2DLU A;  4REY A;  2EGN A;  1IU0 A;  2I04 A;  1T2M A;  2EGO A;  1U3B A;  3O46 A;  2KJP A;  3QGL A;  4N6X A;  2DM8 A;  3GCO A;  2JIK A;  2MHO A;  1RGR A;  3PDV A;  5JXB A;  3AXA A;  3I4W A;  1N6F A;  2H2C A;  5HFF A;  2PA1 A;  4H11 A;  3DJ3 A;  1RY4 A;  2VPH A;  3NGH A;  1R6J A;  1W9Q A;  2I0I A;  3LNX A;  1VA8 A;  2EEH A;  2FCF A;  3CH8 A;  2AWW A;  4R2Z A;  2KYL A;  2FE5 A;  1MFG A;  4RI0 A;  4NXR A;  1GM1 A;  5E22 A;  1KEF A;  1VCW A;  2KG2 A;  3SHU A;  4NMS A;  2KPL A;  4JOH A;  2YUY A;  1M5Z A;  1V62 A;  1N7E A;  1X5Q A;  1WIF A;  4K75 A;  2G5M B;  2YT8 A;  1U39 A;  3PDZ A;  4XHV A;  3ID3 A;  2LOB A;  3L4F D;  1X45 A;  3GGE A;  3ID4 A;  5HFE A;  2EJY A;  2G2L A;  1UJU A;  3TSW A;  1NTE A;  2R4H A;  2PNT A;  2YUB A;  4JOP A;  1Z87 A;  5E1Y A;  4OAJ A;  1U38 A;  3EGG C;  4JOJ A;  4JOK A;  2KQF A;  2YTW A;  1IHJ A;  3PS4 A;  2LC6 A;  1QAV B;  4IC6 A;  2KBS A;  5HET A;  2KOM A;  2OZF A;  2L4T A;  2EGK A;  3ID1 A;  2VSV A;  3HPM A;  4AMH A;  2FNE A;  2VRF A;  3QIK A;  2JWE A;  1U37 A;  3O5N A;  1I16 A;  5FHT A;  2VZ5 A;  2OGP A;  2EXG A;  1B8Q A;  1N7T A;  1BFE A;  3QJM A;  5HF1 A;  2M0Z A;  3LNY A;  2I0L A;  2YT7 A;  2VWR A;  2DMZ A;  2RCZ A;  1ZUB A;  3GDV A;  2CS5 A;  4G69 A;  3MH6 A;  4LMM A;  1V5Q A;  5GND A;  2KPK A;  5EYZ A;  2KJD A;  1N7F A;  5HFB A;  4P0C A;  2E7K A; 
#chains in the Genus database with same CATH topology
 2JIN A;  1Y8T A;  1YBO A;  3K50 A;  2JXO A;  4Q2P A;  1WHD A;  2KRG A;  1TE0 A;  2IWP A;  3GDS A;  3TMH A;  1V1T A;  2KL1 A;  2R3Y A;  2WL7 A;  2O2T A;  3WKL A;  4JJ0 A;  2EAQ A;  2H3L A;  1P1D A;  1UJV A;  3SHW A;  4Q2O A;  3CC0 A;  4NNM A;  4JL7 A;  5HED A;  4MPA A;  1QLC A;  2D90 A;  3QJN A;  5G1E A;  5HJ1 A;  5HDY A;  1G9O A;  1L6O A;  3KZE A;  2LUI A;  2I1N A;  1FC7 A;  4Q2N A;  1Q3P A;  1BE9 A;  1UEW A;  4Z8J A;  1MFL A;  2GEF A;  3KHF A;  1NF3 C;  4Q3H A;  1RZX A;  3CBY A;  4FGM A;  2EHR A;  2W7R A;  3R68 A;  4WYU A;  2M0U A;  2OMJ A;  2QKV A;  1SOT A;  2EDP A;  2PKT A;  5E21 A;  4E35 A;  2HGA A;  2DC2 A;  4NMP A;  3RL8 A;  3ZRT A;  2QKU A;  2EEI A;  5E11 A;  3RL7 A;  2EEJ A;  2IWN A;  3WKM A;  2I6V A;  1X8S A;  3QO6 A;  5DTH A;  2JRE A;  1TP5 A;  1WFV A;  3MH4 A;  1OBX A;  1WJL A;  4GVD A;  3SFJ A;  1KY9 A;  3R69 A;  4GHN A;  2HE2 A;  3RLE A;  4OEO A;  5HEY A;  5B42 A;  2V90 A;  4E3B A;  2D8I A;  4K6Y A;  1X5R A;  1OZI A;  1N6D A;  4EDJ A;  3CYY A;  4HOP A;  2M10 A;  1VJ6 A;  4YYX A;  1VAE A;  4Z33 A;  1MC7 A;  1UJD A;  3NFL A;  1X6D A;  1QAU A;  3CS0 A;  3PV2 A;  2IWO A;  3EGH C;  2H3M A;  4NMQ A;  4PQW A;  1Q3O A;  1W9E A;  1GQ4 A;  3DJ1 A;  1KWA A;  2P3W A;  4JOE A;  1OBZ A;  1V6B A;  2K1Z A;  3GJ9 A;  1XZ9 A;  2V1W A;  1UEP A;  3DIW A;  3MH7 A;  1WG6 A;  2EDV A;  3GDU A;  3TSZ A;  3CBZ A;  5H3J A;  1PDR A;  2EV8 A;  2CSS A;  2REY A;  1UIT A;  2EDZ A;  3QDO A;  3OU0 A;  4OEP A;  1N99 A;  2UZC A;  2DJT A;  4NMV A;  3VQG A;  5D13 A;  3K1R A;  1VB7 A;  5G1D A;  2ZPL A;  2DB5 A;  5F67 A;  1K32 A;  3VQF A;  4JOR A;  1UEQ A;  4F8K A;  2OPG A;  1Y7N A;  3SUZ A;  2X7Z A;  4P2A B;  4NXQ A;  2FN5 A;  3KZD A;  3B76 A;  5F3X A;  2L4S A;  3HPK A;  2ENO A;  1D5G A;  5ILB A;  3STJ A;  3PV4 A;  2DKR A;  2Z17 A;  4KFW A;  2OSG A;  4UU6 A;  2EEG A;  3ID2 A;  2AWX A;  1GQ5 A;  2M0V A;  2JOA A;  1IU2 A;  2KOJ A;  1WFG A;  1UFX A;  4Q6S A;  2M0T A;  3DJA A;  2Q3G A;  2IWQ A;  1LCY A;  1FC6 A;  3NFK A;  5B6L A;  5HEB A;  3E17 A;  3KDK A;  3PV5 A;  3QE1 A;  3R0H A;  2H2B A;  4Q6H A;  2QBW A;  3K82 A;  4GVC A;  1N6E A;  4WYT A;  2D92 A;  1WI4 A;  2BYG A;  3TSV A;  2LC7 A;  4E34 A;  2RRM A;  4O06 A;  1WF8 A;  2VSP A;  1WHA A;  2QT5 A;  4KFV A;  2JSN A;  4K78 A;  1Z86 A;  5A2P A;  2L97 A;  3GCN A;  4Q2Q A;  1OBY A;  2ZPM A;  1UF1 A;  5HFC A;  1X5N A;  2PDZ A;  1Q7X A;  1P1E A;  4NMT A;  2DLS A;  2MX6 A;  4NNL A;  1WI2 A;  3JXT A;  2KAW A;  2JIL A;  1FC9 A;  4NMR A;  2DAZ A;  3OTP A;  2KV8 A;  1QAV A;  2CSJ A;  2KJK A;  4JOG A;  3GSL A;  5GLJ A;  1UM7 A;  2K20 A;  1UHP A;  3HVQ C;  2AWU A;  1ZOK A;  2F0A A;  3DOR A;  1W9O A;  4HOP B;  2GZV A;  2LA8 A;  5I7Z A;  4UU5 A;  4YDP A;  4JJ3 A;  2I4S A;  1WF7 A;  2KA9 A;  2Q9V A;  3FY5 A;  2W4F A;  2AIN A;  5E6P B;  5EZ0 A;  2PZD A;  1TP3 A;  1I92 A;  1SOZ A;  2QKT A;  1FCF A;  4NXP A;  2OCS A;  2F5Y A;  1UEZ A;  2QG1 A;  3I1E A;  4K76 A;  5FB8 C;  1WH1 A;  1UM1 A;  1V5L A;  4L8N A;  2PKU A;  5IL9 A;  2M3M A;  2OS6 A;  2Z9I A;  3CBX A;  2OQS A;  3GAB A;  1X9Z A;  1RGW A;  1TQ3 A;  4JOF A;  4NMO A;  3SOE A;  3I18 A;  2HE4 A;  4K72 A;  5HFD A;  3BPU A;  5HF4 A;  2KOH A;  2DLU A;  4REY A;  2EGN A;  1IU0 A;  2I04 A;  1T2M A;  2EGO A;  1U3B A;  3O46 A;  2KJP A;  3QGL A;  4N6X A;  2DM8 A;  4FLN A;  3GCO A;  2JIK A;  2MHO A;  1RGR A;  3PDV A;  5JXB A;  3AXA A;  3I4W A;  1N6F A;  2H2C A;  5HFF A;  2PA1 A;  4H11 A;  3DJ3 A;  1RY4 A;  2VPH A;  3NGH A;  1R6J A;  1W9Q A;  2I0I A;  3LNX A;  1VA8 A;  2EEH A;  2FCF A;  3CH8 A;  2AWW A;  4R2Z A;  2KYL A;  2FE5 A;  1MFG A;  4RI0 A;  4NXR A;  1GM1 A;  5E22 A;  1KEF A;  1VCW A;  2KG2 A;  3SHU A;  4NMS A;  2KPL A;  4JOH A;  2YUY A;  1M5Z A;  1V62 A;  1N7E A;  1X5Q A;  1WIF A;  4K75 A;  2G5M B;  2YT8 A;  1U39 A;  3PDZ A;  4XHV A;  3ID3 A;  2LOB A;  3L4F D;  1X45 A;  3GGE A;  3ID4 A;  5HFE A;  2EJY A;  2G2L A;  1UJU A;  3TSW A;  1NTE A;  2R4H A;  2PNT A;  2YUB A;  4JOP A;  1Z87 A;  5E1Y A;  4OAJ A;  1U38 A;  3EGG C;  4JOJ A;  4JOK A;  2KQF A;  2YTW A;  1IHJ A;  3PS4 A;  2LC6 A;  1QAV B;  4IC6 A;  2KBS A;  5HET A;  2KOM A;  2OZF A;  2L4T A;  2EGK A;  3ID1 A;  2VSV A;  3HPM A;  4AMH A;  2FNE A;  2VRF A;  3QIK A;  2JWE A;  1U37 A;  3O5N A;  3NCV A;  1I16 A;  3KDG A;  5FHT A;  2VZ5 A;  2OGP A;  2EXG A;  1B8Q A;  1N7T A;  1BFE A;  3QJM A;  5HF1 A;  2M0Z A;  3LNY A;  2I0L A;  2YT7 A;  2VWR A;  2DMZ A;  2RCZ A;  1ZUB A;  3GDV A;  2CS5 A;  4G69 A;  3MH6 A;  4LMM A;  1V5Q A;  5GND A;  2KPK A;  5EYZ A;  2KJD A;  1N7F A;  5HFB A;  4P0C A;  2E7K A; 
#chains in the Genus database with same CATH homology
 2JIN A;  1Y8T A;  1YBO A;  3K50 A;  2JXO A;  4Q2P A;  1WHD A;  2KRG A;  1TE0 A;  2IWP A;  3GDS A;  3TMH A;  1V1T A;  2KL1 A;  2R3Y A;  2WL7 A;  2O2T A;  3WKL A;  4JJ0 A;  2EAQ A;  2H3L A;  1P1D A;  1UJV A;  3SHW A;  4Q2O A;  3CC0 A;  4NNM A;  4JL7 A;  5HED A;  4MPA A;  1QLC A;  2D90 A;  3QJN A;  5G1E A;  5HJ1 A;  5HDY A;  1G9O A;  1L6O A;  3KZE A;  2LUI A;  2I1N A;  1FC7 A;  4Q2N A;  1Q3P A;  1BE9 A;  1UEW A;  4Z8J A;  1MFL A;  2GEF A;  3KHF A;  1NF3 C;  4Q3H A;  1RZX A;  3CBY A;  4FGM A;  2EHR A;  2W7R A;  3R68 A;  4WYU A;  2M0U A;  2OMJ A;  2QKV A;  1SOT A;  2EDP A;  2PKT A;  5E21 A;  4E35 A;  2HGA A;  2DC2 A;  4NMP A;  3RL8 A;  3ZRT A;  2QKU A;  2EEI A;  5E11 A;  3RL7 A;  2EEJ A;  2IWN A;  3WKM A;  2I6V A;  1X8S A;  3QO6 A;  5DTH A;  2JRE A;  1TP5 A;  1WFV A;  3MH4 A;  1OBX A;  1WJL A;  4GVD A;  3SFJ A;  1KY9 A;  3R69 A;  4GHN A;  2HE2 A;  3RLE A;  4OEO A;  5HEY A;  5B42 A;  2V90 A;  4E3B A;  2D8I A;  4K6Y A;  1X5R A;  1OZI A;  1N6D A;  4EDJ A;  3CYY A;  4HOP A;  2M10 A;  1VJ6 A;  4YYX A;  1VAE A;  4Z33 A;  1MC7 A;  1UJD A;  3NFL A;  1X6D A;  1QAU A;  3CS0 A;  3PV2 A;  2IWO A;  3EGH C;  2H3M A;  4NMQ A;  4PQW A;  1Q3O A;  1W9E A;  1GQ4 A;  3DJ1 A;  1KWA A;  2P3W A;  4JOE A;  1OBZ A;  1V6B A;  2K1Z A;  3GJ9 A;  1XZ9 A;  2V1W A;  1UEP A;  3DIW A;  3MH7 A;  1WG6 A;  2EDV A;  3GDU A;  3TSZ A;  3CBZ A;  5H3J A;  1PDR A;  2EV8 A;  2CSS A;  2REY A;  1UIT A;  2EDZ A;  3QDO A;  3OU0 A;  4OEP A;  1N99 A;  2UZC A;  2DJT A;  4NMV A;  3VQG A;  5D13 A;  3K1R A;  1VB7 A;  5G1D A;  2ZPL A;  2DB5 A;  5F67 A;  1K32 A;  3VQF A;  4JOR A;  1UEQ A;  4F8K A;  2OPG A;  1Y7N A;  3SUZ A;  2X7Z A;  4P2A B;  4NXQ A;  2FN5 A;  3KZD A;  3B76 A;  5F3X A;  2L4S A;  3HPK A;  2ENO A;  1D5G A;  5ILB A;  3STJ A;  3PV4 A;  2DKR A;  2Z17 A;  4KFW A;  2OSG A;  4UU6 A;  2EEG A;  3ID2 A;  2AWX A;  1GQ5 A;  2M0V A;  2JOA A;  1IU2 A;  2KOJ A;  1WFG A;  1UFX A;  4Q6S A;  2M0T A;  3DJA A;  2Q3G A;  2IWQ A;  1LCY A;  1FC6 A;  3NFK A;  5B6L A;  5HEB A;  3E17 A;  3KDK A;  3PV5 A;  3QE1 A;  3R0H A;  2H2B A;  4Q6H A;  2QBW A;  3K82 A;  4GVC A;  1N6E A;  4WYT A;  2D92 A;  1WI4 A;  2BYG A;  3TSV A;  2LC7 A;  4E34 A;  2RRM A;  4O06 A;  1WF8 A;  2VSP A;  1WHA A;  2QT5 A;  4KFV A;  2JSN A;  4K78 A;  1Z86 A;  5A2P A;  2L97 A;  3GCN A;  4Q2Q A;  1OBY A;  2ZPM A;  1UF1 A;  5HFC A;  1X5N A;  2PDZ A;  1Q7X A;  1P1E A;  4NMT A;  2DLS A;  2MX6 A;  4NNL A;  1WI2 A;  3JXT A;  2KAW A;  2JIL A;  1FC9 A;  4NMR A;  2DAZ A;  3OTP A;  2KV8 A;  1QAV A;  2CSJ A;  2KJK A;  4JOG A;  3GSL A;  5GLJ A;  1UM7 A;  2K20 A;  1UHP A;  3HVQ C;  2AWU A;  1ZOK A;  2F0A A;  3DOR A;  1W9O A;  4HOP B;  2GZV A;  2LA8 A;  5I7Z A;  4UU5 A;  4YDP A;  4JJ3 A;  2I4S A;  1WF7 A;  2KA9 A;  2Q9V A;  3FY5 A;  2W4F A;  2AIN A;  5E6P B;  5EZ0 A;  2PZD A;  1TP3 A;  1I92 A;  1SOZ A;  2QKT A;  1FCF A;  4NXP A;  2OCS A;  2F5Y A;  1UEZ A;  2QG1 A;  3I1E A;  4K76 A;  5FB8 C;  1WH1 A;  1UM1 A;  1V5L A;  4L8N A;  2PKU A;  5IL9 A;  2M3M A;  2OS6 A;  2Z9I A;  3CBX A;  2OQS A;  3GAB A;  1X9Z A;  1RGW A;  1TQ3 A;  4JOF A;  4NMO A;  3SOE A;  3I18 A;  2HE4 A;  4K72 A;  5HFD A;  3BPU A;  5HF4 A;  2KOH A;  2DLU A;  4REY A;  2EGN A;  1IU0 A;  2I04 A;  1T2M A;  2EGO A;  1U3B A;  3O46 A;  2KJP A;  3QGL A;  4N6X A;  2DM8 A;  4FLN A;  3GCO A;  2JIK A;  2MHO A;  1RGR A;  3PDV A;  5JXB A;  3AXA A;  3I4W A;  1N6F A;  2H2C A;  5HFF A;  2PA1 A;  4H11 A;  3DJ3 A;  1RY4 A;  2VPH A;  3NGH A;  1R6J A;  1W9Q A;  2I0I A;  3LNX A;  1VA8 A;  2EEH A;  2FCF A;  3CH8 A;  2AWW A;  4R2Z A;  2KYL A;  2FE5 A;  1MFG A;  4RI0 A;  4NXR A;  1GM1 A;  5E22 A;  1KEF A;  1VCW A;  2KG2 A;  3SHU A;  4NMS A;  2KPL A;  4JOH A;  2YUY A;  1M5Z A;  1V62 A;  1N7E A;  1X5Q A;  1WIF A;  4K75 A;  2G5M B;  2YT8 A;  1U39 A;  3PDZ A;  4XHV A;  3ID3 A;  2LOB A;  3L4F D;  1X45 A;  3GGE A;  3ID4 A;  5HFE A;  2EJY A;  2G2L A;  1UJU A;  3TSW A;  1NTE A;  2R4H A;  2PNT A;  2YUB A;  4JOP A;  1Z87 A;  5E1Y A;  4OAJ A;  1U38 A;  3EGG C;  4JOJ A;  4JOK A;  2KQF A;  2YTW A;  1IHJ A;  3PS4 A;  2LC6 A;  1QAV B;  4IC6 A;  2KBS A;  5HET A;  2KOM A;  2OZF A;  2L4T A;  2EGK A;  3ID1 A;  2VSV A;  3HPM A;  4AMH A;  2FNE A;  2VRF A;  3QIK A;  2JWE A;  1U37 A;  3O5N A;  3NCV A;  1I16 A;  3KDG A;  5FHT A;  2VZ5 A;  2OGP A;  2EXG A;  1B8Q A;  1N7T A;  1BFE A;  3QJM A;  5HF1 A;  2M0Z A;  3LNY A;  2I0L A;  2YT7 A;  2VWR A;  2DMZ A;  2RCZ A;  1ZUB A;  3GDV A;  2CS5 A;  4G69 A;  3MH6 A;  4LMM A;  1V5Q A;  5GND A;  2KPK A;  5EYZ A;  2KJD A;  1N7F A;  5HFB A;  4P0C A;  2E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...