1G9OA

First pdz domain of the human na+/h+ exchanger regulatory factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'RMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHE-RF
publication title Crystal structure of the PDZ1 domain of human Na(+)/H(+) exchanger regulatory factor provides insights into the mechanism of carboxyl-terminal leucine recognition by class I PDZ domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2000-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1g9oA00
3HVQC 1UM1A 2KAWA 1WHAA 5EZ0A 1V5QA 4JOGA 4E35A 4NXQA 1RGWA 1I16A 1LCYA 5HETA 2KOHA 2Q3GA 3OU0A 4JOFA 2GZVA 2QKUA 2KPKA 2I0LA 5F67A 2CS5A 3VQGA 5HFBA 5HEYA 3AXAA 2H2BA 3DIWA 4YYXA 3NFKA 4K76A 2VPHA 2DMZA 2HE2A 5G1EA 2LC7A 3R69A 1UEQA 3LNXA 1Q3OA 2EGKA 1QAVA 3BPUA 2EDZA 4G69A 1UEPA 5H3JA 1N7FA 1RY4A 3KHFA 1TP3A 1L6OA 2ZPMA 3CBZA 3TSWA 4KFWA 4UU6A 2OCSA 4KFVA 3GCNA 3PDZA 2I0IA 5HFEA 2OGPA 2EEJA 4JOHA 2KBSA 1UJVA 2VWRA 1I92A 1QLCA 4GVCA 2QBWA 4NMSA 3PV2A 4OAJA 2KJKA 3OTPA 1RGRA 3TMHA 2LUIA 3ID1A 3SFJA 4NMQA 1YBOA 1X45A 3RLEA 2AINA 5E22A 2EJYA 2EDPA 2M3MA 2M0UA 2JWEA 1WIFA 5HFFA 3DJAA 5HDYA 1Y7NA 2O2TA 4K6YA 1QAUA 2M0ZA 4GVDA 5E1YA 2DLUA 2W4FA 5HEBA 4HOPA 4AMHA 2BYGA 1IU2A 3DORA 3WKMA 1QAVB 1GQ4A 4K72A 2H3MA 5I7ZA 3FY5A 1UF1A 1Z87A 3E17A 1P1EA 3GGEA 2AWWA 4JOPA 3MH4A 2H3LA 2RCZA 1WFGA 1SOZA 4IC6A 1FC9A 1XZ9A 2YTWA 1UITA 2M0TA 2HGAA 3QDOA 2V90A 1FC6A 4PQWA 4K75A 4R2ZA 4WYTA 2KRGA 2D90A 2IWOA 3MH7A 5GNDA 2L4TA 3O46A 5HEDA 1N99A 4JOEA 2L97A 1WH1A 1MC7A 1VB7A 3QIKA 4NXRA 1U37A 4Q2QA 3RL7A 3CC0A 2JXOA 1P1DA 2KL1A 5E6PB 2FCFA 3CH8A 4L8NA 2QKTA 1WF8A 4JOJA 2REYA 3STJA 3KZEA 1G9OA 2LA8A 4NMOA 2VZ5A 3PS4A 3QE1A 2DLSA 3L4FD 3NGHA 2VSVA 4HOPB 2EAQA 2VRFA 5HJ1A 1UFXA 2KJDA 3QGLA 5HFDA 1D5GA 3CYYA 2UZCA 2CSSA 1GQ5A 2IWQA 2KPLA 2FNEA 2PDZA 2DAZA 5FB8C 1V1TA 1ZUBA 2MX6A 2I4SA 2KYLA 5G1DA 2PA1A 3KZDA 3R68A 2CSJA 4E3BA 3I1EA 3QO6A 1U38A 3K82A 3PDVA 3GDSA 3ZRTA 2RRMA 3K50A 2I04A 1UJUA 4Q6SA 2YUYA 5HF1A 1OBXA 4Q2NA 2IWNA 1Z86A 5GLJA 2LC6A 1T2MA 2KQFA 4Q2OA 2KOMA 1N7TA 4P2AB 5A2PA 1UEWA 3NFLA 2PZDA 2EGNA 1RZXA 4Q6HA 2F0AA 1KWAA 5HFCA 2M0VA 5JXBA 1MFLA 2EV8A 2X7ZA 3DJ3A 2D92A 4REYA 1VCWA 1FC7A 4WYUA 1V5LA 2KJPA 2R4HA 3I18A 3LNYA 1WHDA 3TSVA 1SOTA 1WI2A 3O5NA 4E34A 1NF3C 2WL7A 5FHTA 1N6EA 3GJ9A 1TP5A 1OBZA 1N6FA 1FCFA 2QG1A 4UU5A 1IU0A 3EGHC 4OEOA 4MPAA 2KV8A 2OZFA 4Q2PA 1X6DA 3SUZA 1UHPA 2KA9A 4H11A 3ID2A 1K32A 1WJLA 1WG6A 1MFGA 1U39A 4NXPA 4OEPA 1WI4A 1UEZA 4Q3HA 3JXTA 2AWUA 3MH6A 1GM1A 2I6VA 2YT8A 1R6JA 2FN5A 5EYZA 2JIKA 2W7RA 1N6DA 2Z9IA 1Y8TA 1UJDA 2K20A 1TE0A 4NNLA 1V62A 2MHOA 4P0CA 3WKLA 1M5ZA 4NNMA 2VSPA 2EHRA 2FE5A 4Z8JA 2D8IA 4NMRA 2I1NA 1Q7XA 2JREA 2G2LA 2OSGA 4GHNA 1KEFA 4O06A 5E21A 1ZOKA 4JL7A 2YT7A 4NMPA 3RL8A 2YUBA 1UM7A 3ID4A 4JORA 1X8SA 2DC2A 4F8KA 1WFVA 1X5QA 2Z17A 3ID3A 3GCOA 2P3WA 2EXGA 3EGGC 1W9OA 2IWPA 3SOEA 2EGOA 2JOAA 2QKVA 1NTEA 3B76A 2KG2A 2OPGA 4NMTA 2QT5A 2EDVA 5D13A 1X5NA 2DM8A 5HF4A 1W9EA 1Q3PA 3VQFA 2M10A 5B6LA 1VAEA 3PV5A 4Z33A 2H2CA 3CS0A 2V1WA 2F5YA 1IHJA 1V6BA 2ZPLA 3QJMA 3CBXA 3GDUA 2EEGA 2DJTA 2LOBA 2HE4A 2L4SA 1PDRA 3DJ1A 5E11A 2ENOA 3SHUA 4NMVA 4FGMA 2PKUA 2DB5A 2JINA 2OMJA 1X5RA 2G5MB 2PKTA 1WF7A 3I4WA 1BE9A 4JOKA 1B8QA 3TSZA 2OQSA 2EEIA 2EEHA 3HPMA 4XHVA 3QJNA 2PNTA 3PV4A 3K1RA 3HPKA 1KY9A 4RI0A 2E7KA 2Q9VA 4LMMA 2OS6A 3GDVA 1TQ3A 2R3YA 2K1ZA 3SHWA 4EDJA 1BFEA 2KOJA 2AWXA 1VA8A 5F3XA 3GSLA 1VJ6A 3CBYA 5DTHA 1OZIA 1N7EA 2JILA 1W9QA 4N6XA 1U3BA 4YDPA 1OBYA 4K78A 3R0HA 2DKRA
chains in the Genus database with same CATH superfamily
3HVQC 1UM1A 2KAWA 1WHAA 5EZ0A 1V5QA 4JOGA 4E35A 4NXQA 1RGWA 1I16A 1LCYA 5HETA 2KOHA 2Q3GA 3OU0A 4JOFA 2GZVA 2QKUA 2KPKA 2I0LA 5F67A 2CS5A 3VQGA 5HFBA 3KDKA 5HEYA 3AXAA 2H2BA 3DIWA 4YYXA 3NFKA 4K76A 2VPHA 2DMZA 2HE2A 5G1EA 2LC7A 3R69A 1UEQA 3LNXA 1Q3OA 2EGKA 1QAVA 3BPUA 2EDZA 4G69A 1UEPA 5H3JA 1N7FA 1RY4A 3KHFA 1TP3A 1L6OA 2ZPMA 3CBZA 3TSWA 4KFWA 4UU6A 2OCSA 4KFVA 3GCNA 3PDZA 2I0IA 5HFEA 2OGPA 2EEJA 4JOHA 2KBSA 1UJVA 2VWRA 1I92A 1QLCA 4GVCA 2QBWA 4NMSA 3PV2A 5IL9A 4OAJA 2KJKA 3OTPA 1RGRA 3TMHA 2JSNA 2LUIA 3ID1A 3SFJA 4NMQA 1YBOA 1X45A 3RLEA 2AINA 5E22A 2EJYA 2EDPA 2M3MA 2M0UA 2JWEA 1WIFA 5HFFA 3DJAA 5HDYA 1Y7NA 2O2TA 4K6YA 1QAUA 2M0ZA 4GVDA 5E1YA 2DLUA 2W4FA 5HEBA 4HOPA 4AMHA 2BYGA 1IU2A 3DORA 3WKMA 1QAVB 1GQ4A 4K72A 2H3MA 5I7ZA 3FY5A 1UF1A 1Z87A 3E17A 1P1EA 3GGEA 2AWWA 4JOPA 3MH4A 2H3LA 2RCZA 1WFGA 1SOZA 4IC6A 1FC9A 1XZ9A 2YTWA 1UITA 2M0TA 2HGAA 3QDOA 2V90A 1FC6A 4PQWA 4K75A 4R2ZA 4WYTA 2KRGA 2D90A 2IWOA 3MH7A 5GNDA 2L4TA 3O46A 5HEDA 1N99A 4JOEA 2L97A 1WH1A 1MC7A 1VB7A 3QIKA 4NXRA 1U37A 4Q2QA 3RL7A 3CC0A 2JXOA 1P1DA 2KL1A 5E6PB 2FCFA 3CH8A 4L8NA 2QKTA 1WF8A 4JOJA 2REYA 3STJA 3KZEA 4FLNA 1G9OA 2LA8A 4NMOA 2VZ5A 3PS4A 3QE1A 2DLSA 3L4FD 3NGHA 2VSVA 4HOPB 2EAQA 2VRFA 5HJ1A 1UFXA 2KJDA 3QGLA 5HFDA 1D5GA 3GABA 3CYYA 2UZCA 2CSSA 1GQ5A 2IWQA 2KPLA 2FNEA 2PDZA 2DAZA 5FB8C 1V1TA 1ZUBA 2MX6A 2I4SA 2KYLA 5G1DA 2PA1A 3KZDA 3R68A 2CSJA 4E3BA 3I1EA 3QO6A 1U38A 3K82A 3PDVA 5B42A 3GDSA 3ZRTA 2RRMA 3K50A 2I04A 1UJUA 4Q6SA 2YUYA 5HF1A 1OBXA 4Q2NA 2IWNA 1Z86A 5GLJA 2LC6A 1T2MA 2KQFA 3KDGA 4Q2OA 2KOMA 1N7TA 4P2AB 5A2PA 1UEWA 3NFLA 2PZDA 2EGNA 1RZXA 4Q6HA 2F0AA 1KWAA 5HFCA 2M0VA 5JXBA 1MFLA 2EV8A 2X7ZA 3DJ3A 2D92A 4REYA 1VCWA 1FC7A 1X9ZA 4WYUA 1V5LA 2KJPA 2R4HA 3I18A 3LNYA 1WHDA 3TSVA 1SOTA 1WI2A 3O5NA 4E34A 1NF3C 2WL7A 5FHTA 1N6EA 3GJ9A 1TP5A 1OBZA 1N6FA 1FCFA 2QG1A 4UU5A 1IU0A 3EGHC 4OEOA 4MPAA 2KV8A 2OZFA 4Q2PA 1X6DA 3SUZA 1UHPA 2KA9A 4H11A 3ID2A 1K32A 1WJLA 1WG6A 1MFGA 1U39A 4NXPA 4OEPA 1WI4A 1UEZA 4Q3HA 3JXTA 2AWUA 3MH6A 1GM1A 2GEFA 2I6VA 2YT8A 1R6JA 2FN5A 5EYZA 2JIKA 2W7RA 1N6DA 2Z9IA 1Y8TA 1UJDA 2K20A 1TE0A 4NNLA 1V62A 2MHOA 4P0CA 3WKLA 1M5ZA 4NNMA 2VSPA 2EHRA 2FE5A 4Z8JA 2D8IA 4JJ3A 4NMRA 2I1NA 1Q7XA 2JREA 2G2LA 3NCVA 2OSGA 4GHNA 1KEFA 4O06A 5E21A 1ZOKA 4JL7A 2YT7A 4NMPA 3RL8A 2YUBA 1UM7A 3ID4A 4JORA 1X8SA 2DC2A 4F8KA 1WFVA 1X5QA 2Z17A 3ID3A 3GCOA 5ILBA 2P3WA 2EXGA 3EGGC 1W9OA 2IWPA 3SOEA 2EGOA 2JOAA 2QKVA 1NTEA 3B76A 2KG2A 2OPGA 4NMTA 2QT5A 2EDVA 5D13A 1X5NA 2DM8A 5HF4A 1W9EA 1Q3PA 3VQFA 2M10A 5B6LA 1VAEA 3PV5A 4Z33A 2H2CA 3CS0A 2V1WA 2F5YA 1IHJA 1V6BA 2ZPLA 3QJMA 3CBXA 3GDUA 2EEGA 2DJTA 2LOBA 2HE4A 2L4SA 1PDRA 3DJ1A 5E11A 2ENOA 3SHUA 4NMVA 4FGMA 2PKUA 2DB5A 2JINA 2OMJA 1X5RA 2G5MB 2PKTA 1WF7A 3I4WA 1BE9A 4JOKA 1B8QA 3TSZA 2OQSA 2EEIA 2EEHA 3HPMA 4XHVA 3QJNA 2PNTA 3PV4A 3K1RA 3HPKA 1KY9A 4RI0A 2E7KA 2Q9VA 4LMMA 2OS6A 3GDVA 1TQ3A 2R3YA 2K1ZA 3SHWA 4EDJA 1BFEA 2KOJA 2AWXA 1VA8A 5F3XA 3GSLA 1VJ6A 3CBYA 5DTHA 1OZIA 4JJ0A 1N7EA 2JILA 1W9QA 4N6XA 1U3BA 4YDPA 1OBYA 4K78A 3R0HA 2DKRA
chains in the Genus database with same CATH topology
3HVQC 1UM1A 2KAWA 1WHAA 5EZ0A 1V5QA 4JOGA 4E35A 4NXQA 1RGWA 1I16A 1LCYA 5HETA 2KOHA 2Q3GA 3OU0A 4JOFA 2GZVA 2QKUA 2KPKA 2I0LA 5F67A 2CS5A 3VQGA 5HFBA 3KDKA 5HEYA 3AXAA 2H2BA 3DIWA 4YYXA 3NFKA 4K76A 2VPHA 2DMZA 2HE2A 5G1EA 2LC7A 3R69A 1UEQA 3LNXA 1Q3OA 2EGKA 1QAVA 3BPUA 2EDZA 4G69A 1UEPA 5H3JA 1N7FA 1RY4A 3KHFA 1TP3A 1L6OA 2ZPMA 3CBZA 3TSWA 4KFWA 4UU6A 2OCSA 4KFVA 3GCNA 3PDZA 2I0IA 5HFEA 2OGPA 2EEJA 4JOHA 2KBSA 1UJVA 2VWRA 1I92A 1QLCA 4GVCA 2QBWA 4NMSA 3PV2A 5IL9A 4OAJA 2KJKA 3OTPA 1RGRA 3TMHA 2JSNA 2LUIA 3ID1A 3SFJA 4NMQA 1YBOA 1X45A 3RLEA 2AINA 5E22A 2EJYA 2EDPA 2M3MA 2M0UA 2JWEA 1WIFA 5HFFA 3DJAA 5HDYA 1Y7NA 2O2TA 4K6YA 1QAUA 2M0ZA 4GVDA 5E1YA 2DLUA 2W4FA 5HEBA 4HOPA 4AMHA 2BYGA 1IU2A 3DORA 3WKMA 1QAVB 1GQ4A 4K72A 2H3MA 5I7ZA 3FY5A 1UF1A 1Z87A 3E17A 1P1EA 3GGEA 2AWWA 4JOPA 3MH4A 2H3LA 2RCZA 1WFGA 1SOZA 4IC6A 1FC9A 1XZ9A 2YTWA 1UITA 2M0TA 2HGAA 3QDOA 2V90A 1FC6A 4PQWA 4K75A 4R2ZA 4WYTA 2KRGA 2D90A 2IWOA 3MH7A 5GNDA 2L4TA 3O46A 5HEDA 1N99A 4JOEA 2L97A 1WH1A 1MC7A 1VB7A 3QIKA 4NXRA 1U37A 4Q2QA 3RL7A 3CC0A 2JXOA 1P1DA 2KL1A 5E6PB 2FCFA 3CH8A 4L8NA 2QKTA 1WF8A 4JOJA 2REYA 3STJA 3KZEA 4FLNA 1G9OA 2LA8A 4NMOA 2VZ5A 3PS4A 3QE1A 2DLSA 3L4FD 3NGHA 2VSVA 4HOPB 2EAQA 2VRFA 5HJ1A 1UFXA 2KJDA 3QGLA 5HFDA 1D5GA 3GABA 3CYYA 2UZCA 2CSSA 1GQ5A 2IWQA 2KPLA 2FNEA 2PDZA 2DAZA 5FB8C 1V1TA 1ZUBA 2MX6A 2I4SA 2KYLA 5G1DA 2PA1A 3KZDA 3R68A 2CSJA 4E3BA 3I1EA 3QO6A 1U38A 3K82A 3PDVA 5B42A 3GDSA 3ZRTA 2RRMA 3K50A 2I04A 1UJUA 4Q6SA 2YUYA 5HF1A 1OBXA 4Q2NA 2IWNA 1Z86A 5GLJA 2LC6A 1T2MA 2KQFA 3KDGA 4Q2OA 2KOMA 1N7TA 4P2AB 5A2PA 1UEWA 3NFLA 2PZDA 2EGNA 1RZXA 4Q6HA 2F0AA 1KWAA 5HFCA 2M0VA 5JXBA 1MFLA 2EV8A 2X7ZA 3DJ3A 2D92A 4REYA 1VCWA 1FC7A 1X9ZA 4WYUA 1V5LA 2KJPA 2R4HA 3I18A 3LNYA 1WHDA 3TSVA 1SOTA 1WI2A 3O5NA 4E34A 1NF3C 2WL7A 5FHTA 1N6EA 3GJ9A 1TP5A 1OBZA 1N6FA 1FCFA 2QG1A 4UU5A 1IU0A 3EGHC 4OEOA 4MPAA 2KV8A 2OZFA 4Q2PA 1X6DA 3SUZA 1UHPA 2KA9A 4H11A 3ID2A 1K32A 1WJLA 1WG6A 1MFGA 1U39A 4NXPA 4OEPA 1WI4A 1UEZA 4Q3HA 3JXTA 2AWUA 3MH6A 1GM1A 2GEFA 2I6VA 2YT8A 1R6JA 2FN5A 5EYZA 2JIKA 2W7RA 1N6DA 2Z9IA 1Y8TA 1UJDA 2K20A 1TE0A 4NNLA 1V62A 2MHOA 4P0CA 3WKLA 1M5ZA 4NNMA 2VSPA 2EHRA 2FE5A 4Z8JA 2D8IA 4JJ3A 4NMRA 2I1NA 1Q7XA 2JREA 2G2LA 3NCVA 2OSGA 4GHNA 1KEFA 4O06A 5E21A 1ZOKA 4JL7A 2YT7A 4NMPA 3RL8A 2YUBA 1UM7A 3ID4A 4JORA 1X8SA 2DC2A 4F8KA 1WFVA 1X5QA 2Z17A 3ID3A 3GCOA 5ILBA 2P3WA 2EXGA 3EGGC 1W9OA 2IWPA 3SOEA 2EGOA 2JOAA 2QKVA 1NTEA 3B76A 2KG2A 2OPGA 4NMTA 2QT5A 2EDVA 5D13A 1X5NA 2DM8A 5HF4A 1W9EA 1Q3PA 3VQFA 2M10A 5B6LA 1VAEA 3PV5A 4Z33A 2H2CA 3CS0A 2V1WA 2F5YA 1IHJA 1V6BA 2ZPLA 3QJMA 3CBXA 3GDUA 2EEGA 2DJTA 2LOBA 2HE4A 2L4SA 1PDRA 3DJ1A 5E11A 2ENOA 3SHUA 4NMVA 4FGMA 2PKUA 2DB5A 2JINA 2OMJA 1X5RA 2G5MB 2PKTA 1WF7A 3I4WA 1BE9A 4JOKA 1B8QA 3TSZA 2OQSA 2EEIA 2EEHA 3HPMA 4XHVA 3QJNA 2PNTA 3PV4A 3K1RA 3HPKA 1KY9A 4RI0A 2E7KA 2Q9VA 4LMMA 2OS6A 3GDVA 1TQ3A 2R3YA 2K1ZA 3SHWA 4EDJA 1BFEA 2KOJA 2AWXA 1VA8A 5F3XA 3GSLA 1VJ6A 3CBYA 5DTHA 1OZIA 4JJ0A 1N7EA 2JILA 1W9QA 4N6XA 1U3BA 4YDPA 1OBYA 4K78A 3R0HA 2DKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVQ C;  1UM1 A;  2KAW A;  1WHA A;  5EZ0 A;  1V5Q A;  4JOG A;  4E35 A;  4NXQ A;  1RGW A;  1I16 A;  1LCY A;  5HET A;  2KOH A;  2Q3G A;  3OU0 A;  4JOF A;  2GZV A;  2QKU A;  2KPK A;  2I0L A;  5F67 A;  2CS5 A;  3VQG A;  5HFB A;  5HEY A;  3AXA A;  2H2B A;  3DIW A;  4YYX A;  3NFK A;  4K76 A;  2VPH A;  2DMZ A;  2HE2 A;  5G1E A;  2LC7 A;  3R69 A;  1UEQ A;  3LNX A;  1Q3O A;  2EGK A;  1QAV A;  3BPU A;  2EDZ A;  4G69 A;  1UEP A;  5H3J A;  1N7F A;  1RY4 A;  3KHF A;  1TP3 A;  1L6O A;  2ZPM A;  3CBZ A;  3TSW A;  4KFW A;  4UU6 A;  2OCS A;  4KFV A;  3GCN A;  3PDZ A;  2I0I A;  5HFE A;  2OGP A;  2EEJ A;  4JOH A;  2KBS A;  1UJV A;  2VWR A;  1I92 A;  1QLC A;  4GVC A;  2QBW A;  4NMS A;  3PV2 A;  4OAJ A;  2KJK A;  3OTP A;  1RGR A;  3TMH A;  2LUI A;  3ID1 A;  3SFJ A;  4NMQ A;  1YBO A;  1X45 A;  3RLE A;  2AIN A;  5E22 A;  2EJY A;  2EDP A;  2M3M A;  2M0U A;  2JWE A;  1WIF A;  5HFF A;  3DJA A;  5HDY A;  1Y7N A;  2O2T A;  4K6Y A;  1QAU A;  2M0Z A;  4GVD A;  5E1Y A;  2DLU A;  2W4F A;  5HEB A;  4HOP A;  4AMH A;  2BYG A;  1IU2 A;  3DOR A;  3WKM A;  1QAV B;  1GQ4 A;  4K72 A;  2H3M A;  5I7Z A;  3FY5 A;  1UF1 A;  1Z87 A;  3E17 A;  1P1E A;  3GGE A;  2AWW A;  4JOP A;  3MH4 A;  2H3L A;  2RCZ A;  1WFG A;  1SOZ A;  4IC6 A;  1FC9 A;  1XZ9 A;  2YTW A;  1UIT A;  2M0T A;  2HGA A;  3QDO A;  2V90 A;  1FC6 A;  4PQW A;  4K75 A;  4R2Z A;  4WYT A;  2KRG A;  2D90 A;  2IWO A;  3MH7 A;  5GND A;  2L4T A;  3O46 A;  5HED A;  1N99 A;  4JOE A;  2L97 A;  1WH1 A;  1MC7 A;  1VB7 A;  3QIK A;  4NXR A;  1U37 A;  4Q2Q A;  3RL7 A;  3CC0 A;  2JXO A;  1P1D A;  2KL1 A;  5E6P B;  2FCF A;  3CH8 A;  4L8N A;  2QKT A;  1WF8 A;  4JOJ A;  2REY A;  3STJ A;  3KZE A;  1G9O A;  2LA8 A;  4NMO A;  2VZ5 A;  3PS4 A;  3QE1 A;  2DLS A;  3L4F D;  3NGH A;  2VSV A;  4HOP B;  2EAQ A;  2VRF A;  5HJ1 A;  1UFX A;  2KJD A;  3QGL A;  5HFD A;  1D5G A;  3CYY A;  2UZC A;  2CSS A;  1GQ5 A;  2IWQ A;  2KPL A;  2FNE A;  2PDZ A;  2DAZ A;  5FB8 C;  1V1T A;  1ZUB A;  2MX6 A;  2I4S A;  2KYL A;  5G1D A;  2PA1 A;  3KZD A;  3R68 A;  2CSJ A;  4E3B A;  3I1E A;  3QO6 A;  1U38 A;  3K82 A;  3PDV A;  3GDS A;  3ZRT A;  2RRM A;  3K50 A;  2I04 A;  1UJU A;  4Q6S A;  2YUY A;  5HF1 A;  1OBX A;  4Q2N A;  2IWN A;  1Z86 A;  5GLJ A;  2LC6 A;  1T2M A;  2KQF A;  4Q2O A;  2KOM A;  1N7T A;  4P2A B;  5A2P A;  1UEW A;  3NFL A;  2PZD A;  2EGN A;  1RZX A;  4Q6H A;  2F0A A;  1KWA A;  5HFC A;  2M0V A;  5JXB A;  1MFL A;  2EV8 A;  2X7Z A;  3DJ3 A;  2D92 A;  4REY A;  1VCW A;  1FC7 A;  4WYU A;  1V5L A;  2KJP A;  2R4H A;  3I18 A;  3LNY A;  1WHD A;  3TSV A;  1SOT A;  1WI2 A;  3O5N A;  4E34 A;  1NF3 C;  2WL7 A;  5FHT A;  1N6E A;  3GJ9 A;  1TP5 A;  1OBZ A;  1N6F A;  1FCF A;  2QG1 A;  4UU5 A;  1IU0 A;  3EGH C;  4OEO A;  4MPA A;  2KV8 A;  2OZF A;  4Q2P A;  1X6D A;  3SUZ A;  1UHP A;  2KA9 A;  4H11 A;  3ID2 A;  1K32 A;  1WJL A;  1WG6 A;  1MFG A;  1U39 A;  4NXP A;  4OEP A;  1WI4 A;  1UEZ A;  4Q3H A;  3JXT A;  2AWU A;  3MH6 A;  1GM1 A;  2I6V A;  2YT8 A;  1R6J A;  2FN5 A;  5EYZ A;  2JIK A;  2W7R A;  1N6D A;  2Z9I A;  1Y8T A;  1UJD A;  2K20 A;  1TE0 A;  4NNL A;  1V62 A;  2MHO A;  4P0C A;  3WKL A;  1M5Z A;  4NNM A;  2VSP A;  2EHR A;  2FE5 A;  4Z8J A;  2D8I A;  4NMR A;  2I1N A;  1Q7X A;  2JRE A;  2G2L A;  2OSG A;  4GHN A;  1KEF A;  4O06 A;  5E21 A;  1ZOK A;  4JL7 A;  2YT7 A;  4NMP A;  3RL8 A;  2YUB A;  1UM7 A;  3ID4 A;  4JOR A;  1X8S A;  2DC2 A;  4F8K A;  1WFV A;  1X5Q A;  2Z17 A;  3ID3 A;  3GCO A;  2P3W A;  2EXG A;  3EGG C;  1W9O A;  2IWP A;  3SOE A;  2EGO A;  2JOA A;  2QKV A;  1NTE A;  3B76 A;  2KG2 A;  2OPG A;  4NMT A;  2QT5 A;  2EDV A;  5D13 A;  1X5N A;  2DM8 A;  5HF4 A;  1W9E A;  1Q3P A;  3VQF A;  2M10 A;  5B6L A;  1VAE A;  3PV5 A;  4Z33 A;  2H2C A;  3CS0 A;  2V1W A;  2F5Y A;  1IHJ A;  1V6B A;  2ZPL A;  3QJM A;  3CBX A;  3GDU A;  2EEG A;  2DJT A;  2LOB A;  2HE4 A;  2L4S A;  1PDR A;  3DJ1 A;  5E11 A;  2ENO A;  3SHU A;  4NMV A;  4FGM A;  2PKU A;  2DB5 A;  2JIN A;  2OMJ A;  1X5R A;  2G5M B;  2PKT A;  1WF7 A;  3I4W A;  1BE9 A;  4JOK A;  1B8Q A;  3TSZ A;  2OQS A;  2EEI A;  2EEH A;  3HPM A;  4XHV A;  3QJN A;  2PNT A;  3PV4 A;  3K1R A;  3HPK A;  1KY9 A;  4RI0 A;  2E7K A;  2Q9V A;  4LMM A;  2OS6 A;  3GDV A;  1TQ3 A;  2R3Y A;  2K1Z A;  3SHW A;  4EDJ A;  1BFE A;  2KOJ A;  2AWX A;  1VA8 A;  5F3X A;  3GSL A;  1VJ6 A;  3CBY A;  5DTH A;  1OZI A;  1N7E A;  2JIL A;  1W9Q A;  4N6X A;  1U3B A;  4YDP A;  1OBY A;  4K78 A;  3R0H A;  2DKR A; 
#chains in the Genus database with same CATH topology
 3HVQ C;  1UM1 A;  2KAW A;  1WHA A;  5EZ0 A;  1V5Q A;  4JOG A;  4E35 A;  4NXQ A;  1RGW A;  1I16 A;  1LCY A;  5HET A;  2KOH A;  2Q3G A;  3OU0 A;  4JOF A;  2GZV A;  2QKU A;  2KPK A;  2I0L A;  5F67 A;  2CS5 A;  3VQG A;  5HFB A;  3KDK A;  5HEY A;  3AXA A;  2H2B A;  3DIW A;  4YYX A;  3NFK A;  4K76 A;  2VPH A;  2DMZ A;  2HE2 A;  5G1E A;  2LC7 A;  3R69 A;  1UEQ A;  3LNX A;  1Q3O A;  2EGK A;  1QAV A;  3BPU A;  2EDZ A;  4G69 A;  1UEP A;  5H3J A;  1N7F A;  1RY4 A;  3KHF A;  1TP3 A;  1L6O A;  2ZPM A;  3CBZ A;  3TSW A;  4KFW A;  4UU6 A;  2OCS A;  4KFV A;  3GCN A;  3PDZ A;  2I0I A;  5HFE A;  2OGP A;  2EEJ A;  4JOH A;  2KBS A;  1UJV A;  2VWR A;  1I92 A;  1QLC A;  4GVC A;  2QBW A;  4NMS A;  3PV2 A;  5IL9 A;  4OAJ A;  2KJK A;  3OTP A;  1RGR A;  3TMH A;  2JSN A;  2LUI A;  3ID1 A;  3SFJ A;  4NMQ A;  1YBO A;  1X45 A;  3RLE A;  2AIN A;  5E22 A;  2EJY A;  2EDP A;  2M3M A;  2M0U A;  2JWE A;  1WIF A;  5HFF A;  3DJA A;  5HDY A;  1Y7N A;  2O2T A;  4K6Y A;  1QAU A;  2M0Z A;  4GVD A;  5E1Y A;  2DLU A;  2W4F A;  5HEB A;  4HOP A;  4AMH A;  2BYG A;  1IU2 A;  3DOR A;  3WKM A;  1QAV B;  1GQ4 A;  4K72 A;  2H3M A;  5I7Z A;  3FY5 A;  1UF1 A;  1Z87 A;  3E17 A;  1P1E A;  3GGE A;  2AWW A;  4JOP A;  3MH4 A;  2H3L A;  2RCZ A;  1WFG A;  1SOZ A;  4IC6 A;  1FC9 A;  1XZ9 A;  2YTW A;  1UIT A;  2M0T A;  2HGA A;  3QDO A;  2V90 A;  1FC6 A;  4PQW A;  4K75 A;  4R2Z A;  4WYT A;  2KRG A;  2D90 A;  2IWO A;  3MH7 A;  5GND A;  2L4T A;  3O46 A;  5HED A;  1N99 A;  4JOE A;  2L97 A;  1WH1 A;  1MC7 A;  1VB7 A;  3QIK A;  4NXR A;  1U37 A;  4Q2Q A;  3RL7 A;  3CC0 A;  2JXO A;  1P1D A;  2KL1 A;  5E6P B;  2FCF A;  3CH8 A;  4L8N A;  2QKT A;  1WF8 A;  4JOJ A;  2REY A;  3STJ A;  3KZE A;  4FLN A;  1G9O A;  2LA8 A;  4NMO A;  2VZ5 A;  3PS4 A;  3QE1 A;  2DLS A;  3L4F D;  3NGH A;  2VSV A;  4HOP B;  2EAQ A;  2VRF A;  5HJ1 A;  1UFX A;  2KJD A;  3QGL A;  5HFD A;  1D5G A;  3GAB A;  3CYY A;  2UZC A;  2CSS A;  1GQ5 A;  2IWQ A;  2KPL A;  2FNE A;  2PDZ A;  2DAZ A;  5FB8 C;  1V1T A;  1ZUB A;  2MX6 A;  2I4S A;  2KYL A;  5G1D A;  2PA1 A;  3KZD A;  3R68 A;  2CSJ A;  4E3B A;  3I1E A;  3QO6 A;  1U38 A;  3K82 A;  3PDV A;  5B42 A;  3GDS A;  3ZRT A;  2RRM A;  3K50 A;  2I04 A;  1UJU A;  4Q6S A;  2YUY A;  5HF1 A;  1OBX A;  4Q2N A;  2IWN A;  1Z86 A;  5GLJ A;  2LC6 A;  1T2M A;  2KQF A;  3KDG A;  4Q2O A;  2KOM A;  1N7T A;  4P2A B;  5A2P A;  1UEW A;  3NFL A;  2PZD A;  2EGN A;  1RZX A;  4Q6H A;  2F0A A;  1KWA A;  5HFC A;  2M0V A;  5JXB A;  1MFL A;  2EV8 A;  2X7Z A;  3DJ3 A;  2D92 A;  4REY A;  1VCW A;  1FC7 A;  1X9Z A;  4WYU A;  1V5L A;  2KJP A;  2R4H A;  3I18 A;  3LNY A;  1WHD A;  3TSV A;  1SOT A;  1WI2 A;  3O5N A;  4E34 A;  1NF3 C;  2WL7 A;  5FHT A;  1N6E A;  3GJ9 A;  1TP5 A;  1OBZ A;  1N6F A;  1FCF A;  2QG1 A;  4UU5 A;  1IU0 A;  3EGH C;  4OEO A;  4MPA A;  2KV8 A;  2OZF A;  4Q2P A;  1X6D A;  3SUZ A;  1UHP A;  2KA9 A;  4H11 A;  3ID2 A;  1K32 A;  1WJL A;  1WG6 A;  1MFG A;  1U39 A;  4NXP A;  4OEP A;  1WI4 A;  1UEZ A;  4Q3H A;  3JXT A;  2AWU A;  3MH6 A;  1GM1 A;  2GEF A;  2I6V A;  2YT8 A;  1R6J A;  2FN5 A;  5EYZ A;  2JIK A;  2W7R A;  1N6D A;  2Z9I A;  1Y8T A;  1UJD A;  2K20 A;  1TE0 A;  4NNL A;  1V62 A;  2MHO A;  4P0C A;  3WKL A;  1M5Z A;  4NNM A;  2VSP A;  2EHR A;  2FE5 A;  4Z8J A;  2D8I A;  4JJ3 A;  4NMR A;  2I1N A;  1Q7X A;  2JRE A;  2G2L A;  3NCV A;  2OSG A;  4GHN A;  1KEF A;  4O06 A;  5E21 A;  1ZOK A;  4JL7 A;  2YT7 A;  4NMP A;  3RL8 A;  2YUB A;  1UM7 A;  3ID4 A;  4JOR A;  1X8S A;  2DC2 A;  4F8K A;  1WFV A;  1X5Q A;  2Z17 A;  3ID3 A;  3GCO A;  5ILB A;  2P3W A;  2EXG A;  3EGG C;  1W9O A;  2IWP A;  3SOE A;  2EGO A;  2JOA A;  2QKV A;  1NTE A;  3B76 A;  2KG2 A;  2OPG A;  4NMT A;  2QT5 A;  2EDV A;  5D13 A;  1X5N A;  2DM8 A;  5HF4 A;  1W9E A;  1Q3P A;  3VQF A;  2M10 A;  5B6L A;  1VAE A;  3PV5 A;  4Z33 A;  2H2C A;  3CS0 A;  2V1W A;  2F5Y A;  1IHJ A;  1V6B A;  2ZPL A;  3QJM A;  3CBX A;  3GDU A;  2EEG A;  2DJT A;  2LOB A;  2HE4 A;  2L4S A;  1PDR A;  3DJ1 A;  5E11 A;  2ENO A;  3SHU A;  4NMV A;  4FGM A;  2PKU A;  2DB5 A;  2JIN A;  2OMJ A;  1X5R A;  2G5M B;  2PKT A;  1WF7 A;  3I4W A;  1BE9 A;  4JOK A;  1B8Q A;  3TSZ A;  2OQS A;  2EEI A;  2EEH A;  3HPM A;  4XHV A;  3QJN A;  2PNT A;  3PV4 A;  3K1R A;  3HPK A;  1KY9 A;  4RI0 A;  2E7K A;  2Q9V A;  4LMM A;  2OS6 A;  3GDV A;  1TQ3 A;  2R3Y A;  2K1Z A;  3SHW A;  4EDJ A;  1BFE A;  2KOJ A;  2AWX A;  1VA8 A;  5F3X A;  3GSL A;  1VJ6 A;  3CBY A;  5DTH A;  1OZI A;  4JJ0 A;  1N7E A;  2JIL A;  1W9Q A;  4N6X A;  1U3B A;  4YDP A;  1OBY A;  4K78 A;  3R0H A;  2DKR A; 
#chains in the Genus database with same CATH homology
 3HVQ C;  1UM1 A;  2KAW A;  1WHA A;  5EZ0 A;  1V5Q A;  4JOG A;  4E35 A;  4NXQ A;  1RGW A;  1I16 A;  1LCY A;  5HET A;  2KOH A;  2Q3G A;  3OU0 A;  4JOF A;  2GZV A;  2QKU A;  2KPK A;  2I0L A;  5F67 A;  2CS5 A;  3VQG A;  5HFB A;  3KDK A;  5HEY A;  3AXA A;  2H2B A;  3DIW A;  4YYX A;  3NFK A;  4K76 A;  2VPH A;  2DMZ A;  2HE2 A;  5G1E A;  2LC7 A;  3R69 A;  1UEQ A;  3LNX A;  1Q3O A;  2EGK A;  1QAV A;  3BPU A;  2EDZ A;  4G69 A;  1UEP A;  5H3J A;  1N7F A;  1RY4 A;  3KHF A;  1TP3 A;  1L6O A;  2ZPM A;  3CBZ A;  3TSW A;  4KFW A;  4UU6 A;  2OCS A;  4KFV A;  3GCN A;  3PDZ A;  2I0I A;  5HFE A;  2OGP A;  2EEJ A;  4JOH A;  2KBS A;  1UJV A;  2VWR A;  1I92 A;  1QLC A;  4GVC A;  2QBW A;  4NMS A;  3PV2 A;  5IL9 A;  4OAJ A;  2KJK A;  3OTP A;  1RGR A;  3TMH A;  2JSN A;  2LUI A;  3ID1 A;  3SFJ A;  4NMQ A;  1YBO A;  1X45 A;  3RLE A;  2AIN A;  5E22 A;  2EJY A;  2EDP A;  2M3M A;  2M0U A;  2JWE A;  1WIF A;  5HFF A;  3DJA A;  5HDY A;  1Y7N A;  2O2T A;  4K6Y A;  1QAU A;  2M0Z A;  4GVD A;  5E1Y A;  2DLU A;  2W4F A;  5HEB A;  4HOP A;  4AMH A;  2BYG A;  1IU2 A;  3DOR A;  3WKM A;  1QAV B;  1GQ4 A;  4K72 A;  2H3M A;  5I7Z A;  3FY5 A;  1UF1 A;  1Z87 A;  3E17 A;  1P1E A;  3GGE A;  2AWW A;  4JOP A;  3MH4 A;  2H3L A;  2RCZ A;  1WFG A;  1SOZ A;  4IC6 A;  1FC9 A;  1XZ9 A;  2YTW A;  1UIT A;  2M0T A;  2HGA A;  3QDO A;  2V90 A;  1FC6 A;  4PQW A;  4K75 A;  4R2Z A;  4WYT A;  2KRG A;  2D90 A;  2IWO A;  3MH7 A;  5GND A;  2L4T A;  3O46 A;  5HED A;  1N99 A;  4JOE A;  2L97 A;  1WH1 A;  1MC7 A;  1VB7 A;  3QIK A;  4NXR A;  1U37 A;  4Q2Q A;  3RL7 A;  3CC0 A;  2JXO A;  1P1D A;  2KL1 A;  5E6P B;  2FCF A;  3CH8 A;  4L8N A;  2QKT A;  1WF8 A;  4JOJ A;  2REY A;  3STJ A;  3KZE A;  4FLN A;  1G9O A;  2LA8 A;  4NMO A;  2VZ5 A;  3PS4 A;  3QE1 A;  2DLS A;  3L4F D;  3NGH A;  2VSV A;  4HOP B;  2EAQ A;  2VRF A;  5HJ1 A;  1UFX A;  2KJD A;  3QGL A;  5HFD A;  1D5G A;  3GAB A;  3CYY A;  2UZC A;  2CSS A;  1GQ5 A;  2IWQ A;  2KPL A;  2FNE A;  2PDZ A;  2DAZ A;  5FB8 C;  1V1T A;  1ZUB A;  2MX6 A;  2I4S A;  2KYL A;  5G1D A;  2PA1 A;  3KZD A;  3R68 A;  2CSJ A;  4E3B A;  3I1E A;  3QO6 A;  1U38 A;  3K82 A;  3PDV A;  5B42 A;  3GDS A;  3ZRT A;  2RRM A;  3K50 A;  2I04 A;  1UJU A;  4Q6S A;  2YUY A;  5HF1 A;  1OBX A;  4Q2N A;  2IWN A;  1Z86 A;  5GLJ A;  2LC6 A;  1T2M A;  2KQF A;  3KDG A;  4Q2O A;  2KOM A;  1N7T A;  4P2A B;  5A2P A;  1UEW A;  3NFL A;  2PZD A;  2EGN A;  1RZX A;  4Q6H A;  2F0A A;  1KWA A;  5HFC A;  2M0V A;  5JXB A;  1MFL A;  2EV8 A;  2X7Z A;  3DJ3 A;  2D92 A;  4REY A;  1VCW A;  1FC7 A;  1X9Z A;  4WYU A;  1V5L A;  2KJP A;  2R4H A;  3I18 A;  3LNY A;  1WHD A;  3TSV A;  1SOT A;  1WI2 A;  3O5N A;  4E34 A;  1NF3 C;  2WL7 A;  5FHT A;  1N6E A;  3GJ9 A;  1TP5 A;  1OBZ A;  1N6F A;  1FCF A;  2QG1 A;  4UU5 A;  1IU0 A;  3EGH C;  4OEO A;  4MPA A;  2KV8 A;  2OZF A;  4Q2P A;  1X6D A;  3SUZ A;  1UHP A;  2KA9 A;  4H11 A;  3ID2 A;  1K32 A;  1WJL A;  1WG6 A;  1MFG A;  1U39 A;  4NXP A;  4OEP A;  1WI4 A;  1UEZ A;  4Q3H A;  3JXT A;  2AWU A;  3MH6 A;  1GM1 A;  2GEF A;  2I6V A;  2YT8 A;  1R6J A;  2FN5 A;  5EYZ A;  2JIK A;  2W7R A;  1N6D A;  2Z9I A;  1Y8T A;  1UJD A;  2K20 A;  1TE0 A;  4NNL A;  1V62 A;  2MHO A;  4P0C A;  3WKL A;  1M5Z A;  4NNM A;  2VSP A;  2EHR A;  2FE5 A;  4Z8J A;  2D8I A;  4JJ3 A;  4NMR A;  2I1N A;  1Q7X A;  2JRE A;  2G2L A;  3NCV A;  2OSG A;  4GHN A;  1KEF A;  4O06 A;  5E21 A;  1ZOK A;  4JL7 A;  2YT7 A;  4NMP A;  3RL8 A;  2YUB A;  1UM7 A;  3ID4 A;  4JOR A;  1X8S A;  2DC2 A;  4F8K A;  1WFV A;  1X5Q A;  2Z17 A;  3ID3 A;  3GCO A;  5ILB A;  2P3W A;  2EXG A;  3EGG C;  1W9O A;  2IWP A;  3SOE A;  2EGO A;  2JOA A;  2QKV A;  1NTE A;  3B76 A;  2KG2 A;  2OPG A;  4NMT A;  2QT5 A;  2EDV A;  5D13 A;  1X5N A;  2DM8 A;  5HF4 A;  1W9E A;  1Q3P A;  3VQF A;  2M10 A;  5B6L A;  1VAE A;  3PV5 A;  4Z33 A;  2H2C A;  3CS0 A;  2V1W A;  2F5Y A;  1IHJ A;  1V6B A;  2ZPL A;  3QJM A;  3CBX A;  3GDU A;  2EEG A;  2DJT A;  2LOB A;  2HE4 A;  2L4S A;  1PDR A;  3DJ1 A;  5E11 A;  2ENO A;  3SHU A;  4NMV A;  4FGM A;  2PKU A;  2DB5 A;  2JIN A;  2OMJ A;  1X5R A;  2G5M B;  2PKT A;  1WF7 A;  3I4W A;  1BE9 A;  4JOK A;  1B8Q A;  3TSZ A;  2OQS A;  2EEI A;  2EEH A;  3HPM A;  4XHV A;  3QJN A;  2PNT A;  3PV4 A;  3K1R A;  3HPK A;  1KY9 A;  4RI0 A;  2E7K A;  2Q9V A;  4LMM A;  2OS6 A;  3GDV A;  1TQ3 A;  2R3Y A;  2K1Z A;  3SHW A;  4EDJ A;  1BFE A;  2KOJ A;  2AWX A;  1VA8 A;  5F3X A;  3GSL A;  1VJ6 A;  3CBY A;  5DTH A;  1OZI A;  4JJ0 A;  1N7E A;  2JIL A;  1W9Q A;  4N6X A;  1U3B A;  4YDP A;  1OBY A;  4K78 A;  3R0H A;  2DKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...