4KFVA

Structural insight into golgi membrane stacking by grasp65 and grasp55
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
199
structure length
199
Chain Sequence
GGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPSSQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Golgi reassembly-stacking protein 1
publication title Structural insight into Golgi membrane stacking by GRASP65 and GRASP55 proteins
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 46
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04495 GRASP55_65 GRASP55/65 PDZ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4kfvA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4kfvA01
1QAVA 2VSVA 5FB8C 3AXAA 2EV8A 4Q2QA 2R4HA 2MX6A 2CSJA 2H3LA 2EEHA 2PKTA 4NXPA 2D92A 2RCZA 4Q6SA 1R6JA 2I1NA 2K20A 4NMVA 3R0HA 2ENOA 1OBZA 3I18A 1IU0A 3STJA 2G2LA 1WHDA 1UJUA 2YUYA 2W7RA 1WI4A 2QT5A 3HVQC 3I1EA 4WYUA 1X5NA 3CYYA 2G5MB 3GJ9A 2OSGA 2M0VA 1VB7A 2W4FA 4JOFA 4FGMA 4Q2OA 2Z17A 4IC6A 1X45A 1QLCA 2EAQA 5F67A 2AINA 2ZPLA 1LCYA 2F5YA 3CBXA 1VCWA 2L97A 4R2ZA 1BFEA 4E34A 5EZ0A 1G9OA 2PA1A 1UFXA 2HE4A 5I7ZA 2EGOA 2IWNA 2M0ZA 3ID3A 3ID2A 3TSVA 1WJLA 3DORA 1BE9A 2D8IA 4K78A 3CC0A 5H3JA 2EGKA 2KYLA 3DJ3A 2KOJA 1FC6A 2KV8A 4UU5A 2LOBA 1FC7A 1SOTA 2M0UA 1Q3OA 3MH7A 3DIWA 3CBYA 2IWPA 3ZRTA 1MFGA 3PDZA 4HOPB 3ID4A 5D13A 1VA8A 1U37A 2REYA 1K32A 1TP3A 3DJ1A 2P3WA 1OBYA 2KA9A 1FCFA 1U39A 3NGHA 1W9OA 2LC6A 2I4SA 2I0LA 2OS6A 3FY5A 2PDZA 2PNTA 2KOHA 2M3MA 1V5QA 4NMRA 5E21A 2H2BA 5HF4A 1U38A 3JXTA 3OU0A 2HGAA 2EDZA 2BYGA 4Q6HA 3QGLA 2KPLA 2F0AA 4AMHA 3I4WA 2OCSA 3QJMA 4KFWA 1TE0A 3WKLA 5GLJA 5HDYA 1I92A 1WH1A 1UITA 3SHWA 3SUZA 2FCFA 3B76A 2K1ZA 1KEFA 2OZFA 1WIFA 2EDVA 2PZDA 3BPUA 4Z8JA 1UHPA 1SOZA 3TMHA 2JIKA 2OPGA 2YT7A 3L4FD 1RGRA 1ZUBA 4JOHA 1NF3C 3RL7A 4GVCA 2L4SA 2EJYA 2L4TA 2HE2A 1N7TA 3PV4A 1KY9A 4Q3HA 5HFBA 2AWUA 5FHTA 1Q3PA 4JOPA 3QJNA 1VAEA 1X5QA 5HFEA 5G1DA 1FC9A 3PV2A 2CS5A 5E11A 4K6YA 2M0TA 2R3YA 5HFFA 1ZOKA 2V90A 3VQFA 4NXQA 3TSZA 1UEQA 4NNMA 4F8KA 3CBZA 2RRMA 2JREA 5F3XA 2IWOA 2H3MA 5A2PA 3EGHC 4GHNA 2LA8A 2D90A 3MH4A 3GSLA 2VRFA 2PKUA 3SFJA 1P1DA 1V5LA 2MHOA 4JOGA 5HEDA 4L8NA 1X8SA 2JWEA 3WKMA 2I0IA 2KAWA 4Q2PA 5GNDA 1UEZA 2KOMA 2JOAA 2QKUA 5HFDA 2I04A 2KBSA 3K1RA 2DB5A 2EXGA 4JOEA 3QDOA 1KWAA 2EEGA 1T2MA 2DMZA 3SHUA 2GZVA 4K76A 1N6EA 4NMSA 3HPMA 5E1YA 2KPKA 1WFGA 4RI0A 1U3BA 4WYTA 1N99A 3KZDA 4HOPA 4Z33A 1UJDA 1XZ9A 4K75A 2JXOA 1D5GA 1UEWA 2Z9IA 1X5RA 2V1WA 3DJAA 1WF8A 1V62A 1V6BA 3ID1A 2VZ5A 1N7FA 3CS0A 3O5NA 3VQGA 5HFCA 4O06A 2DAZA 1QAVB 2QBWA 1OZIA 1V1TA 5G1EA 3PS4A 3SOEA 1RZXA 1N6DA 1UJVA 2FNEA 3QO6A 1I16A 4JOJA 2EHRA 2DJTA 4EDJA 1Y7NA 5EYZA 1B8QA 2O2TA 4JOKA 2KJDA 4NMTA 5HF1A 3KZEA 2FE5A 1TP5A 2AWWA 1MFLA 3E17A 4LMMA 2Q9VA 5JXBA 4E3BA 1GQ4A 2JILA 2LUIA 2EEIA 2DKRA 3R68A 4REYA 1MC7A 1RY4A 1W9EA 2VWRA 3MH6A 3PDVA 3LNYA 2OGPA 5DTHA 4E35A 1IHJA 4P2AB 2E7KA 1PDRA 4JORA 2H2CA 2UZCA 4NXRA 1WF7A 3GCNA 3HPKA 2KQFA 2YUBA 4G69A 3TSWA 2KG2A 4N6XA 3K82A 5HETA 2DM8A 2KJKA 4YYXA 2OMJA 1Y8TA 1QAUA 2JINA 1WG6A 1IU2A 2AWXA 3GDSA 4NMPA 1Z87A 3RLEA 4K72A 3NFLA 2KJPA 4KFVA 4P0CA 4OAJA 3GDVA 1WI2A 3GDUA 2DLSA 1WFVA 3GGEA 3RL8A 3O46A 3OTPA 2DLUA 2LC7A 2WL7A 3PV5A 4NNLA 1X6DA 3NFKA 4JL7A 1UM7A 4Q2NA 2DC2A 1OBXA 2Q3GA 1GQ5A 2EGNA 2KL1A 3R69A 5HJ1A 5B6LA 2QG1A 2CSSA 4OEOA 1GM1A 1UEPA 2IWQA 2X7ZA 1NTEA 2EDPA 4NMOA 3KHFA 2ZPMA 4OEPA 2QKTA 3EGGC 4GVDA 5E22A 4H11A 1UF1A 4YDPA 4PQWA 1VJ6A 2QKVA 3CH8A 2I6VA 1Z86A 4XHVA 1P1EA 1YBOA 3QE1A 2FN5A 5HEYA 3LNXA 4UU6A 1UM1A 1TQ3A 3K50A 1W9QA 2YT8A 1N7EA 2OQSA 2M10A 2VSPA 3QIKA 4MPAA 1RGWA 2VPHA 2KRGA 3GCOA 2YTWA 2EEJA 5E6PB 1M5ZA 1Q7XA 4NMQA 1L6OA 1WHAA 5HEBA 1N6FA
chains in the Genus database with same CATH superfamily
1QAVA 2VSVA 5FB8C 3AXAA 2EV8A 4Q2QA 2R4HA 2MX6A 2CSJA 2H3LA 2EEHA 2PKTA 4NXPA 2D92A 2RCZA 4Q6SA 1R6JA 2I1NA 2K20A 4NMVA 3R0HA 2ENOA 1OBZA 3I18A 1IU0A 3STJA 2G2LA 1WHDA 1UJUA 2YUYA 2W7RA 1WI4A 2QT5A 3HVQC 3I1EA 4WYUA 1X5NA 3CYYA 2G5MB 3GJ9A 2OSGA 2M0VA 1VB7A 2W4FA 4JOFA 4FGMA 4Q2OA 5B42A 2Z17A 4IC6A 1X45A 1QLCA 2EAQA 5F67A 2AINA 2ZPLA 1LCYA 2F5YA 3CBXA 1VCWA 2L97A 4R2ZA 1BFEA 4E34A 5EZ0A 1G9OA 2PA1A 1UFXA 2HE4A 5I7ZA 2EGOA 2IWNA 2M0ZA 3ID3A 3ID2A 3TSVA 2GEFA 4JJ0A 1WJLA 3DORA 1BE9A 2D8IA 4K78A 3CC0A 5H3JA 2EGKA 2KYLA 3DJ3A 2KOJA 1FC6A 2KV8A 4UU5A 2LOBA 1FC7A 1SOTA 2M0UA 1Q3OA 3MH7A 3DIWA 3CBYA 2IWPA 3ZRTA 1MFGA 3PDZA 4HOPB 3ID4A 5D13A 1VA8A 1U37A 2REYA 1K32A 1TP3A 3DJ1A 2P3WA 1OBYA 2KA9A 1FCFA 1U39A 3NGHA 1W9OA 2LC6A 2I4SA 2I0LA 2OS6A 3FY5A 2PDZA 2PNTA 2KOHA 2M3MA 1V5QA 4NMRA 5E21A 2H2BA 5HF4A 1U38A 3JXTA 3OU0A 2HGAA 2EDZA 2BYGA 4Q6HA 3QGLA 2KPLA 2F0AA 4AMHA 3I4WA 2OCSA 3QJMA 4KFWA 1TE0A 3WKLA 5GLJA 5HDYA 1I92A 1WH1A 1UITA 3SHWA 3SUZA 2FCFA 3B76A 2K1ZA 1KEFA 2OZFA 1WIFA 2EDVA 2PZDA 3BPUA 4Z8JA 1UHPA 1SOZA 3TMHA 2JIKA 2OPGA 2YT7A 3L4FD 1RGRA 1ZUBA 4JOHA 1NF3C 3RL7A 4GVCA 2L4SA 2EJYA 2L4TA 2HE2A 1N7TA 3PV4A 1KY9A 4Q3HA 5HFBA 2AWUA 5FHTA 1Q3PA 4JOPA 3QJNA 1VAEA 1X5QA 5HFEA 5G1DA 1FC9A 3PV2A 2CS5A 5E11A 4K6YA 2M0TA 2R3YA 5HFFA 1ZOKA 2V90A 3VQFA 4NXQA 3TSZA 1UEQA 4NNMA 4F8KA 3CBZA 2RRMA 2JREA 5F3XA 2IWOA 2H3MA 5A2PA 3EGHC 4GHNA 2LA8A 2D90A 3MH4A 3GSLA 2VRFA 2PKUA 3SFJA 1P1DA 1V5LA 2MHOA 4JOGA 5HEDA 4L8NA 1X8SA 2JWEA 3WKMA 2I0IA 2KAWA 4Q2PA 5GNDA 1UEZA 2KOMA 2JOAA 2QKUA 5HFDA 2I04A 3NCVA 2KBSA 3K1RA 2DB5A 2EXGA 4JOEA 3QDOA 1KWAA 2EEGA 1T2MA 2DMZA 3SHUA 2GZVA 4K76A 1N6EA 4NMSA 3HPMA 5E1YA 2KPKA 1WFGA 4RI0A 1U3BA 4WYTA 1N99A 3KZDA 4HOPA 4Z33A 1UJDA 1XZ9A 4K75A 2JXOA 1D5GA 1UEWA 2Z9IA 1X5RA 2V1WA 3DJAA 1WF8A 1V62A 1V6BA 3ID1A 2VZ5A 1N7FA 3CS0A 3O5NA 3VQGA 5HFCA 4O06A 2DAZA 1QAVB 2QBWA 1OZIA 1V1TA 5G1EA 3PS4A 3SOEA 1RZXA 1N6DA 1UJVA 2FNEA 3QO6A 1I16A 4JOJA 2EHRA 2DJTA 4EDJA 1Y7NA 5EYZA 1B8QA 2O2TA 4JOKA 2KJDA 4NMTA 5HF1A 3KZEA 2FE5A 1TP5A 2AWWA 1MFLA 3E17A 4LMMA 2Q9VA 5JXBA 4E3BA 1GQ4A 2JILA 2LUIA 2EEIA 2DKRA 3R68A 4REYA 1MC7A 1RY4A 3GABA 1W9EA 2VWRA 3MH6A 3PDVA 3LNYA 2OGPA 5DTHA 4E35A 4FLNA 1IHJA 4P2AB 2E7KA 1PDRA 4JORA 2H2CA 2UZCA 4NXRA 1WF7A 3GCNA 3HPKA 2KQFA 2YUBA 4G69A 3TSWA 2KG2A 4N6XA 3K82A 5HETA 2DM8A 2KJKA 4YYXA 2OMJA 1Y8TA 1QAUA 2JINA 1WG6A 1IU2A 2AWXA 3GDSA 4NMPA 1Z87A 3RLEA 4K72A 3NFLA 2KJPA 4KFVA 4P0CA 4OAJA 5ILBA 3GDVA 1WI2A 3GDUA 2DLSA 1WFVA 3GGEA 3RL8A 3O46A 3OTPA 2DLUA 2LC7A 2WL7A 3PV5A 4NNLA 1X6DA 3NFKA 4JL7A 1UM7A 4Q2NA 2DC2A 1OBXA 2Q3GA 1GQ5A 2EGNA 2KL1A 3R69A 5HJ1A 5B6LA 1X9ZA 2QG1A 2CSSA 4OEOA 1GM1A 2JSNA 1UEPA 2IWQA 2X7ZA 1NTEA 2EDPA 4NMOA 3KHFA 2ZPMA 4OEPA 2QKTA 3EGGC 4GVDA 5E22A 4H11A 1UF1A 4YDPA 4PQWA 1VJ6A 4JJ3A 2QKVA 3CH8A 2I6VA 1Z86A 4XHVA 1P1EA 1YBOA 3QE1A 2FN5A 5HEYA 3LNXA 4UU6A 1UM1A 1TQ3A 3K50A 1W9QA 2YT8A 1N7EA 2OQSA 2M10A 2VSPA 3QIKA 4MPAA 3KDKA 1RGWA 2VPHA 5IL9A 3KDGA 2KRGA 3GCOA 2YTWA 2EEJA 5E6PB 1M5ZA 1Q7XA 4NMQA 1L6OA 1WHAA 5HEBA 1N6FA
chains in the Genus database with same CATH topology
1QAVA 2VSVA 5FB8C 3AXAA 2EV8A 4Q2QA 2R4HA 2MX6A 2CSJA 2H3LA 2EEHA 2PKTA 4NXPA 2D92A 2RCZA 4Q6SA 1R6JA 2I1NA 2K20A 4NMVA 3R0HA 2ENOA 1OBZA 3I18A 1IU0A 3STJA 2G2LA 1WHDA 1UJUA 2YUYA 2W7RA 1WI4A 2QT5A 3HVQC 3I1EA 4WYUA 1X5NA 3CYYA 2G5MB 3GJ9A 2OSGA 2M0VA 1VB7A 2W4FA 4JOFA 4FGMA 4Q2OA 5B42A 2Z17A 4IC6A 1X45A 1QLCA 2EAQA 5F67A 2AINA 2ZPLA 1LCYA 2F5YA 3CBXA 1VCWA 2L97A 4R2ZA 1BFEA 4E34A 5EZ0A 1G9OA 2PA1A 1UFXA 2HE4A 5I7ZA 2EGOA 2IWNA 2M0ZA 3ID3A 3ID2A 3TSVA 2GEFA 4JJ0A 1WJLA 3DORA 1BE9A 2D8IA 4K78A 3CC0A 5H3JA 2EGKA 2KYLA 3DJ3A 2KOJA 1FC6A 2KV8A 4UU5A 2LOBA 1FC7A 1SOTA 2M0UA 1Q3OA 3MH7A 3DIWA 3CBYA 2IWPA 3ZRTA 1MFGA 3PDZA 4HOPB 3ID4A 5D13A 1VA8A 1U37A 2REYA 1K32A 1TP3A 3DJ1A 2P3WA 1OBYA 2KA9A 1FCFA 1U39A 3NGHA 1W9OA 2LC6A 2I4SA 2I0LA 2OS6A 3FY5A 2PDZA 2PNTA 2KOHA 2M3MA 1V5QA 4NMRA 5E21A 2H2BA 5HF4A 1U38A 3JXTA 3OU0A 2HGAA 2EDZA 2BYGA 4Q6HA 3QGLA 2KPLA 2F0AA 4AMHA 3I4WA 2OCSA 3QJMA 4KFWA 1TE0A 3WKLA 5GLJA 5HDYA 1I92A 1WH1A 1UITA 3SHWA 3SUZA 2FCFA 3B76A 2K1ZA 1KEFA 2OZFA 1WIFA 2EDVA 2PZDA 3BPUA 4Z8JA 1UHPA 1SOZA 3TMHA 2JIKA 2OPGA 2YT7A 3L4FD 1RGRA 1ZUBA 4JOHA 1NF3C 3RL7A 4GVCA 2L4SA 2EJYA 2L4TA 2HE2A 1N7TA 3PV4A 1KY9A 4Q3HA 5HFBA 2AWUA 5FHTA 1Q3PA 4JOPA 3QJNA 1VAEA 1X5QA 5HFEA 5G1DA 1FC9A 3PV2A 2CS5A 5E11A 4K6YA 2M0TA 2R3YA 5HFFA 1ZOKA 2V90A 3VQFA 4NXQA 3TSZA 1UEQA 4NNMA 4F8KA 3CBZA 2RRMA 2JREA 5F3XA 2IWOA 2H3MA 5A2PA 3EGHC 4GHNA 2LA8A 2D90A 3MH4A 3GSLA 2VRFA 2PKUA 3SFJA 1P1DA 1V5LA 2MHOA 4JOGA 5HEDA 4L8NA 1X8SA 2JWEA 3WKMA 2I0IA 2KAWA 4Q2PA 5GNDA 1UEZA 2KOMA 2JOAA 2QKUA 5HFDA 2I04A 3NCVA 2KBSA 3K1RA 2DB5A 2EXGA 4JOEA 3QDOA 1KWAA 2EEGA 1T2MA 2DMZA 3SHUA 2GZVA 4K76A 1N6EA 4NMSA 3HPMA 5E1YA 2KPKA 1WFGA 4RI0A 1U3BA 4WYTA 1N99A 3KZDA 4HOPA 4Z33A 1UJDA 1XZ9A 4K75A 2JXOA 1D5GA 1UEWA 2Z9IA 1X5RA 2V1WA 3DJAA 1WF8A 1V62A 1V6BA 3ID1A 2VZ5A 1N7FA 3CS0A 3O5NA 3VQGA 5HFCA 4O06A 2DAZA 1QAVB 2QBWA 1OZIA 1V1TA 5G1EA 3PS4A 3SOEA 1RZXA 1N6DA 1UJVA 2FNEA 3QO6A 1I16A 4JOJA 2EHRA 2DJTA 4EDJA 1Y7NA 5EYZA 1B8QA 2O2TA 4JOKA 2KJDA 4NMTA 5HF1A 3KZEA 2FE5A 1TP5A 2AWWA 1MFLA 3E17A 4LMMA 2Q9VA 5JXBA 4E3BA 1GQ4A 2JILA 2LUIA 2EEIA 2DKRA 3R68A 4REYA 1MC7A 1RY4A 3GABA 1W9EA 2VWRA 3MH6A 3PDVA 3LNYA 2OGPA 5DTHA 4E35A 4FLNA 1IHJA 4P2AB 2E7KA 1PDRA 4JORA 2H2CA 2UZCA 4NXRA 1WF7A 3GCNA 3HPKA 2KQFA 2YUBA 4G69A 3TSWA 2KG2A 4N6XA 3K82A 5HETA 2DM8A 2KJKA 4YYXA 2OMJA 1Y8TA 1QAUA 2JINA 1WG6A 1IU2A 2AWXA 3GDSA 4NMPA 1Z87A 3RLEA 4K72A 3NFLA 2KJPA 4KFVA 4P0CA 4OAJA 5ILBA 3GDVA 1WI2A 3GDUA 2DLSA 1WFVA 3GGEA 3RL8A 3O46A 3OTPA 2DLUA 2LC7A 2WL7A 3PV5A 4NNLA 1X6DA 3NFKA 4JL7A 1UM7A 4Q2NA 2DC2A 1OBXA 2Q3GA 1GQ5A 2EGNA 2KL1A 3R69A 5HJ1A 5B6LA 1X9ZA 2QG1A 2CSSA 4OEOA 1GM1A 2JSNA 1UEPA 2IWQA 2X7ZA 1NTEA 2EDPA 4NMOA 3KHFA 2ZPMA 4OEPA 2QKTA 3EGGC 4GVDA 5E22A 4H11A 1UF1A 4YDPA 4PQWA 1VJ6A 4JJ3A 2QKVA 3CH8A 2I6VA 1Z86A 4XHVA 1P1EA 1YBOA 3QE1A 2FN5A 5HEYA 3LNXA 4UU6A 1UM1A 1TQ3A 3K50A 1W9QA 2YT8A 1N7EA 2OQSA 2M10A 2VSPA 3QIKA 4MPAA 3KDKA 1RGWA 2VPHA 5IL9A 3KDGA 2KRGA 3GCOA 2YTWA 2EEJA 5E6PB 1M5ZA 1Q7XA 4NMQA 1L6OA 1WHAA 5HEBA 1N6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAV A;  2VSV A;  5FB8 C;  3AXA A;  2EV8 A;  4Q2Q A;  2R4H A;  2MX6 A;  2CSJ A;  2H3L A;  2EEH A;  2PKT A;  4NXP A;  2D92 A;  2RCZ A;  4Q6S A;  1R6J A;  2I1N A;  2K20 A;  4NMV A;  3R0H A;  2ENO A;  1OBZ A;  3I18 A;  1IU0 A;  3STJ A;  2G2L A;  1WHD A;  1UJU A;  2YUY A;  2W7R A;  1WI4 A;  2QT5 A;  3HVQ C;  3I1E A;  4WYU A;  1X5N A;  3CYY A;  2G5M B;  3GJ9 A;  2OSG A;  2M0V A;  1VB7 A;  2W4F A;  4JOF A;  4FGM A;  4Q2O A;  2Z17 A;  4IC6 A;  1X45 A;  1QLC A;  2EAQ A;  5F67 A;  2AIN A;  2ZPL A;  1LCY A;  2F5Y A;  3CBX A;  1VCW A;  2L97 A;  4R2Z A;  1BFE A;  4E34 A;  5EZ0 A;  1G9O A;  2PA1 A;  1UFX A;  2HE4 A;  5I7Z A;  2EGO A;  2IWN A;  2M0Z A;  3ID3 A;  3ID2 A;  3TSV A;  1WJL A;  3DOR A;  1BE9 A;  2D8I A;  4K78 A;  3CC0 A;  5H3J A;  2EGK A;  2KYL A;  3DJ3 A;  2KOJ A;  1FC6 A;  2KV8 A;  4UU5 A;  2LOB A;  1FC7 A;  1SOT A;  2M0U A;  1Q3O A;  3MH7 A;  3DIW A;  3CBY A;  2IWP A;  3ZRT A;  1MFG A;  3PDZ A;  4HOP B;  3ID4 A;  5D13 A;  1VA8 A;  1U37 A;  2REY A;  1K32 A;  1TP3 A;  3DJ1 A;  2P3W A;  1OBY A;  2KA9 A;  1FCF A;  1U39 A;  3NGH A;  1W9O A;  2LC6 A;  2I4S A;  2I0L A;  2OS6 A;  3FY5 A;  2PDZ A;  2PNT A;  2KOH A;  2M3M A;  1V5Q A;  4NMR A;  5E21 A;  2H2B A;  5HF4 A;  1U38 A;  3JXT A;  3OU0 A;  2HGA A;  2EDZ A;  2BYG A;  4Q6H A;  3QGL A;  2KPL A;  2F0A A;  4AMH A;  3I4W A;  2OCS A;  3QJM A;  4KFW A;  1TE0 A;  3WKL A;  5GLJ A;  5HDY A;  1I92 A;  1WH1 A;  1UIT A;  3SHW A;  3SUZ A;  2FCF A;  3B76 A;  2K1Z A;  1KEF A;  2OZF A;  1WIF A;  2EDV A;  2PZD A;  3BPU A;  4Z8J A;  1UHP A;  1SOZ A;  3TMH A;  2JIK A;  2OPG A;  2YT7 A;  3L4F D;  1RGR A;  1ZUB A;  4JOH A;  1NF3 C;  3RL7 A;  4GVC A;  2L4S A;  2EJY A;  2L4T A;  2HE2 A;  1N7T A;  3PV4 A;  1KY9 A;  4Q3H A;  5HFB A;  2AWU A;  5FHT A;  1Q3P A;  4JOP A;  3QJN A;  1VAE A;  1X5Q A;  5HFE A;  5G1D A;  1FC9 A;  3PV2 A;  2CS5 A;  5E11 A;  4K6Y A;  2M0T A;  2R3Y A;  5HFF A;  1ZOK A;  2V90 A;  3VQF A;  4NXQ A;  3TSZ A;  1UEQ A;  4NNM A;  4F8K A;  3CBZ A;  2RRM A;  2JRE A;  5F3X A;  2IWO A;  2H3M A;  5A2P A;  3EGH C;  4GHN A;  2LA8 A;  2D90 A;  3MH4 A;  3GSL A;  2VRF A;  2PKU A;  3SFJ A;  1P1D A;  1V5L A;  2MHO A;  4JOG A;  5HED A;  4L8N A;  1X8S A;  2JWE A;  3WKM A;  2I0I A;  2KAW A;  4Q2P A;  5GND A;  1UEZ A;  2KOM A;  2JOA A;  2QKU A;  5HFD A;  2I04 A;  2KBS A;  3K1R A;  2DB5 A;  2EXG A;  4JOE A;  3QDO A;  1KWA A;  2EEG A;  1T2M A;  2DMZ A;  3SHU A;  2GZV A;  4K76 A;  1N6E A;  4NMS A;  3HPM A;  5E1Y A;  2KPK A;  1WFG A;  4RI0 A;  1U3B A;  4WYT A;  1N99 A;  3KZD A;  4HOP A;  4Z33 A;  1UJD A;  1XZ9 A;  4K75 A;  2JXO A;  1D5G A;  1UEW A;  2Z9I A;  1X5R A;  2V1W A;  3DJA A;  1WF8 A;  1V62 A;  1V6B A;  3ID1 A;  2VZ5 A;  1N7F A;  3CS0 A;  3O5N A;  3VQG A;  5HFC A;  4O06 A;  2DAZ A;  1QAV B;  2QBW A;  1OZI A;  1V1T A;  5G1E A;  3PS4 A;  3SOE A;  1RZX A;  1N6D A;  1UJV A;  2FNE A;  3QO6 A;  1I16 A;  4JOJ A;  2EHR A;  2DJT A;  4EDJ A;  1Y7N A;  5EYZ A;  1B8Q A;  2O2T A;  4JOK A;  2KJD A;  4NMT A;  5HF1 A;  3KZE A;  2FE5 A;  1TP5 A;  2AWW A;  1MFL A;  3E17 A;  4LMM A;  2Q9V A;  5JXB A;  4E3B A;  1GQ4 A;  2JIL A;  2LUI A;  2EEI A;  2DKR A;  3R68 A;  4REY A;  1MC7 A;  1RY4 A;  1W9E A;  2VWR A;  3MH6 A;  3PDV A;  3LNY A;  2OGP A;  5DTH A;  4E35 A;  1IHJ A;  4P2A B;  2E7K A;  1PDR A;  4JOR A;  2H2C A;  2UZC A;  4NXR A;  1WF7 A;  3GCN A;  3HPK A;  2KQF A;  2YUB A;  4G69 A;  3TSW A;  2KG2 A;  4N6X A;  3K82 A;  5HET A;  2DM8 A;  2KJK A;  4YYX A;  2OMJ A;  1Y8T A;  1QAU A;  2JIN A;  1WG6 A;  1IU2 A;  2AWX A;  3GDS A;  4NMP A;  1Z87 A;  3RLE A;  4K72 A;  3NFL A;  2KJP A;  4KFV A;  4P0C A;  4OAJ A;  3GDV A;  1WI2 A;  3GDU A;  2DLS A;  1WFV A;  3GGE A;  3RL8 A;  3O46 A;  3OTP A;  2DLU A;  2LC7 A;  2WL7 A;  3PV5 A;  4NNL A;  1X6D A;  3NFK A;  4JL7 A;  1UM7 A;  4Q2N A;  2DC2 A;  1OBX A;  2Q3G A;  1GQ5 A;  2EGN A;  2KL1 A;  3R69 A;  5HJ1 A;  5B6L A;  2QG1 A;  2CSS A;  4OEO A;  1GM1 A;  1UEP A;  2IWQ A;  2X7Z A;  1NTE A;  2EDP A;  4NMO A;  3KHF A;  2ZPM A;  4OEP A;  2QKT A;  3EGG C;  4GVD A;  5E22 A;  4H11 A;  1UF1 A;  4YDP A;  4PQW A;  1VJ6 A;  2QKV A;  3CH8 A;  2I6V A;  1Z86 A;  4XHV A;  1P1E A;  1YBO A;  3QE1 A;  2FN5 A;  5HEY A;  3LNX A;  4UU6 A;  1UM1 A;  1TQ3 A;  3K50 A;  1W9Q A;  2YT8 A;  1N7E A;  2OQS A;  2M10 A;  2VSP A;  3QIK A;  4MPA A;  1RGW A;  2VPH A;  2KRG A;  3GCO A;  2YTW A;  2EEJ A;  5E6P B;  1M5Z A;  1Q7X A;  4NMQ A;  1L6O A;  1WHA A;  5HEB A;  1N6F A; 
#chains in the Genus database with same CATH topology
 1QAV A;  2VSV A;  5FB8 C;  3AXA A;  2EV8 A;  4Q2Q A;  2R4H A;  2MX6 A;  2CSJ A;  2H3L A;  2EEH A;  2PKT A;  4NXP A;  2D92 A;  2RCZ A;  4Q6S A;  1R6J A;  2I1N A;  2K20 A;  4NMV A;  3R0H A;  2ENO A;  1OBZ A;  3I18 A;  1IU0 A;  3STJ A;  2G2L A;  1WHD A;  1UJU A;  2YUY A;  2W7R A;  1WI4 A;  2QT5 A;  3HVQ C;  3I1E A;  4WYU A;  1X5N A;  3CYY A;  2G5M B;  3GJ9 A;  2OSG A;  2M0V A;  1VB7 A;  2W4F A;  4JOF A;  4FGM A;  4Q2O A;  5B42 A;  2Z17 A;  4IC6 A;  1X45 A;  1QLC A;  2EAQ A;  5F67 A;  2AIN A;  2ZPL A;  1LCY A;  2F5Y A;  3CBX A;  1VCW A;  2L97 A;  4R2Z A;  1BFE A;  4E34 A;  5EZ0 A;  1G9O A;  2PA1 A;  1UFX A;  2HE4 A;  5I7Z A;  2EGO A;  2IWN A;  2M0Z A;  3ID3 A;  3ID2 A;  3TSV A;  2GEF A;  4JJ0 A;  1WJL A;  3DOR A;  1BE9 A;  2D8I A;  4K78 A;  3CC0 A;  5H3J A;  2EGK A;  2KYL A;  3DJ3 A;  2KOJ A;  1FC6 A;  2KV8 A;  4UU5 A;  2LOB A;  1FC7 A;  1SOT A;  2M0U A;  1Q3O A;  3MH7 A;  3DIW A;  3CBY A;  2IWP A;  3ZRT A;  1MFG A;  3PDZ A;  4HOP B;  3ID4 A;  5D13 A;  1VA8 A;  1U37 A;  2REY A;  1K32 A;  1TP3 A;  3DJ1 A;  2P3W A;  1OBY A;  2KA9 A;  1FCF A;  1U39 A;  3NGH A;  1W9O A;  2LC6 A;  2I4S A;  2I0L A;  2OS6 A;  3FY5 A;  2PDZ A;  2PNT A;  2KOH A;  2M3M A;  1V5Q A;  4NMR A;  5E21 A;  2H2B A;  5HF4 A;  1U38 A;  3JXT A;  3OU0 A;  2HGA A;  2EDZ A;  2BYG A;  4Q6H A;  3QGL A;  2KPL A;  2F0A A;  4AMH A;  3I4W A;  2OCS A;  3QJM A;  4KFW A;  1TE0 A;  3WKL A;  5GLJ A;  5HDY A;  1I92 A;  1WH1 A;  1UIT A;  3SHW A;  3SUZ A;  2FCF A;  3B76 A;  2K1Z A;  1KEF A;  2OZF A;  1WIF A;  2EDV A;  2PZD A;  3BPU A;  4Z8J A;  1UHP A;  1SOZ A;  3TMH A;  2JIK A;  2OPG A;  2YT7 A;  3L4F D;  1RGR A;  1ZUB A;  4JOH A;  1NF3 C;  3RL7 A;  4GVC A;  2L4S A;  2EJY A;  2L4T A;  2HE2 A;  1N7T A;  3PV4 A;  1KY9 A;  4Q3H A;  5HFB A;  2AWU A;  5FHT A;  1Q3P A;  4JOP A;  3QJN A;  1VAE A;  1X5Q A;  5HFE A;  5G1D A;  1FC9 A;  3PV2 A;  2CS5 A;  5E11 A;  4K6Y A;  2M0T A;  2R3Y A;  5HFF A;  1ZOK A;  2V90 A;  3VQF A;  4NXQ A;  3TSZ A;  1UEQ A;  4NNM A;  4F8K A;  3CBZ A;  2RRM A;  2JRE A;  5F3X A;  2IWO A;  2H3M A;  5A2P A;  3EGH C;  4GHN A;  2LA8 A;  2D90 A;  3MH4 A;  3GSL A;  2VRF A;  2PKU A;  3SFJ A;  1P1D A;  1V5L A;  2MHO A;  4JOG A;  5HED A;  4L8N A;  1X8S A;  2JWE A;  3WKM A;  2I0I A;  2KAW A;  4Q2P A;  5GND A;  1UEZ A;  2KOM A;  2JOA A;  2QKU A;  5HFD A;  2I04 A;  3NCV A;  2KBS A;  3K1R A;  2DB5 A;  2EXG A;  4JOE A;  3QDO A;  1KWA A;  2EEG A;  1T2M A;  2DMZ A;  3SHU A;  2GZV A;  4K76 A;  1N6E A;  4NMS A;  3HPM A;  5E1Y A;  2KPK A;  1WFG A;  4RI0 A;  1U3B A;  4WYT A;  1N99 A;  3KZD A;  4HOP A;  4Z33 A;  1UJD A;  1XZ9 A;  4K75 A;  2JXO A;  1D5G A;  1UEW A;  2Z9I A;  1X5R A;  2V1W A;  3DJA A;  1WF8 A;  1V62 A;  1V6B A;  3ID1 A;  2VZ5 A;  1N7F A;  3CS0 A;  3O5N A;  3VQG A;  5HFC A;  4O06 A;  2DAZ A;  1QAV B;  2QBW A;  1OZI A;  1V1T A;  5G1E A;  3PS4 A;  3SOE A;  1RZX A;  1N6D A;  1UJV A;  2FNE A;  3QO6 A;  1I16 A;  4JOJ A;  2EHR A;  2DJT A;  4EDJ A;  1Y7N A;  5EYZ A;  1B8Q A;  2O2T A;  4JOK A;  2KJD A;  4NMT A;  5HF1 A;  3KZE A;  2FE5 A;  1TP5 A;  2AWW A;  1MFL A;  3E17 A;  4LMM A;  2Q9V A;  5JXB A;  4E3B A;  1GQ4 A;  2JIL A;  2LUI A;  2EEI A;  2DKR A;  3R68 A;  4REY A;  1MC7 A;  1RY4 A;  3GAB A;  1W9E A;  2VWR A;  3MH6 A;  3PDV A;  3LNY A;  2OGP A;  5DTH A;  4E35 A;  4FLN A;  1IHJ A;  4P2A B;  2E7K A;  1PDR A;  4JOR A;  2H2C A;  2UZC A;  4NXR A;  1WF7 A;  3GCN A;  3HPK A;  2KQF A;  2YUB A;  4G69 A;  3TSW A;  2KG2 A;  4N6X A;  3K82 A;  5HET A;  2DM8 A;  2KJK A;  4YYX A;  2OMJ A;  1Y8T A;  1QAU A;  2JIN A;  1WG6 A;  1IU2 A;  2AWX A;  3GDS A;  4NMP A;  1Z87 A;  3RLE A;  4K72 A;  3NFL A;  2KJP A;  4KFV A;  4P0C A;  4OAJ A;  5ILB A;  3GDV A;  1WI2 A;  3GDU A;  2DLS A;  1WFV A;  3GGE A;  3RL8 A;  3O46 A;  3OTP A;  2DLU A;  2LC7 A;  2WL7 A;  3PV5 A;  4NNL A;  1X6D A;  3NFK A;  4JL7 A;  1UM7 A;  4Q2N A;  2DC2 A;  1OBX A;  2Q3G A;  1GQ5 A;  2EGN A;  2KL1 A;  3R69 A;  5HJ1 A;  5B6L A;  1X9Z A;  2QG1 A;  2CSS A;  4OEO A;  1GM1 A;  2JSN A;  1UEP A;  2IWQ A;  2X7Z A;  1NTE A;  2EDP A;  4NMO A;  3KHF A;  2ZPM A;  4OEP A;  2QKT A;  3EGG C;  4GVD A;  5E22 A;  4H11 A;  1UF1 A;  4YDP A;  4PQW A;  1VJ6 A;  4JJ3 A;  2QKV A;  3CH8 A;  2I6V A;  1Z86 A;  4XHV A;  1P1E A;  1YBO A;  3QE1 A;  2FN5 A;  5HEY A;  3LNX A;  4UU6 A;  1UM1 A;  1TQ3 A;  3K50 A;  1W9Q A;  2YT8 A;  1N7E A;  2OQS A;  2M10 A;  2VSP A;  3QIK A;  4MPA A;  3KDK A;  1RGW A;  2VPH A;  5IL9 A;  3KDG A;  2KRG A;  3GCO A;  2YTW A;  2EEJ A;  5E6P B;  1M5Z A;  1Q7X A;  4NMQ A;  1L6O A;  1WHA A;  5HEB A;  1N6F A; 
#chains in the Genus database with same CATH homology
 1QAV A;  2VSV A;  5FB8 C;  3AXA A;  2EV8 A;  4Q2Q A;  2R4H A;  2MX6 A;  2CSJ A;  2H3L A;  2EEH A;  2PKT A;  4NXP A;  2D92 A;  2RCZ A;  4Q6S A;  1R6J A;  2I1N A;  2K20 A;  4NMV A;  3R0H A;  2ENO A;  1OBZ A;  3I18 A;  1IU0 A;  3STJ A;  2G2L A;  1WHD A;  1UJU A;  2YUY A;  2W7R A;  1WI4 A;  2QT5 A;  3HVQ C;  3I1E A;  4WYU A;  1X5N A;  3CYY A;  2G5M B;  3GJ9 A;  2OSG A;  2M0V A;  1VB7 A;  2W4F A;  4JOF A;  4FGM A;  4Q2O A;  5B42 A;  2Z17 A;  4IC6 A;  1X45 A;  1QLC A;  2EAQ A;  5F67 A;  2AIN A;  2ZPL A;  1LCY A;  2F5Y A;  3CBX A;  1VCW A;  2L97 A;  4R2Z A;  1BFE A;  4E34 A;  5EZ0 A;  1G9O A;  2PA1 A;  1UFX A;  2HE4 A;  5I7Z A;  2EGO A;  2IWN A;  2M0Z A;  3ID3 A;  3ID2 A;  3TSV A;  2GEF A;  4JJ0 A;  1WJL A;  3DOR A;  1BE9 A;  2D8I A;  4K78 A;  3CC0 A;  5H3J A;  2EGK A;  2KYL A;  3DJ3 A;  2KOJ A;  1FC6 A;  2KV8 A;  4UU5 A;  2LOB A;  1FC7 A;  1SOT A;  2M0U A;  1Q3O A;  3MH7 A;  3DIW A;  3CBY A;  2IWP A;  3ZRT A;  1MFG A;  3PDZ A;  4HOP B;  3ID4 A;  5D13 A;  1VA8 A;  1U37 A;  2REY A;  1K32 A;  1TP3 A;  3DJ1 A;  2P3W A;  1OBY A;  2KA9 A;  1FCF A;  1U39 A;  3NGH A;  1W9O A;  2LC6 A;  2I4S A;  2I0L A;  2OS6 A;  3FY5 A;  2PDZ A;  2PNT A;  2KOH A;  2M3M A;  1V5Q A;  4NMR A;  5E21 A;  2H2B A;  5HF4 A;  1U38 A;  3JXT A;  3OU0 A;  2HGA A;  2EDZ A;  2BYG A;  4Q6H A;  3QGL A;  2KPL A;  2F0A A;  4AMH A;  3I4W A;  2OCS A;  3QJM A;  4KFW A;  1TE0 A;  3WKL A;  5GLJ A;  5HDY A;  1I92 A;  1WH1 A;  1UIT A;  3SHW A;  3SUZ A;  2FCF A;  3B76 A;  2K1Z A;  1KEF A;  2OZF A;  1WIF A;  2EDV A;  2PZD A;  3BPU A;  4Z8J A;  1UHP A;  1SOZ A;  3TMH A;  2JIK A;  2OPG A;  2YT7 A;  3L4F D;  1RGR A;  1ZUB A;  4JOH A;  1NF3 C;  3RL7 A;  4GVC A;  2L4S A;  2EJY A;  2L4T A;  2HE2 A;  1N7T A;  3PV4 A;  1KY9 A;  4Q3H A;  5HFB A;  2AWU A;  5FHT A;  1Q3P A;  4JOP A;  3QJN A;  1VAE A;  1X5Q A;  5HFE A;  5G1D A;  1FC9 A;  3PV2 A;  2CS5 A;  5E11 A;  4K6Y A;  2M0T A;  2R3Y A;  5HFF A;  1ZOK A;  2V90 A;  3VQF A;  4NXQ A;  3TSZ A;  1UEQ A;  4NNM A;  4F8K A;  3CBZ A;  2RRM A;  2JRE A;  5F3X A;  2IWO A;  2H3M A;  5A2P A;  3EGH C;  4GHN A;  2LA8 A;  2D90 A;  3MH4 A;  3GSL A;  2VRF A;  2PKU A;  3SFJ A;  1P1D A;  1V5L A;  2MHO A;  4JOG A;  5HED A;  4L8N A;  1X8S A;  2JWE A;  3WKM A;  2I0I A;  2KAW A;  4Q2P A;  5GND A;  1UEZ A;  2KOM A;  2JOA A;  2QKU A;  5HFD A;  2I04 A;  3NCV A;  2KBS A;  3K1R A;  2DB5 A;  2EXG A;  4JOE A;  3QDO A;  1KWA A;  2EEG A;  1T2M A;  2DMZ A;  3SHU A;  2GZV A;  4K76 A;  1N6E A;  4NMS A;  3HPM A;  5E1Y A;  2KPK A;  1WFG A;  4RI0 A;  1U3B A;  4WYT A;  1N99 A;  3KZD A;  4HOP A;  4Z33 A;  1UJD A;  1XZ9 A;  4K75 A;  2JXO A;  1D5G A;  1UEW A;  2Z9I A;  1X5R A;  2V1W A;  3DJA A;  1WF8 A;  1V62 A;  1V6B A;  3ID1 A;  2VZ5 A;  1N7F A;  3CS0 A;  3O5N A;  3VQG A;  5HFC A;  4O06 A;  2DAZ A;  1QAV B;  2QBW A;  1OZI A;  1V1T A;  5G1E A;  3PS4 A;  3SOE A;  1RZX A;  1N6D A;  1UJV A;  2FNE A;  3QO6 A;  1I16 A;  4JOJ A;  2EHR A;  2DJT A;  4EDJ A;  1Y7N A;  5EYZ A;  1B8Q A;  2O2T A;  4JOK A;  2KJD A;  4NMT A;  5HF1 A;  3KZE A;  2FE5 A;  1TP5 A;  2AWW A;  1MFL A;  3E17 A;  4LMM A;  2Q9V A;  5JXB A;  4E3B A;  1GQ4 A;  2JIL A;  2LUI A;  2EEI A;  2DKR A;  3R68 A;  4REY A;  1MC7 A;  1RY4 A;  3GAB A;  1W9E A;  2VWR A;  3MH6 A;  3PDV A;  3LNY A;  2OGP A;  5DTH A;  4E35 A;  4FLN A;  1IHJ A;  4P2A B;  2E7K A;  1PDR A;  4JOR A;  2H2C A;  2UZC A;  4NXR A;  1WF7 A;  3GCN A;  3HPK A;  2KQF A;  2YUB A;  4G69 A;  3TSW A;  2KG2 A;  4N6X A;  3K82 A;  5HET A;  2DM8 A;  2KJK A;  4YYX A;  2OMJ A;  1Y8T A;  1QAU A;  2JIN A;  1WG6 A;  1IU2 A;  2AWX A;  3GDS A;  4NMP A;  1Z87 A;  3RLE A;  4K72 A;  3NFL A;  2KJP A;  4KFV A;  4P0C A;  4OAJ A;  5ILB A;  3GDV A;  1WI2 A;  3GDU A;  2DLS A;  1WFV A;  3GGE A;  3RL8 A;  3O46 A;  3OTP A;  2DLU A;  2LC7 A;  2WL7 A;  3PV5 A;  4NNL A;  1X6D A;  3NFK A;  4JL7 A;  1UM7 A;  4Q2N A;  2DC2 A;  1OBX A;  2Q3G A;  1GQ5 A;  2EGN A;  2KL1 A;  3R69 A;  5HJ1 A;  5B6L A;  1X9Z A;  2QG1 A;  2CSS A;  4OEO A;  1GM1 A;  2JSN A;  1UEP A;  2IWQ A;  2X7Z A;  1NTE A;  2EDP A;  4NMO A;  3KHF A;  2ZPM A;  4OEP A;  2QKT A;  3EGG C;  4GVD A;  5E22 A;  4H11 A;  1UF1 A;  4YDP A;  4PQW A;  1VJ6 A;  4JJ3 A;  2QKV A;  3CH8 A;  2I6V A;  1Z86 A;  4XHV A;  1P1E A;  1YBO A;  3QE1 A;  2FN5 A;  5HEY A;  3LNX A;  4UU6 A;  1UM1 A;  1TQ3 A;  3K50 A;  1W9Q A;  2YT8 A;  1N7E A;  2OQS A;  2M10 A;  2VSP A;  3QIK A;  4MPA A;  3KDK A;  1RGW A;  2VPH A;  5IL9 A;  3KDG A;  2KRG A;  3GCO A;  2YTW A;  2EEJ A;  5E6P B;  1M5Z A;  1Q7X A;  4NMQ A;  1L6O A;  1WHA A;  5HEB A;  1N6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...