1KY9A

Crystal structure of degp (htra)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
343
structure length
311
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEASE DO
publication title Crystal structure of DegP (HtrA) reveals a new protease-chaperone machine.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 311
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ky9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A01
1HGTH 4IC5A 1V1TA 1Y5BT 1T4VH 1G3CA 1OBZA 5E6PB 2F9OA 3FZZA 3DJAA 1IQNA 1GJ8B 1AB9B 4NMPA 3RL7A 3TNSA 2G4TA 3FP7E 2BD8A 2ZCHP 1LQEA 5ESTE 2ZI2H 3CS7A 3KHFA 1C9TA 1OWEA 3QTVH 2Z9JA 1P06A 4JZ1A 3DORA 1UEWA 5DO4H 2Y7XA 3TH2H 4NIXA 1PQ7A 2OC1A 4A1XA 1AB9C 2UUYA 3DD2H 2PKSC 1TPSA 1G37A 1GI5A 1WSSH 5FCRA 4Y71A 2F83A 1LKBA 1GBBA 3GDSA 4JOJA 4ZKSU 1TNHA 3W95A 5JBCS 3ATLA 3LGUA 5FB8C 2J2UA 1GM1A 4K2YA 3EA9A 4NIVA 1AKSB 1SQTA 1UK2A 2AWWA 1HAVB 1TBZH 1GBLA 1BTZA 2VGCB 1UTPA 1MKXH 2R0LA 2ASUB 2D8IA 3RLEA 1NFWA 2A5AA 4NFFA 4RN6A 3V7TA 2EI6A 1TB6H 1QL8A 2DE9A 1PPEE 2ZFTA 3BIUH 2VGCC 2EGNA 1I92A 2G52A 1DANH 3SNEA 5HFDA 1PYTC 2SFAA 5EGMA 1THPB 4A6LA 4K8YA 3T28A 2LC6A 3QJNA 1FONA 1CHOG 1O3NA 2ZHEH 2W5EA 1NU9A 1RIWB 3DHKH 3T27A 3S9BA 1RRKA 1SGPE 4MVNA 1LHCH 1O2LA 3UQOA 1O2HA 2BDIA 2BB4A 5B6OA 2VH0A 1MTVA 7LPRA 2EXGA 1L1NA 3SHUA 2AMQA 4BAKB 2PW8H 3W94A 1D6RA 1Y3UA 1W3CA 2G00A 2R4HA 1QB1A 1XM1A 4NMOA 4IMQA 3RU4D 4NMRA 1LTOA 3CC0A 3RM2H 3ATIA 2L4SA 1XX9A 1GI9B 1J14A 3O8DA 1TMUH 2VZ5A 5GXPA 1P03A 3GY8A 2OBOA 1NRNH 2VIWA 2Q3GA 3CENA 1S6FA 1BTUA 3WY8A 3SU5A 2Q1JA 1X6DA 3PWCA 1OX1A 1OWIA 1BTWA 1IU0A 1OPHB 2PA1A 3K82A 5A0BA 1QQ4A 1AWHB 4ZHAA 5T3HA 3KZDA 2O8TA 3U9AH 1J9CH 5HGGA 5DPAA 3MYWA 3JXTA 4R0IA 1SVPA 3SQHE 1CA8B 4FUIA 2BD2A 3HKJB 4MLFB 3SN8A 3TNTA 1T4UH 1A0LA 2CHAB 2EHRA 1ELVA 4BNRA 1KXDA 1N6YA 9ESTA 1Y7NA 5JDUB 1DLKB 3A7YA 5K0HA 2CGAA 4ZHMU 3A7VA 1S6HA 1O3PB 1WYKA 1ESBA 1GI8B 1YLCA 3MMGA 3QZRA 4SGAE 4JOPA 3RM0H 3QUMP 1WF8A 1C1TA 1MMJN 2W3KA 5JBTA 3SU2A 2FN5A 1SC8U 4IN2A 1ZTJA 3OTPA 4UD9H 1AZ8A 2DAZA 2R0KA 3ZZ5A 3O5NA 2J92A 1FN8A 3EA7A 1AI8H 1AE5A 3BEIB 3UQVA 1UVOA 3DIWA 2STBE 2ZPQA 2YUYA 1UK3A 1E38B 3TITA 5AFZH 5EOKA 1FAXA 3P8GA 1F0RA 2ZDLA 1YPHE 1NPMA 1V2NT 2I6SA 2I0LA 2OUAA 2AYWA 4KELA 2DJTA 1OXGA 2ZGJA 2FOMB 3B8JA 1BMLA 1QA7A 2OD3B 3RMNH 2QG1A 1JBUH 2M0TA 4UDWH 3FANA 1LMWB 2F0AA 4NA9H 2GZ9A 5E11A 1OS8A 1YP9A 4X2XA 2BD4A 4B2BA 3PO1B 5EG4A 2BXTH 1TMTH 1HJ9A 2P8OB 2W26A 1ARCA 1JWTA 3A8BA 1MKWH 1DITH 3MH4A 3UTUH 1UTJA 5GCHG 5F8TA 1TOCB 2BD9A 2KPLA 1O5GH 1YPHC 3SV7A 2ODYB 4JOKA 3BG4B 1IQHA 2OXSA 3KHVA 2ZDNA 4AFZA 2PUXB 3OTJE 2BLQA 4CRDA 2JOAA 1U3BA 4R8TB 2OZFA 5C3NA 5A2MH 1OZIA 1P9UA 2PSXA 3A7XA 2SGFE 1MAXA 2QIQA 1GJBB 3C1KA 1YBWA 3SGBE 1LHDH 2VVCA 4ZXYH 3T26A 2D92A 1TRMA 4UFDH 1C1OA 1B5GH 2ZGBH 3U8TH 2Q6FA 4P2AB 5E0GA 4O03A 1PPHE 2QCYA 3R0HA 1GBFA 1D4PB 1NRQH 3M3TA 1LHEH 1KYNA 1MAYA 1UTOA 3ZYEA 2KG2A 4ZHLU 2XBWA 2Z9KA 5C67A 1A61H 1C2EA 3NZIA 5E0HA 2FEQH 2IJOB 1W13U 5ESBA 1W14U 3PDVA 2BX4A 3ZZ3A 5HJ1A 4PROA 1E37B 3U98H 5LH8A 5HEYA 1YKTA 3O46A 1P2MA 2HE2A 1IQIA 3STJA 4KFVA 4B2AA 5HM9A 1VITH 4INLA 1WJLA 2VH6A 1GVZA 2FCFA 2FOAA 2JINA 1Y59T 1QNJA 3T2NA 1PDRA 1GCTB 1P3EA 2ODQA 3RDZA 1VGCB 1C5LH 1O2NA 2A2QH 3MU1A 4YT7H 1AD8H 3F9EA 2FS8A 5E22A 3QJMA 1LVBA 3HK6B 3L33A 4FU8A 1UTMA 1F2SE 2BHGA 4NSVA 1GMCF 5C5NA 1ZHMA 3S69A 1ABJH 2ZFPH 1EAUA 1SGTA 2GZ7A 1AMHA 4Y0YE 1TNJA 1KLJH 2D26C 5AFYH 2C8XB 3SJOA 5FAHA 1YPMH 1MH0A 1P3CA 2VVVA 3D49H 3NFKA 3FVFB 4O3TA 4NMSA 1ACBE 5J4QA 2H2ZA 8ESTE 1WAYB 1GBHA 1HAGE 1UVSH 1ANDA 2XRCA 1ZRBA 5HFBA 2BD7A 1YPLH 2EEIA 1U6QA 1O5CB 2W4FA 3UR6A 2OCSA 4AG1A 1C2DA 1TGBA 3M3VA 1UEPA 6CHAB 1FLEE 5JBAS 4J2YB 4CR9A 4NWKA 1NF3C 1C1MA 1NFYA 1WUNH 5C1UA 1ELFA 1O2YA 3CBYA 1FJSA 1OWHA 4JZFH 1N1LA 3DT0H 4WJG2 1O3EA 1UF1A 3NCLA 3UOPA 3F68H 4YT6H 1KDQA 2D8WA 1QA0A 1SGFG 1UFXA 1ZUBA 1VITG 1GHVH 2EDVA 4CHAC 4THNH 1WG6A 2KJKA 4DIIH 2C93B 4XBDA 4I31A 3MNXA 4B71A 1EXFA 5EU8A 1K22H 1QBVH 5GLJA 4FUHA 1A3EH 3Q77A 1MBQA 5JBBS 2YNBA 3QZQA 3TJNA 2FXRA 1EAIA 1O2SA 2ILNA 2V3OH 3GCHC 3VB6A 2I6VA 3M5MA 1IQGA 3LOXA 1H9HE 2SGDE 2UUFB 1LCYA 3AXAA 3RXJA 2FX4A 2KOMA 4AB8A 4H6SB 4D7FA 3LT3A 3ID1A 1A5GH 3Q00A 5HFFA 2Z9IA 5HETA 1C5TA 1KXBA 3R69A 1MQ5A 5D13A 3UNQA 3CP7A 1F7ZA 2A1DB 3S7KB 5C1XA 1AUTC 1DS2E 2IN2A 3HPTB 2TGDA 1ZOKA 2DUCA 3SV2H 2AWUA 2BDBA 1FN6A 3QN7A 4KKDA 3GJ9A 2OQSA 2H1UA 2AIPA 1O2WA 4X8VH 1O36A 4P0CA 1KTTB 2DE8A 2PKAA 2FNEA 4MNXA 4U2WA 1K1OA 4X2WA 1SPJA 2V90A 1S81A 4B2CA 2WYJA 1P2KA 4Y11E 3E91A 2WYGA 2HE4A 1UMAH 1ZMNA 2ZZUH 3ZVFA 4D7GA 3EE0B 4GHTA 5C1YA 3CH8A 2ZNKH 3B9FH 1N99A 2VWRA 1HAYB 1F0TA 4H6TA 1HAXB 1HIAA 1V2TT 3PV2A 1HFDA 5EXMA 1C5XB 1SOTA 3UWIA 1HAZB 6LPRA 3O8RA 3H7OA 5LPRA 2QKTA 1PQ5A 3K9XB 4WMEA 4YLUA 2Z17A 5JPMH 1S84A 4A5TS 4ABEA 1BBRH 2FI3E 2EEHA 2VWOA 1WU1A 1TONA 2HGTH 1YLDA 4FUBA 3BPUA 4K60A 2OGPA 1IQLA 4Y10E 2C3SA 3HPMA 4Q2NA 4XDEA 5E21A 1N6EA 1GI0A 4CH8B 1Q2WA 1DOJA 1DY8A 1RY4A 4LK4A 2XNIA 1ZPCA 1V62A 1P10A 2PHBA 4Z6AH 2R2WU 3P8FA 3RXAA 8LPRA 1IQEA 1ELAA 1NO9H 1V2OT 2QGRA 1QAVA 1QL7A 3ZZ6A 1ELDE 2GZ8A 1UJVA 3GCTG 5HF4A 5AHGH 1C5QA 3I77A 3HATH 3M7TA 1IAUA 4KTCA 3BTGE 3PTNA 1W2KH 2GX4A 2DLSA 2VIVA 1O30A 3Q3XA 3LNYA 2ALVA 2EEJA 1QRXA 1GDNA 3ZZCA 2VSPA 1QHRB 5T6GA 3AAUA 3RXHA 1OWKA 1YF4A 1DUAA 2BVRH 5EXLA 1G2MA 4BAOB 3T25A 1KXEA 1TNKA 3S0NA 5CHAB 1FC7A 2FODA 1EJNA 3P95A 3RXFA 1CBWB 2B7DH 2RG3A 2WL7A 1AVXA 1E34B 1FPCH 4E34A 5I25A 3KQBA 3LU9B 5EXNA 3ATKA 2V6NA 3GY6A 3SHAH 1RJXB 1TBQH 4WMDA 3E3TA 1IQFA 5CHAC 3L6PA 3GDUA 1HJ8A 4WH8A 1PYTD 1O3JA 3PMJA 2Y5FA 2BZAA 3ZVBA 3SBKA 2QV1A 5HEBA 1E36B 1PQAA 2FS9A 1EAWA 1SHHB 1OP8A 2BX3A 2W7UA 2FDAA 2XTTB 4E05H 3ZVEA 1HRTH 6GCHF 1MKXK 2V35A 3H7TA 3SQEE 1ETSH 2WV5A 5EZ0A 1CT4E 2A31A 1YPEH 1BTYA 1J16A 3RUOA 2C8WB 3PS4A 4Q3HA 2PKAB 4JYTA 1AU8A 5L2YH 4NZQA 1TX6A 1AUJA 2Z6BD 1LO6A 1O3BA 1CE5A 1NRSH 2GTBA 2YNAA 1WH1A 1DPOA 1C5NH 2PGQB 3B23B 4B76A 1CGIE 3F9GA 4WYUA 2IWNA 1LDTT 3GSLA 2QXIA 2VVUA 5BPEA 3T5FH 1UEZA 3QGLA 1TGSZ 1CGHA 2Z3EA 4IS5A 4Q2PA 5HF1A 1HDTH 4BAHB 1K1LA 3P92A 2QC2A 2KOJA 1O2GH 3DJ3A 1C1RA 1TGNA 2H9TH 3Q76A 1TMBH 2FX6A 2QYIA 4YYXA 2H6MA 4WH6A 1HJAB 2H2CA 3KIDU 1UTQA 2AEIH 1GMHG 2JH6D 1IQJA 1LVMA 1V2KT 4CRAA 1V2QT 2AMDA 2GCHG 3TGKE 2ZCLP 1O5EH 3GYLB 5DTHA 3A81A 4OAJA 4X1RU 1A2CH 1HLTH 4GVCA 1HJAC 1YPKH 1BE9A 4IC6A 1ZMLA 4G69A 1H9IE 2UWPA 4ABFA 4N6XA 1P01A 1MZAA 5HEDA 1XUKA 1GHYH 1DY9A 1JRTA 1Z6EA 3RXVA 1AO5A 2ZO3H 3MTYA 1KIGH 1ZOMA 4DGJA 1YPJH 1NTEA 5GNDA 1KSNA 3K50A 3BIVH 4MPAA 4MG3A 3GY3A 3CS0A 1O2RA 2HGAA 4NNLA 2WV4A 5FBIA 3SU4A 4R2ZA 1J15A 1C2JA 1TALA 2OLGA 1Z7KA 4K1TA 3P70B 2A32A 4LZ1H 3PWBA 1NU7B 1YCPH 2QY0B 1TX8A 2FI4E 1GGDB 4UFEH 1MFGA 3M36A 2P3TB 3K6ZA 4AG2A 5ABWA 2G81E 1MQ6A 1WQSA 1GMDG 3R3GB 1O37A 1A0JA 1Q3XA 1BFEA 4CBOA 2WPLS 3LGTA 4K1EA 1N7TA 2EAQA 1HAIH 4X1SU 2ZTZA 3UOUA 4GUXA 3ATMA 1EPTA 3EQ0H 1V2JT 4FUGA 2ZHDA 3SNDA 3M61U 2ANYA 5L2ZH 2HNTC 3TGIE 2VB0A 1X7AC 2HRVA 2O2TA 1O2PA 2GT7A 3TVJB 1K9OE 1SG8B 2BVSH 3F6UH 1CGJE 3GY2A 3SUDA 3U1IB 2R3YA 1BUIA 2D2DA 2OCVB 3TSVA 2ZC9H 3LPRA 4A7IB 3ID3A 2ESTE 8GCHG 4X6OA 2I0IA 1JIRA 3ZZDA 4E06H 3LGYA 1X5QA 1Z86A 4NCYA 3RXDA 2VJ1A 1ABIH 2IPHA 2VPHA 1MU8B 1BTXA 2FPZA 1O5DH 1GHXH 4E35A 1WFGA 3ID4A 5HFCA 1C1UH 4XBBA 2OP9A 2VWNA 3ESTA 4OS6A 2FESH 1C2IA 4GCHG 4ABGA 1ZHRA 1OBXA 2NU3E 3M7QA 1RIWC 3SNBA 1C5PA 3RXKA 3LH3A 1VJ6A 1T31A 1WCZA 3MO6A 3TK6A 1U37A 5I7ZA 1RGRA 3TSZA 2VIDA 3HVQC 3BEFB 1TNLA 5DP3A 2XCNA 2KL1A 3EGHC 1KEFA 1BCUH 1EAXA 3ATWA 1MKWK 1ZGVA 4K5ZA 3FP8E 1GBIA 3ZZ8A 2P3FH 4NG9H 1SGRE 1JXPA 3ZVAA 3MNCA 4GSOA 3A88A 4AORA 5CE1A 1CHGA 3MH5A 4BAQB 2FOEA 2FZZA 2VIQA 1AZZA 3BSQA 1CT2E 2GV7A 1SQOA 3QE1A 1G9OA 3MFJA 3SHWA 1P2OA 1PJPA 2RDLA 4IGDA 1ZTLA 2BXUH 1UM1A 1GHAF 1XXFA 1S5SA 2GDDA 3VFEA 1GHWH 1ELBA 5G1DA 2V1WA 1DLEA 1QCPA 5DGJA 3TH3H 4XSKU 1INCA 2QF3A 4LMMA 1Q3OA 2KJDA 1V6BA 4YOGA 1J8AA 1S0RA 1JIMA 2JETB 5DP8A 5AF9H 3SFJA 1B8QA 1FY8E 4AZ2B 2WUCA 4U01A 4UU6A 2EA3A 4X6MA 5TCAA 3VB4A 1K1MA 2RRMA 2VRFA 7ESTE 5GPIB 4WY3A 2BDHA 5A0AE 3A8CA 4FGMA 2JETC 1O31A 1T8OA 1ORFA 1P9SA 3ENSB 2CHAC 5E2PA 1AE8H 4CBNA 4CH2B 5EQSA 2FIRH 1SL3A 3ODFA 4OS7A 5TCCA 2LNCA 4X2VA 1XUJA 5A8XA 2BY5X 2XC5A 1DXPA 3V12A 2BYAX 2F9PA 3O8BA 5L6NH 1O2UA 3SV6A 4YZUA 3S7HB 3VB7A 2L97A 2FTMA 1HYLA 2F9NA 2L4TA 1N7FA 2ZFFH 2EI8A 1U39A 4HZHA 1THSH 1YM0A 3U8OH 4D8NA 3MU8A 4OS4A 4DIHH 2K1QA 1HAOH 1UTLM 2A45B 4GPGA 1OWDA 1BDAA 1TBRH 3E8LA 1RXPA 2F5YA 1FC9A 4K8BA 1AIXH 2Y5HA 3UREA 1G9IE 1Z71A 3E0PB 1FDPA 1WBGB 2A0QB 1PPGE 2JKHA 2RA3A 2CF8H 4U30A 1O3FA 2AGEX 5F3XA 1EOJA 2ZU3A 5F03A 3Q3KA 1DT2A 3FZDA 1T8LA 1O2IA 4GHQA 2WPHS 2KBSA 1RD3B 2G51A 4FUDA 4BXSA 4A92A 4NMTA 1P02A 2D1JA 4YOIA 5IDKA 1V2ST 1JOUB 1BTHH 1A5HA 1WFVA 2SNVA 4I32A 2THFB 4UFFH 4ZXXH 1A3BH 1GL1A 1XKBC 5DG6A 4Q2QA 1A7SA 2Z7FE 1EOLA 2LPRA 4O9VA 2I6QA 1SFIA 3ZV8A 2AS9A 3PO1C 1XVMA 2IWPA 2GP9B 2P8OC 3TU7H 2GMTB 4RKOB 4YDPA 2H3MA 1A4WH 2GCTB 3NXPA 2K20A 3GCOA 1NZQH 2H9HA 2OQUA 1I16A 1V3XA 4NIYA 4K72A 4M7GA 4K6YA 4HI3A 5EQQA 4ZKRU 3BG4C 4TPIZ 4BXWA 4FU7A 2XC0A 1C2LA 2GMTC 3LIWA 2FTLE 1QY6A 4WVPE 2XBYA 2GCTC 3KZEA 1O2OA 2QF0A 5I46H 1C1PA 5E1YA 1MTWA 6ESTA 3QLPH 4ZKOU 1DWDH 3AASA 2BY8X 2VWMA 1O5AB 2FLRH 2ZU5A 2F91A 1QURH 1C2GA 3SUZA 3RMOH 3SUFA 2EDZA 5HFEA 3PYHA 1TFXA 2NU0E 4WXIA 4I8HA 1BBRE 4CRFA 3BEUA 1O38A 1C1QA 1XKAC 1GL0E 1DWBH 5E2OA 2PV9B 4YOJA 3GCNA 1IHJA 4H42U 4YO9A 2O8MA 2SGEE 3P17H 1VAEA 4MNYA 1L1JA 1CU1A 3B76A 5G4BA 4JOFA 1D5GA 1Y3XA 1LVYA 1P8VC 2PWXA 4AOQA 1N6XA 4NMVA 2AWXA 1AWFH 1GJCB 1O3DA 3TMHA 1GCTC 1EASA 2NU1E 1VGCC 3V13A 1W11U 2FOCA 1F0SA 3PMHB 3GICB 2JH5D 4B74A 2IWOA 3HGPA 1ZZZA 3GY5A 2BY9X 1YC0A 3ZZ4A 2SNWA 2ZPSA 3E17A 2I1NA 1W7XH 3A82A 4ZH8A 2ZQ1A 1GJ4H 1BMNH 2NU4E 1O3MA 1ZR0A 4DURA 3P8OA 4WWYA 4ESTE 2K1ZA 2G5VA 1O3CA 2UZCA 1BIOA 1SOZA 3HPKA 1SI5H 4MTBA 4JK6A 2ZHWH 2CF9H 4X2YA 2BDYA 1Y3VA 1K1NA 3LJJA 4RSPA 3DFJA 4HGCA 2QA9E 1Z6JH 1QJ1B 1QTFA 2KAIA 1PPZA 2HALA 2FI5E 1BBRK 3IWMA 1WIFA 1EP6A 4KTUA 1ELTA 2M0UA 1ZPBA 2ZDAH 3PDZA 4TPYA 2O8WA 1BRBE 3BTME 6CHAC 5JB8S 1BHXF 4ISLA 4BOHA 2Y5GA 3KEEA 4LOYH 4BTTB 1N7EA 1Y5UT 3NKKA 3SU6A 4Y8XA 1IU2A 1TWXB 2H9EH 1TGTA 3KGPA 1L1GA 1WV7H 1QL9A 4XHVA 1A46H 1E0FD 1C1SA 3ID2A 1QRWA 1K32A 1MC7A 3V3MA 1FXYA 1DWCH 4X8UH 1EB2A 4FVBA 5E8EH 5H4IB 1WF7A 1ESTA 4INHA 4JOGA 5HDYA 1IHSH 5GWZA 1JMOH 3M37A 4SGBE 3ZVDA 3V0XA 1ZYOA 1GJ6A 3RL8A 4ISOA 1Z87A 2ZU4A 3E0NB 2ZP0H 1V2MT 3ELAH 1MZDA 2A2XH 2ZECA 1X45A 4Q7XA 1MD7A 4ABIA 4KTSA 1GMCG 1O35A 3NWUA 1FI8A 2P59A 3KQCA 3RXTA 1KY9A 3UIRA 4NNMA 2KOHA 7GCHF 1NY22 2H3LA 1W0YH 3OY5U 1B0EA 2CJIA 3LC5A 1E35B 1UCYH 2ZFQH 1G36A 1K1PA 5T6DA 4CR5A 1GHBF 1NS3A 4AGKA 2OTVA 1FQ3A 2NWNA 1LHFH 3D23A 1FC6A 5IYTA 1O5BB 3RXOA 1HB0B 1GI6A 2EI7A 2PDZA 1O3HA 1ZRKA 2G5NA 3A84A 2ZHFH 4Y8YA 4ZMAH 2OBQA 4JYVH 3T29A 2JXOA 2PTCE 1B7XB 2I04A 1HPGA 1SGQE 2IWQA 1ZLRA 1K21H 1K28D 5DP4A 4LZ4B 3I4WA 2PKUA 4HFPB 1G32B 1BOQA 1O2QA 3EYDA 1MU6B 1W9OA 4K75A 4UONA 5FHTA 1Z8GA 1BJVA 3LDXH 1O34A 5EPNA 5SGAE 2ANWA 1Z8JB 1T2MA 4XFQA 3EAJA 1ZSLA 2GVFA 5GJ4B 1C5VA 1FY1A 5F8ZA 4E7RG 1NRRH 1ETRH 1GHZA 2VIOA 1GBAA 4MNVA 4XE4A 3PV4A 1GJDB 1KLIH 1OOKB 3BG8A 3GYMA 2DMZA 3RXUA 1VB7A 4NXRA 2ENOA 2BOHB 2KQFA 4MPUA 5PTPA 3RXQA 1Z1JA 2ZHQH 1FIWA 4KGAA 5FBEA 1N8OB 2BMGB 4REYA 1W9QA 2RCEA 1MCTA 1O2ZA 3LGVA 3KF2A 1KDQB 4D76A 2ZGCA 4F4OC 1BRCE 3A8DA 1SGYE 1ZSKA 2A4RA 3F9HA 4DJZB 2LA8A 1GJ5H 3PLKA 1BRUP 3E6PH 1UJDA 1QB9A 3ZZ9A 1ZTKA 3RXGA 1N8OC 4AFQA 3QK1A 1IQMA 1DM4B 4NSYA 2NU2E 2AIQA 3SJKA 3SNAA 4FUCA 1ID5H 2ZPRA 2QKUA 1XVOA 5DP7A 1C2FA 1OWJA 2P95A 3PLPA 1O2KA 3UPEA 4ABAA 3PROA 1O3LA 1GBCA 3FP6E 1QAUA 5J4SA 4B73A 2ZG0H 1AVWA 4GAWA 2YOLA 1NFUA 2BDAA 1C4V2 4FXGH 1C5YB 1GI1A 1KXFA 1O0DH 2FYRA 2JIKA 1XUIA 4BAMB 2CN0H 3RXMA 1F5KU 2BDCA 4YLQH 3RP2A 1YCPK 3MH7A 1BB0B 1EX3A 1PPFE 1VCPA 4Z33A 2UUJB 4X1NU 1CBWC 1HV7A 1W0ZU 5AVDA 4K78A 3DJ1A 1RS0A 3RLWH 2QAAA 1GI4A 1EZQA 4ABBA 4DG4A 4CRBA 1GG6B 2MX6A 4MQAA 3M5OA 4H11A 1YYY1 3GDVA 3MU5A 1NN6A 1UVTH 2FM2A 1P11E 5FPYA 4UU5A 1BA8B 2KA9A 1CA0B 3SORA 4Q80A 3UNRA 3PM3A 1AFQB 3QGJA 2M10A 5HYOA 1TYNA 1SBWA 1GG6C 3STIA 2CXVA 2W3IA 1TOMH 3LONA 5L30H 2LUIA 4X8TH 1CA0C 3SOEA 3PTBA 2RA0A 1AFQC 2ZGHA 3TJOA 3AAVA 2FLBH 1GQ5A 1C5SA 1HIAB 2HPPH 3D62A 3ZZAA 4RI0A 1YGCH 4Q2OA 1EUFA 2GD4B 1P2IA 3U8RH 1Y5AT 2KAWA 1VR1H 1BITA 2AFQB 2BVXH 2ZKSA 3K1RA 5A2PA 1MD8A 2BY7X 3A89A 1GBJA 3QGNB 4UFGH 4NA7A 5FXLA 2J94A 1L2EA 1EB1H 4AYVB 5GDSH 2G4UA 3A86A 2Y80A 3SGQE 2TIOA 4A1TA 1P09A 3M5LA 4CRCA 2BOKA 2GDEH 2QKVA 4FUFA 3SU0A 1MCVA 2SGAA 3UR9A 4AMHA 1CHOF 4NXQA 2JILA 3QIKA 2BLWA 2W7SA 1B0FA 3A80A 3LH1A 1UVPA 3BF6H 3S9AA 2MHOA 1ZJKA 3QTOH 3LJOA 3SO3A 1P1DA 3TPIZ 1QAVB 1UO6A 1FY5A 2HLCA 2F9UA 2RCZA 1C5RA 3LGIA 3SJIA 7KMEH 2ODPA 2WPKS 1U38A 3D65E 1O2TA 2A5IA 1D3DB 1O2JA 1C2KA 1TQ0B 1D6WA 4Q7YA 1LPZB 3SUEA 1W8BH 2HNTE 1C1VH 2PKTA 2WPMS 2Y82A 4HTCH 1O2MA 1UEQA 1SGEE 5DJ7A 1ZGIA 2OPGA 4I8JA 4I7YH 1KLTA 3ZZBA 3ZVCA 2PKSB 1P05A 1XMNB 1ARBA 1VCQA 4CREA 4OEOA 3HK3B 1WI4A 5H3JA 1HAHH 1UM7A 6GCHG 1CT0E 1GVLA 2ZTXA 1EQ9A 2BZ6H 3TK5A 4KP0A 4K3JA 2AMPA 1C5OH 2ANKH 4INKA 3U69H 4MDSA 4O97A 2PNTA 2A7CA 1RGWA 3TGJE 5LGOA 1BT7A 1SLUB 1GDUA 3A7TA 4X0WU 1J17T 3KQEA 3SZNA 3BTEE 5FX5A 1C2MA 2J4IA 3BTWE 4HOPA 1ELGA 1GGDC 2E7KA 2BY6X 1H8DH 1UHPA 1AVGH 2CSSA 2B5TB 1CVWH 3I78A 1LQDB 2G2LA 5C2ZA 2SGPE 3L4FD 1DWEH 1Q3PA 1FUJA 3SGAE 5BRRE 2W7RA 2UWOA 4QT8C 1TA2A 3OX7U 1P2JA 1BMMH 1XUHA 3SU3A 1DFPA 3M35A 1ZMJA 1G3BA 1H1BA 5LPFA 3SHCH 1H8IH 1SMFE 1RGQA 3GOVB 4Q2KA 3SJ9A 1K1IA 1WHAA 3I18A 1XUFA 3LC3A 1DSTA 1SLVB 1UK4A 3A85A 1GI2A 1KWAA 1FV9A 1V5QA 2C8ZB 3RMMH 3RXIA 1V2LT 2TGTA 1YBOA 4OGYA 4UEHH 1FNIA 1O5FH 3MU0A 2P93A 2CSJA 4JZEH 1SB1H 1RTLA 3OY6U 2QXJA 4NZLA 4X1PU 3VB5A 2KJPA 1D3QB 2Z9GA 1X8SA 3UFAA 1Z8RA 2JREA 2Y81A 2LC7A 3KQDA 3RXRA 2PUQH 4OS1A 3BN9A 1UTKA 4Q6SA 3ZZ7A 1DX5M 3UUZA 3MHWU 1GJAB 3K65B 3RXCA 3MOCA 3QO6A 2BM2A 1A5IA 2KV8A 4MNWA 1TQ3A 3RC5A 1THRH 3GGEA 2OQ5A 3BV9B 1Z1IA 3MNBA 1OBYA 1V5LA 2FWWA 5DP5A 3M7UA 2QXGA 2O8UA 3FY5A 1D3TB 4U32A 1HXFH 1SLWB 3PLBA 1QBNA 4I33A 3R68A 3VGCB 3PMBB 4GVDA 1SFQB 3QWCH 1MUEB 3JZ1B 3NGHA 2R2MB 2ZWLH 2EGOA 2C8YB 3N7OA 5GCHF 4RKJB 4X8SH 4YESB 3WKMA 5B6LA 3VGCC 3CBZA 1ESAA 1EZUC 1DSUA 4NGAH 2EEGA 3CYYA 1TA6A 3P6ZB 1DXWA 2J38A 2J9NA 1VCWA 1FAKH 2P3UB 5EW2H 1T7CA 1PPCE 3IG6B 1AHTH 2ALPA 2G8TA 2OC7A 3BTFE 2VNTA 1T8NA 3SJ8A 1CQQA 4XOJA 5F8XA 1T8MA 1XUGA 2F9VA 3F1SB 3BTTE 2GZVA 4IMZA 1ZHPA 4NIWA 3TK9A 2Z3DA 2SGQE 1LKAA 1GQ4A 1TRNA 4TY6A 2H2BA 2ZU2A 4WYTA 4HOPB 2TGPZ 1V2VT 1GI3A 1EPTB 3EGGC 4Y79A 5A09A 3E90B 4ABDA 2Z94A 3HGNA 1Q7XA 2PZDA 2EGKA 2BQ6B 4UE7H 1TP5A 2HNTF 1TRYA 1K2I1 3EA8A 1V6DA 1X5RA 1F5RA 2ZDKA 3H5CB 3LKWA 1HCGA 1SGNE 1EPTC 1SLXB 3MH6A 4ZAEA 5F6MA 4TY7A 1GDQA 2ZQ2A 4F49A 3KL6A 2ZU1A 4X1QU 2BTCE 2R9PA 1ZSJA 2BQ7B 4X6NA 3MNSA 4JCNA 1YPGH 1BHXB 3RC6A 3T62A 4BTUB 2G5MB 3NK8A 5ETXA 1UJUA 4OS2A 4F8KA 2BD5A 4O06A 3FAOA 3OU0A 1Y3YA 4I8GA 3CBXA 2BDGA 1EATA 4DW2U 1TAWA 1TE0A 1UCYE 1C4U2 1GHAG 3QDOA 1QR3E 1ZPZA 4NA8A 3RU4E 5EPYA 2V3HH 4LXBH 1UHBA 2ANMH 1N6FA 2Q9VA 3LNXA 2C4FH 3K2UA 3RXSA 5CMXH 1PQ8A 2GGVB 3SW2B 1IOEA 2UUKB 4MPWA 2IOTA 2LOBA 3M5NA 4GLYA 3PMAB 1EJMA 1RZXA 2O8LA 1TIOA 1SR5C 3DFLA 3R0FA 4K1SA 2YTWA 5G1EA 3RXBA 1NRPH 4Y7AA 1O3OA 3A83A 1IHTH 1DVAH 3K6YA 1F5LA 1QQUA 3SU1A 2WINI 2ZPMA 3TH4H 1ELEE 2XBVA 4JK5A 1C5WB 2KYLA 4Q7ZA 1VITF 3E1XB 2HVXA 4JOHA 1M5ZA 4Q6HA 5HM2A 1FZZA 2D90A 1GJ9B 3G01A 4Z0KA 1GCDA 3EDXB 1QB6A 4JMYA 2DKRA 4AN7A 1G2LA 1L6OA 4D9QA 3JZ2B 1W7GH 2XXLA 2OC8A 3ZYDA 3ZVGA 2YT8A 1T32A 3TSWA 4AB9A 1FMGA 3NFLA 3AW0A 3A7WA 2Q6GA 2JH0D 1UCYK 2FMJA 5EYZA 1MTUA 2OSGA 2I4SA 1GBDA 3MWIU 2WPJS 2Y7ZA 1O33A 4E3BA 2OC0A 3SV8A 1TNGA 2AGIX 3F9FA 2A4QA 2STAE 2Y6TA 2QT5A 2V0BA 5JXBA 3SV9A 1XZ9A 2BLOA 2ZDVH 4NFEA 3O8CA 2PR3A 3UWJH 4TWYA 1RFNA 3IITA 2FOHA 1HNEE 2B8OH 2M0VA 1BJUA 3AW1A 3L3TA 4Z8JA 1P1EA 1Y3WA 1LPKB 1ELCA 2VWLA 2H5CA 3MU4A 1OKXA 2ZTYA 5EODA 2ZF0H 2TPIZ 2WUBA 4ABJA 2BLVA 1ANEA 2A7JA 4I8LA 4NWLA 1MBMA 1Y8TA 1NFXA 3DUXH 1GBKA 1LVOA 1G30B 4AFSA 4L8NA 1V2UT 3RC4A 1KXCA 1TLDA 3ZRTA 5DKMA 3I29A 3AVZA 1O32A 2YUBA 1MTNB 1BTPA 4TYDA 4GVUA 2ZEBA 1O2VA 5EQRA 4B75A 4PQWA 2A4OA 5JYIA 1FY3A 2DLUA 4I8KA 2ZGXH 4DVAU 1AY6H 4FVDA 2TBSA 3VQFA 4WXVA 1GI7B 1F92A 1V2RT 1FCFA 1D9IA 2ULLA 4ISIH 4JZDH 1MTNC 1KTSB 1M9UA 4CHAB 4VGCB 1EZSC 1GJ7B 2GKVE 3S9CA 1EKBB 3VXEH 1QIXB 1NTPA 4J1YA 9LPRA 1TX7A 1MFLA 1UTNA 5EW1H 1GBTA 1YCPM 1A1RA 1NM6A 1UHBB 1WOFA 1O39A 1HXEH 3URDA 2EJYA 4VGCC 1WTHD 4A1VA 4AX9H 4IN1A 4ISNA 1C4Y2 4IBLH 3GISB 2PSYA 1O3KA 1WQVH 3GCHB 2P16A 2ZFSA 1FPHH 4H4FA 1G3EA 4IW4E 3QDZB 4MPXA 2XCFA 3VPKA 3GY4A 2YT7A 3RXEA 1O2XA 3MO3A 4FU9A 4YM9A 2PFEA 2Q6DA 4MPVA 1NC6A 5HXFA 1BRAA 4XBCA 1WHDA 4AYYB 5C5OA 1P2NA 2B0FA 3GCTF 3A8AA 4DOQA 4YTAA 2AH4X 2XC4A 1OP0A 1C1WH 4WMFA 4FUEA 2CV3A 2XYAA 3A87A 1NT1A 1QJ7B 3C27B 5E0JA 4CRGA 5A8YA 1RTKA 2OS6A 5DP9A 3KCGH 4K69A 2BQWB 1R6JA 3SI3H 5A0CA 2DB5A 3OYPA 1V2WT 1EZXC 1XXDA 4Y7BA 2P94A 3Q3YA 4OEPA 1DUEA 1SGDE 1SHYA 4Y76A 2FE5A 3TJVA 3TJUA 1A0HB 5LPEA 3OSYA 3TLOA 1RTFB 2XWBI 1C5MD 3SUGA 4GHNA 4ABHA 1P57B 5K7RA 3RLYH 2J95A 3SI4H 2R3UA 1WTGH 2DM8A 2OINA 4NMQA 1GBMA 4TWWA 3ZV9A 1H9LB 2O9QA 3TIUA 1C1NA 2UWLA 2QBWA 1ZJDA 5HMAA 4K76A 4BTIB 4JL7A 1TGCA 4O3UA 2H5DA 1QRZA 1QLCA 2PLXA 3SOSA 1O3GA 1QJ6B 1UITA 3I1EA 3QX5H 1P12E 2ZCKP 2XW9A 1C5UA 4DY7B 5FPSA 4DCDA 2Z3CA 2KAIB 1TPAE 2DC2A 1QBOA 1F0UA 3NPSA 3BTHE 2EEKA 1ETTH 3MO9A 4AFUA 1S85A 2F9BH 3ITIA 1AGJA 2ZPLA 3WKLA 2X7ZA 1AFEH 2QXHA 2A5KA 4OGXA 2TGAA 5FX6A 3BTQE 2ZA5A 4E7NA 1ANBA 1H4WA 2EV8A 7GCHG 4Y0ZE 1LPGB 1ANCA 1PPBH 5DP6A 1HAPH 1TPPA 2GT8A 1DE7H 4D9RA 4KFWA 4DT7B 1JRSA 3KNXA 3P8NA 3RU4T 2CMYA 2AGGX 1BZXE 1S83A 2Z9LA 1V2PT 3KN2A 2FYQA 2G55A 4ZUHA 2HPQH 2XBXA 2ZFRH 1GHBG 1D3PB 2A4GA 3EGKH 1GMHF 2FOFA 1AQ7A 4JYUH 3BTKE 1OYTH 3M3SA 1MTSA 2GCHF 1VJ9U 4NXPA 1QGFA 3U1JB 2TRMA 1EP5A 2VIPA 3VEQB 5FPTA 5JB9S 2FOGA 1S0QA 2KRGA 8KME2 2PGBB 1HUTH 4ASHA 5DK1A 4EDJA 1Q31A 2M3MA 3UY9A 3ODDA 1AKSA 4Y8ZA 3PB1E 2BYGA 1HAVA 5T6FA 3RMLH 2REYA 1W10U 3VB3A 1FY4A 2CS5A 1P04A 3BTDE 1VA8A 1WI2A 1EJAA 1SGIB 1GBEA 5A8ZA 2FOBA 1OSSA 1UVUH 1VJAU 1TQ7B 1W9EA 2QN5T 3HKIB 1O3AA 1TPOA 2VSVA 4AGJA 2C90B 1GWAA 5TJXA 1DDJA 3PV5A 1BMAA 1LHGH 1S82A 2BD3A 4X6PA 3RXLA 1K1JA 2F3CE 2HWLB 3RXPA 4JZIA 2B9LA 2J34A 3E16B 1CO7E 2ZDMA 4FUJA 1C2HA 1O3IA 1IQKA 2VU8E 4ISHH 1G3DA 1P0SH 1GMDF 1UJ1A 3VQGA 3FFGA 2HOBA 1DICA 2ZIQH 2M5TA 3GY7A 1C5ZB 1GPZA 2M0ZA 1QFKH 4ZROA 5F67A 1AN1E 1GVKB 2JWEA 2XWAA 1NESE 2FO9A 5C20A 4WF8A 4BANB 2KPKA 2OMJA 2PTNA 3NUMA 4JORA 1W12U 4B1TA 4Y6DA 2P3WA 1HBTH 3LGWA 5FCKA 1SQAA 2GV6A 8GCHF 2EC9H 1KXAA 1FIZA 2WPIS 1SGCA 1VZQH 1N6DA 5GIBA 1C9PA 1SGFA 3MI4A 3DA9B 2A7HA 1NROH 1SSXA 1TABE 1P2QA 2VINA 3A7ZA 1X5NA 3VXFH 2FP7B 4OS5A 1OP2A 3SNCA 4JOEA 1L0ZA 3UNSA 1CSOE 1Z8IB 3URCA 1TP3A 1PFXC 2AINA 4GCHF 1OYQA 1L4DA 1BQYA 1TNIA 1L4ZA 2EDPA 2AERH 4ZKNU
chains in the Genus database with same CATH superfamily
1HGTH 4IC5A 1V1TA 1Y5BT 1T4VH 1G3CA 1OBZA 5E6PB 2F9OA 3FZZA 3DJAA 1IQNA 5F53A 3DSGA 1GJ8B 1AB9B 4NMPA 3RL7A 3TNSA 2G4TA 3FP7E 2BD8A 2ZCHP 1LQEA 5ESTE 2ZI2H 3CS7A 3KHFA 1C9TA 1OWEA 3QTVH 2Z9JA 1P06A 4JZ1A 3DORA 1UEWA 5DO4H 2Y7XA 3TH2H 4NIXA 1PQ7A 2OC1A 4A1XA 1AB9C 2UUYA 3DD2H 2PKSC 1TPSA 1G37A 1GI5A 1EFRD 1WSSH 5FCRA 4Y71A 2F83A 5C0TA 1LKBA 1GBBA 3GDSA 4JOJA 4ZKSU 1TNHA 3W95A 5JBCS 3ATLA 3LGUA 5FB8C 2J2UA 1GM1A 4K2YA 3EA9A 4NIVA 1AKSB 1SQTA 1UK2A 2AWWA 1HAVB 5IL9A 1SQRA 1TBZH 1GBLA 1BTZA 2VGCB 1UTPA 1MKXH 2R0LA 2ASUB 2D8IA 3RLEA 1NFWA 2A5AA 4NFFA 4RN6A 3V7TA 2EI6A 1TB6H 1QL8A 2DE9A 1PPEE 2ZFTA 3BIUH 2VGCC 2EGNA 1I92A 2G52A 3OFND 1DANH 3SNEA 5HFDA 1PYTC 5HIZA 2SFAA 5EGMA 1THPB 4A6LA 2JJ2D 4K8YA 3T28A 2LC6A 3QJNA 1FONA 1CHOG 1O3NA 2ZHEH 2W5EA 1NU9A 1RIWB 3DHKH 3T27A 3S9BA 1RRKA 1SGPE 4MVNA 1LHCH 1O2LA 3F0OA 3UQOA 1O2HA 2BDIA 2BB4A 5B6OA 2VH0A 1MTVA 7LPRA 2EXGA 1L1NA 3SHUA 2AMQA 4BAKB 2PW8H 3W94A 1D6RA 1Y3UA 1W3CA 2G00A 2R4HA 1QB1A 1XM1A 4NMOA 4IMQA 3GABA 3RU4D 4NMRA 1LTOA 3CC0A 3RM2H 3ATIA 2L4SA 1XX9A 1GI9B 1J14A 3O8DA 1TMUH 2VZ5A 5GXPA 1P03A 3GY8A 2OBOA 1NRNH 2VIWA 2Q3GA 3CENA 1S6FA 1BTUA 3WY8A 3SU5A 2Q1JA 1X6DA 3PWCA 1OX1A 1OWIA 1BTWA 1IU0A 1OPHB 2PA1A 3K82A 5A0BA 1QQ4A 1AWHB 4ZHAA 5T3HA 3KZDA 2O8TA 3U9AH 1J9CH 5HGGA 5DPAA 3MYWA 3JXTA 4R0IA 1SVPA 3SQHE 1CA8B 4FUIA 2KCPA 2BD2A 3HKJB 4MLFB 3SN8A 3TNTA 1T4UH 1A0LA 2CHAB 2EHRA 1ELVA 4BNRA 1KXDA 1N6YA 9ESTA 1Y7NA 5JDUB 1DLKB 3A7YA 5K0HA 2CGAA 4ZHMU 3A7VA 1S6HA 1O3PB 3CNRA 1WYKA 1ESBA 1GI8B 1YLCA 3MMGA 3QZRA 4SGAE 4JOPA 3RM0H 3QUMP 1WF8A 1C1TA 1MMJN 2W3KA 5JBTA 3SU2A 2FN5A 1SC8U 4IN2A 1ZTJA 2YMSD 3OTPA 4UD9H 1AZ8A 2DAZA 2R0KA 3ZZ5A 3O5NA 2KCYA 2J92A 1FN8A 3EA7A 1AI8H 1AE5A 3BEIB 3UQVA 1UVOA 3DIWA 2STBE 2ZPQA 2YUYA 1UK3A 1E38B 3KQ5A 3TITA 5AFZH 5EOKA 1FAXA 3P8GA 1F0RA 2ZDLA 1YPHE 1NPMA 1V2NT 2I6SA 2I0LA 2HVYB 2OUAA 2AYWA 4KELA 2DJTA 1OXGA 2ZGJA 2FOMB 3B8JA 1BMLA 1QA7A 2OD3B 2J98B 2QG1A 3RMNH 1JBUH 2M0TA 4UDWH 3FANA 1LMWB 2F0AA 4NA9H 5ILBA 2GZ9A 5E11A 1OS8A 1YP9A 4X2XA 2BD4A 4B2BA 3PO1B 5EG4A 2BXTH 1TMTH 1HJ9A 2P8OB 2W26A 1ARCA 3OE7D 1MABB 1JWTA 3A8BA 1MKWH 1DITH 3MH4A 3UTUH 1UTJA 5GCHG 5F8TA 1TOCB 2BD9A 2KPLA 1O5GH 1YPHC 3SV7A 2ODYB 4JOKA 3BG4B 1IQHA 2OXSA 3KHVA 2ZDNA 4AFZA 2PUXB 3OTJE 2BLQA 4CRDA 2JOAA 1U3BA 4R8TB 2OZFA 5C3NA 5A2MH 1OZIA 1P9UA 2PSXA 3A7XA 2SGFE 1MAXA 2QIQA 1GJBB 3C1KA 1YBWA 3SGBE 1LHDH 2VVCA 4ZXYH 3T26A 2D92A 1TRMA 4UFDH 1C1OA 1B5GH 2ZGBH 3U8TH 2Q6FA 4P2AB 2QF4A 5E0GA 4O03A 3DSOA 1PPHE 2QCYA 3R0HA 1GBFA 1D4PB 1NRQH 3M3TA 1LHEH 1KYNA 1MAYA 1UTOA 3ZYEA 2KG2A 4ZHLU 2XBWA 2Z9KA 5C67A 1A61H 1C2EA 3NZIA 5E0HA 3N7DA 2FEQH 2IJOB 1W13U 5ESBA 4FLNA 1W14U 3PDVA 2BX4A 3ZZ3A 5HJ1A 4PROA 1E37B 3U98H 5LH8A 5HEYA 1YKTA 3O46A 1P2MA 2HE2A 1IQIA 3STJA 4KFVA 4B2AA 5HM9A 1VITH 4INLA 1WJLA 2VH6A 1GVZA 2FCFA 2FOAA 3AK5A 2JINA 1Y59T 1QNJA 3T2NA 1PDRA 1GCTB 1P3EA 2ODQA 3RDZA 1VGCB 1C5LH 1O2NA 2A2QH 3MU1A 4YT7H 5CDFE 1AD8H 3F9EA 2FS8A 5E22A 3QJMA 1LVBA 3HK6B 3L33A 4FU8A 1UTMA 1F2SE 2BHGA 4NSVA 1GMCF 5C5NA 1ZHMA 3S69A 1ABJH 2ZFPH 1EAUA 1SGTA 2GZ7A 1AMHA 4Y0YE 1TNJA 1KLJH 2D26C 5AFYH 2C8XB 3SJOA 5FAHA 1YPMH 1MH0A 1P3CA 2VVVA 3D49H 3NFKA 3FVFB 4O3TA 4NMSA 1ACBE 5J4QA 2H2ZA 8ESTE 1WAYB 1GBHA 1HAGE 1UVSH 1ANDA 2YMSC 2XRCA 1ZRBA 5HFBA 2BD7A 1YPLH 2EEIA 1U6QA 1O5CB 2W4FA 1E1QD 3UR6A 2OCSA 4AG1A 1C2DA 1TGBA 3M3VA 1UEPA 6CHAB 1FLEE 5JBAS 5KECA 4J2YB 4CR9A 4NWKA 1NF3C 1C1MA 1NFYA 1WUNH 5C1UA 1ELFA 1O2YA 3CBYA 1FJSA 1OWHA 4JZFH 1N1LA 3DT0H 4WJG2 1O3EA 1UF1A 3NCLA 3UOPA 3F68H 4YT6H 1KDQA 2D8WA 1QA0A 1SGFG 1UFXA 4YXWD 1ZUBA 1VITG 1GHVH 2EDVA 4CHAC 4THNH 1WG6A 2KJKA 4DT4A 4DIIH 2C93B 4XBDA 4I31A 3MNXA 4B71A 1EXFA 5EU8A 1K22H 1QBVH 5GLJA 4FUHA 1A3EH 3Q77A 1MBQA 5JBBS 2YNBA 3QZQA 3TJNA 2FXRA 1EAIA 1O2SA 2ILNA 2V3OH 3GCHC 3VB6A 2I6VA 3M5MA 2V3MA 2RDEA 1IQGA 3LOXA 1H9HE 2SGDE 2UUFB 1LCYA 3AXAA 3RXJA 2FX4A 2KOMA 4AB8A 4H6SB 4D7FA 2JIZD 1COWD 3ID1A 3LT3A 1A5GH 3Q00A 5HFFA 3F2FA 2Z9IA 5HETA 1C5TA 1KXBA 3R69A 1MQ5A 5D13A 3UNQA 5C94A 3CP7A 1F7ZA 2A1DB 3S7KB 5C1XA 2KCAA 1AUTC 1DS2E 2IN2A 3HPTB 2TGDA 1ZOKA 2DUCA 3SV2H 2AWUA 2BDBA 1FN6A 3QN7A 4KKDA 3GJ9A 2OQSA 2H1UA 2AIPA 1O2WA 4X8VH 1O36A 4P0CA 1KTTB 2DE8A 2PKAA 2FNEA 4MNXA 4U2WA 4JJ0A 1K1OA 4X2WA 1SPJA 2V90A 1S81A 4B2CA 2WYJA 1P2KA 4Y11E 3E91A 2WYGA 2HE4A 1UMAH 1ZMNA 2ZZUH 3ZVFA 4D7GA 2W6ID 3EE0B 4GHTA 5C1YA 3CH8A 2W6JD 2ZNKH 3B9FH 1N99A 2VWRA 1HAYB 1F0TA 4H6TA 1HAXB 1HIAA 1V2TT 3DSPA 3PV2A 1HFDA 5EXMA 1C5XB 1SOTA 3N99A 4I86A 3UWIA 1HAZB 6LPRA 3O8RA 3H7OA 5LPRA 2QKTA 1PQ5A 3K9XB 4WMEA 4YLUA 2Z17A 5JPMH 1S84A 2JJ1D 4A5TS 4ABEA 1BBRH 2FI3E 2EEHA 2VWOA 1WU1A 1TONA 2HGTH 1YLDA 4FUBA 3W1EA 3BPUA 4K60A 2OGPA 1IQLA 4Y10E 2C3SA 3HPMA 4Q2NA 4XDEA 5E21A 1N6EA 1GI0A 4CH8B 1Q2WA 1DOJA 1DY8A 1RY4A 4LK4A 2XNIA 1ZPCA 1V62A 1P10A 2PHBA 4Z6AH 2R2WU 3P8FA 3RXAA 8LPRA 1IQEA 1ELAA 1NO9H 1V2OT 2QGRA 1QAVA 1QL7A 3ZZ6A 1ELDE 2GZ8A 1UJVA 3GCTG 3PRBA 5HF4A 5AHGH 1C5QA 3I77A 3HATH 3M7TA 1IAUA 4KTCA 3BTGE 3PTNA 1W2KH 2GX4A 2DLSA 2VIVA 1O30A 3Q3XA 3LNYA 2ALVA 2EEJA 1QRXA 1GDNA 3ZZCA 2VSPA 1QHRB 5T6GA 3AAUA 3RXHA 1OWKA 1YF4A 1DUAA 2BVRH 1NBMD 1G2MA 5EXLA 4BAOB 3T25A 1KXEA 1TNKA 3S0NA 2KM0A 5CHAB 1FC7A 2FODA 1H8HD 1EJNA 3P95A 3RXFA 1CBWB 2B7DH 2RG3A 2WL7A 1AVXA 1E34B 1FPCH 4E34A 5I25A 3KQBA 3LU9B 3WWBA 5EXNA 3ATKA 2V6NA 3GY6A 3SHAH 1RJXB 1TBQH 4WMDA 3E3TA 1IQFA 5CHAC 3L6PA 3GDUA 1HJ8A 4WH8A 1PYTD 1O3JA 3PMJA 2Y5FA 2BZAA 3ZVBA 3SBKA 2QV1A 5HEBA 1E36B 1PQAA 2FS9A 1EAWA 1SHHB 1OP8A 2BX3A 2W7UA 2FDAA 2XTTB 4E05H 3ZVEA 1HRTH 6GCHF 1MKXK 2V35A 3H7TA 3SQEE 1ETSH 2WV5A 5DN6D 5EZ0A 1CT4E 2A31A 1YPEH 1BTYA 1J16A 3RUOA 2C8WB 3PS4A 4Q3HA 2PKAB 4HG6A 4JYTA 1AU8A 5L2YH 4NZQA 1TX6A 1AUJA 2Z6BD 1LO6A 1O3BA 1CE5A 1NRSH 2GTBA 2YNAA 1WH1A 1DPOA 1C5NH 2PGQB 3B23B 4B76A 1CGIE 3F9GA 4WYUA 2IWNA 1LDTT 3GSLA 2QXIA 2VVUA 5BPEA 3T5FH 1UEZA 3QGLA 1TGSZ 1CGHA 2Z3EA 4IS5A 4Q2PA 5HF1A 1HDTH 4BAHB 1K1LA 3P92A 2QC2A 2KOJA 1O2GH 3DJ3A 1C1RA 1TGNA 2H9TH 3Q76A 1TMBH 2FX6A 2QYIA 4YYXA 2H6MA 4WH6A 1HJAB 2H2CA 3KIDU 1UTQA 2AEIH 1GMHG 2JH6D 1IQJA 1LVMA 1V2KT 4CRAA 1V2QT 2AMDA 2GCHG 3TGKE 2ZCLP 1O5EH 3GYLB 5DTHA 3U28C 3A81A 4OAJA 4X1RU 5EJLA 1A2CH 1HLTH 4GVCA 1HJAC 1YPKH 1BE9A 4IC6A 1ZMLA 5C0UA 4G69A 1H9IE 2OK5A 2UWPA 4ABFA 4N6XA 1P01A 1MZAA 5HEDA 1NBME 1XUKA 1GHYH 1DY9A 1JRTA 1Z6EA 3RXVA 1AO5A 1SKYE 2ZO3H 3MTYA 1KIGH 1OHHD 1ZOMA 4DGJA 1YPJH 1NTEA 5GNDA 1KSNA 3K50A 2WV9A 3BIVH 4MPAA 4MG3A 3GY3A 3CS0A 1O2RA 2HGAA 4NNLA 2WV4A 5FBIA 3SU4A 4R2ZA 1J15A 1C2JA 1TALA 2OLGA 1Z7KA 4K1TA 3P70B 2A32A 4XD7D 4LZ1H 3PWBA 1NU7B 1YCPH 2QY0B 1TX8A 2FI4E 1GGDB 4UFEH 1MFGA 3M36A 2P3TB 3K6ZA 4AG2A 5ABWA 2G81E 1MQ6A 1WQSA 1GMDG 3R3GB 1O37A 1A0JA 3UB0A 1Q3XA 1BFEA 4CBOA 2WPLS 3LGTA 4K1EA 1N7TA 2EAQA 1HAIH 4X1SU 2ZTZA 3UOUA 4GUXA 3ATMA 1EPTA 3EQ0H 1V2JT 4FUGA 2ZHDA 3SNDA 3M61U 2ANYA 5L2ZH 2HNTC 3TGIE 2VB0A 1X7AC 2HRVA 2O2TA 1O2PA 2GT7A 3TVJB 1K9OE 1SG8B 2BVSH 3F6UH 1CGJE 3GY2A 3SUDA 3U1IB 2R3YA 1BUIA 2D2DA 2OCVB 3TSVA 2ZC9H 3LPRA 4A7IB 3ID3A 2ESTE 8GCHG 4X6OA 2I0IA 1JIRA 3ZZDA 4ACBA 2KCOA 4E06H 3LGYA 1X5QA 1Z86A 4NCYA 3RXDA 2VJ1A 1ABIH 2IPHA 2VPHA 1MU8B 1BTXA 2FPZA 1O5DH 1GHXH 2VBCA 4E35A 1WFGA 3ID4A 5HFCA 1C1UH 4XBBA 3OEHD 2OP9A 2VWNA 3ESTA 4OS6A 2FESH 1C2IA 4GCHG 4ABGA 1ZHRA 1OBXA 2NU3E 3M7QA 1RIWC 3SNBA 1C5PA 3RXKA 3LH3A 1VJ6A 1T31A 1WCZA 3MO6A 3TK6A 3PRDA 1U37A 5I7ZA 1RGRA 3TSZA 2VIDA 3HVQC 3BEFB 4TSFD 1TNLA 5DP3A 2XCNA 2KL1A 3EGHC 1KEFA 1BCUH 1EAXA 3ATWA 1MKWK 1ZGVA 4K5ZA 3FP8E 1GBIA 3ZZ8A 2P3FH 4NG9H 1SGRE 1JXPA 3ZVAA 3MNCA 4GSOA 3A88A 4AORA 5CE1A 1CHGA 4AC9A 3MH5A 4BAQB 2FOEA 2FZZA 2VIQA 1AZZA 2KFWA 3BSQA 1CT2E 2GV7A 1SQOA 3QE1A 1G9OA 3MFJA 3SHWA 1P2OA 1PJPA 2RDLA 4IGDA 1ZTLA 2BXUH 1UM1A 1GHAF 1XXFA 1S5SA 2GDDA 3VFEA 1GHWH 1ELBA 5G1DA 2V1WA 1DLEA 1QCPA 5DGJA 3TH3H 4XSKU 1INCA 2QF3A 4LMMA 1Q3OA 2KJDA 1V6BA 4YOGA 2K0QA 1J8AA 1S0RA 1JIMA 2JETB 5DP8A 5AF9H 3SFJA 1B8QA 1FY8E 3WW7A 4AZ2B 2WUCA 4U01A 4UU6A 2EA3A 4X6MA 3FOAA 3H09A 5TCAA 3VB4A 1K1MA 2RRMA 2VRFA 7ESTE 5GPIB 2KZ4A 4WY3A 2BDHA 5A0AE 3A8CA 4FGMA 2JETC 2EQNA 1O31A 1T8OA 1ORFA 1P9SA 4ASUD 3ENSB 2CHAC 2GEFA 1AE8H 5E2PA 4CBNA 5EQSA 4CH2B 2FIRH 1SL3A 3ODFA 4OS7A 5TCCA 2LNCA 4X2VA 1XUJA 5A8XA 2BY5X 2XC5A 1DXPA 3V12A 2BYAX 2F9PA 3O8BA 5L6NH 1O2UA 3SV6A 2JDID 4YZUA 3S7HB 5T1VA 3VB7A 2L97A 2FTMA 1HYLA 2F9NA 2L4TA 1N7FA 2ZFFH 2EI8A 1U39A 4HZHA 1THSH 1YM0A 3U8OH 4D8NA 3MU8A 4OS4A 4DIHH 2K1QA 3EE7A 1HAOH 1UTLM 2A45B 4GPGA 1OWDA 1BDAA 1TBRH 3E8LA 1RXPA 2F5YA 1FC9A 1H8ED 4K8BA 1AIXH 2Y5HA 3UREA 1G9IE 1Z71A 3E0PB 1FDPA 1WBGB 2A0QB 1PPGE 2JKHA 2RA3A 2CF8H 4U30A 1O3FA 2AGEX 5F3XA 1EOJA 2ZU3A 5F03A 1E1RD 3Q3KA 1DT2A 3FZDA 1T8LA 1O2IA 4GHQA 2WPHS 4ZCNA 2KBSA 1RD3B 2G51A 4FUDA 4BXSA 4A92A 4NMTA 1P02A 2D1JA 4YOIA 5IDKA 1V2ST 1JOUB 1BTHH 1A5HA 1WFVA 2SNVA 4I32A 2THFB 4UFFH 4ZXXH 1A3BH 1GL1A 1XKBC 5DG6A 4Q2QA 1A7SA 2Z7FE 1EOLA 2LPRA 4O9VA 4Q63A 2I6QA 1SFIA 3ZV8A 2AS9A 3PO1C 1XVMA 2IWPA 2GP9B 2P8OC 3TU7H 2GMTB 4RKOB 4YDPA 2H3MA 1A4WH 2GCTB 3NXPA 2K20A 3GCOA 4Z1MD 1NZQH 3VG8A 2H9HA 2OQUA 1I16A 1V3XA 4NIYA 4K72A 4M7GA 4K6YA 4HI3A 5EQQA 4ZKRU 3BG4C 4TPIZ 4BXWA 4FU7A 2XC0A 1C2LA 2GMTC 3LIWA 2FTLE 1QY6A 4WVPE 2XBYA 2WZQA 2GCTC 3KZEA 1O2OA 2QF0A 5I46H 1C1PA 5E1YA 1MTWA 6ESTA 3QLPH 4ZKOU 1DWDH 3AASA 2BY8X 2VWMA 1O5AB 2FLRH 2ZU5A 5FL7D 5HKKD 2F91A 1W0KD 1QURH 2PP6A 1C2GA 3SUZA 3RMOH 3SUFA 5EIYA 2IPQX 2EDZA 5HFEA 2KR7A 3PYHA 1TFXA 2NU0E 4WXIA 4I8HA 1BBRE 3F2GA 4CRFA 3BEUA 1O38A 4M9FA 1C1QA 1XKAC 1GL0E 1DWBH 5E2OA 2PV9B 4YOJA 3GCNA 1IHJA 4H42U 4YO9A 2O8MA 2SGEE 3P17H 1VAEA 4MNYA 1L1JA 1CU1A 3B76A 5G4BA 4JOFA 1D5GA 1Y3XA 1LVYA 1P8VC 2PWXA 4AOQA 1N6XA 4NMVA 4B6FA 2AWXA 1AWFH 1GJCB 1O3DA 3TMHA 1GCTC 1EASA 2NU1E 1VGCC 3V13A 1W11U 2FOCA 2CK3D 1F0SA 3PMHB 3GICB 5EJZA 2JH5D 4B74A 2IWOA 3HGPA 1ZZZA 3GY5A 5EJ1A 2BY9X 1YC0A 3ZZ4A 2SNWA 2ZPSA 3E17A 2I1NA 1W7XH 3A82A 4ZH8A 2ZQ1A 1GJ4H 1BMNH 2NU4E 1O3MA 1ZR0A 1WDIA 4DURA 3P8OA 4WWYA 4ESTE 2K1ZA 2G5VA 1O3CA 2UZCA 1BIOA 1SOZA 3HPKA 1SI5H 4MTBA 4JK6A 2ZHWH 2CF9H 4X2YA 2BDYA 1Y3VA 1K1NA 3LJJA 4RSPA 3DFJA 4HGCA 2QA9E 1Z6JH 1QJ1B 1QTFA 3NRLA 2KAIA 1PPZA 2HALA 2FI5E 1BBRK 3IWMA 1WIFA 1EP6A 4KTUA 1ELTA 2M0UA 1ZPBA 2ZDAH 3PDZA 4TPYA 2O8WA 1BRBE 3BTME 6CHAC 5JB8S 1BHXF 4ISLA 4BOHA 2Y5GA 3KEEA 4JJ3A 4LOYH 2GJGA 4BTTB 1N7EA 1Y5UT 3NKKA 3SU6A 4Y8XA 1IU2A 1TWXB 2H9EH 1TGTA 3KGPA 1L1GA 1WV7H 1QL9A 4XHVA 1A46H 1E0FD 1C1SA 4RT1A 3ID2A 1QRWA 2HLDD 1K32A 1MC7A 3V3MA 1FXYA 1DWCH 4X8UH 1EB2A 4FVBA 5E8EH 5H4IB 1WF7A 1ESTA 4INHA 4JOGA 5HDYA 1IHSH 5GWZA 1JMOH 3M37A 4SGBE 3ZVDA 3V0XA 1ZYOA 1GJ6A 3RL8A 2WPDD 4ISOA 1Z87A 2ZU4A 3E0NB 2ZP0H 1V2MT 3ELAH 1MZDA 2A2XH 2ZECA 1X45A 4Q7XA 1MD7A 4ABIA 4KTSA 1GMCG 1O35A 3NWUA 1FI8A 2P59A 3KQCA 3RXTA 1KY9A 3UIRA 4NNMA 2KOHA 7GCHF 1NY22 2H3LA 1W0YH 3OY5U 1B0EA 2CJIA 3LC5A 1E35B 1UCYH 2ZFQH 1G36A 1K1PA 5T6DA 4CR5A 1GHBF 1NS3A 3WWFA 4AGKA 2OTVA 1FQ3A 2NWNA 1LHFH 3D23A 1FC6A 5IYTA 1O5BB 3RXOA 1HB0B 1GI6A 2EI7A 2PDZA 1O3HA 1ZRKA 2G5NA 3A84A 2ZHFH 4Y8YA 4ZMAH 2OBQA 4JYVH 3T29A 2JXOA 2PTCE 1B7XB 2I04A 1HPGA 1SGQE 3FKSD 2IWQA 1ZLRA 1K21H 1K28D 5DP4A 4LZ4B 3I4WA 2PKUA 4HFPB 1G32B 1BOQA 1O2QA 3EYDA 5C17A 1MU6B 1W9OA 3F0PA 4K75A 4UONA 5FHTA 1Z8GA 1BJVA 3LDXH 1O34A 5EPNA 5SGAE 2ANWA 1Z8JB 1T2MA 4XFQA 3EAJA 1ZSLA 2GVFA 5GJ4B 1C5VA 1FY1A 5F8ZA 4E7RG 1NRRH 4B6EA 1ETRH 1GHZA 2VIOA 1GBAA 4MNVA 4XE4A 3PV4A 1GJDB 1KLIH 1OOKB 3BG8A 3GYMA 2DMZA 3RXUA 1VB7A 4NXRA 2ENOA 2BOHB 2KQFA 4MPUA 5PTPA 3RXQA 1Z1JA 2ZHQH 2J97A 1FIWA 4KGAA 5FBEA 1VKYA 1N8OB 2BMGB 4REYA 1W9QA 2RCEA 1MCTA 1O2ZA 3LGVA 3KF2A 1KDQB 4D76A 2ZGCA 5KGOA 1BRCE 3A8DA 1SGYE 1ZSKA 2A4RA 3F9HA 4F4OC 4DJZB 2LA8A 1GJ5H 3PLKA 1BRUP 3E6PH 1UJDA 1QB9A 3ZZ9A 1ZTKA 3RXGA 1N8OC 1YWUA 4AFQA 3QK1A 1IQMA 1DM4B 4NSYA 2NU2E 2AIQA 3SJKA 3SNAA 4FUCA 1ID5H 2ZPRA 2QKUA 1XVOA 5DP7A 1C2FA 1OWJA 2P95A 3PLPA 1O2KA 3UPEA 4ABAA 3PROA 3F2HA 1O3LA 1GBCA 3FP6E 1QAUA 5J4SA 4B73A 3ZIAD 2ZG0H 1AVWA 4GAWA 2YOLA 1NFUA 2BDAA 2KX4A 1C4V2 4FXGH 1C5YB 1GI1A 1KXFA 3SYJA 1O0DH 2FYRA 2JIKA 1XUIA 4BAMB 2CN0H 3RXMA 1F5KU 2BDCA 4YLQH 3RP2A 1YCPK 3MH7A 1BB0B 1EX3A 1PPFE 1VCPA 3KYGA 4Z33A 2UUJB 4X1NU 2JSNA 1CBWC 1HV7A 1W0ZU 5AVDA 4K78A 3DJ1A 1RS0A 3RLWH 2QAAA 1GI4A 1EZQA 4ABBA 4DG4A 4CRBA 1GG6B 2MX6A 4MQAA 3M5OA 4H11A 1YYY1 3GDVA 3MU5A 1NN6A 1UVTH 2FM2A 1P11E 5FPYA 4UU5A 1BA8B 2KA9A 1CA0B 3SORA 4Q80A 3UNRA 3PM3A 1AFQB 3QGJA 2M10A 5HYOA 1TYNA 1SBWA 1GG6C 4FOUC 3STIA 2CXVA 2W3IA 1TOMH 3LONA 5L30H 2LUIA 4X8TH 1CA0C 3SOEA 3PTBA 2RA0A 1AFQC 2ZGHA 3TJOA 3AAVA 2FLBH 1GQ5A 1C5SA 1HIAB 2HPPH 3D62A 3ZZAA 4RI0A 1YGCH 4Q2OA 1EUFA 2GD4B 1P2IA 3U8RH 3OEED 1Y5AT 2KAWA 1VR1H 1BITA 2AFQB 2BVXH 2ZKSA 3K1RA 5A2PA 1MD8A 2BY7X 3A89A 1GBJA 3QGNB 4UFGH 4NA7A 1X9ZA 5FXLA 2J94A 1L2EA 1EB1H 4ACAA 4AYVB 5GDSH 2G4UA 3A86A 2Y80A 3SGQE 3F3BA 2TIOA 4A1TA 1P09A 3M5LA 4CRCA 2BOKA 2GDEH 2QKVA 4FUFA 3SU0A 1MCVA 2SGAA 3UR9A 4AMHA 1CHOF 4NXQA 2JILA 3QIKA 2BLWA 2W7SA 1B0FA 3A80A 3LH1A 1UVPA 3BF6H 3S9AA 2MHOA 1ZJKA 3QTOH 3LJOA 3SO3A 1P1DA 3TPIZ 1S6LA 1QAVB 1UO6A 1FY5A 2HLCA 2F9UA 2RCZA 1C5RA 3LGIA 3SJIA 7KMEH 2ODPA 2WPKS 1U38A 3D65E 1O2TA 2A5IA 1D3DB 1O2JA 1C2KA 1TQ0B 1D6WA 4Q7YA 1LPZB 3SUEA 1W8BH 2HNTE 1C1VH 2PKTA 2WPMS 2Y82A 4HTCH 1O2MA 1UEQA 1SGEE 5DJ7A 1ZGIA 2OPGA 4I8JA 4I7YH 1KLTA 3ZZBA 3ZVCA 2PKSB 1P05A 1XMNB 1ARBA 1VCQA 4CREA 4OEOA 3HK3B 1WI4A 5H3JA 1HAHH 1UM7A 6GCHG 1CT0E 1GVLA 2ZTXA 1EQ9A 2BZ6H 3OAAD 3TK5A 4KP0A 4K3JA 2AMPA 1C5OH 2ANKH 4INKA 3U69H 4MDSA 4O97A 2PNTA 2A7CA 1RGWA 3TGJE 5LGOA 2EY4C 1BT7A 1SLUB 1GDUA 3A7TA 4X0WU 1J17T 3KQEA 3SZNA 3BTEE 5FX5A 1C2MA 1E79D 2J4IA 3BTWE 4HOPA 1ELGA 1GGDC 2E7KA 2BY6X 1H8DH 1UHPA 1AVGH 2CSSA 2B5TB 1CVWH 3I78A 1LQDB 2G2LA 5C2ZA 2SGPE 3L4FD 1DWEH 1Q3PA 1FUJA 3SGAE 5BRRE 2W7RA 2UWOA 4QT8C 1TA2A 3OX7U 1P2JA 1BMMH 1XUHA 3SU3A 1DFPA 3M35A 1ZMJA 1G3BA 5DSFA 3KYFA 1H1BA 4P00A 5LPFA 3SHCH 1H8IH 1SMFE 1RGQA 3GOVB 4Q2KA 3SJ9A 1K1IA 1WHAA 3I18A 1XUFA 2WHXA 1DSTA 3LC3A 2J98A 1SLVB 1UK4A 3A85A 1BMFD 1GI2A 1KWAA 1FV9A 1V5QA 2C8ZB 3RMMH 3RXIA 1V2LT 2TGTA 1YBOA 4OGYA 3GS9A 4UEHH 1FNIA 1O5FH 2QE7D 3MU0A 4F55A 2P93A 2CSJA 4JZEH 1SB1H 1RTLA 1QZ8A 2QXJA 3OY6U 4NZLA 4X1PU 3VB5A 2KJPA 3FO8D 1D3QB 2Z9GA 1X8SA 3UFAA 1Z8RA 2JREA 2Y81A 2LC7A 3KQDA 3RXRA 2PUQH 4OS1A 3BN9A 1UTKA 4Q6SA 2V7QD 3ZZ7A 1DX5M 3UUZA 3MHWU 1GJAB 3K65B 3RXCA 3MOCA 3QO6A 2BM2A 1A5IA 2KV8A 4MNWA 1TQ3A 3RC5A 1THRH 3GGEA 2OQ5A 2K8IA 1Z1IA 3BV9B 1OBYA 3MNBA 1V5LA 2FWWA 5DP5A 3M7UA 2QXGA 2O8UA 3FY5A 1D3TB 2QF5A 4U32A 1HXFH 1SLWB 3PLBA 1QBNA 4I33A 3R68A 3VGCB 3PMBB 4GVDA 1SFQB 3QWCH 1MUEB 3JZ1B 3NGHA 2R2MB 2ZWLH 2EGOA 2C8YB 3N7OA 5GCHF 4RKJB 4X8SH 4YESB 3WKMA 5B6LA 3VGCC 3CBZA 1ESAA 1UW7A 1EZUC 1DSUA 3N7EA 4NGAH 2EEGA 3CYYA 1TA6A 3P6ZB 1DXWA 2J38A 2J9NA 1VCWA 1FAKH 2P3UB 5EW2H 1T7CA 1PPCE 3IG6B 1AHTH 2ALPA 2G8TA 2OC7A 3BTFE 2VNTA 1T8NA 3SJ8A 1CQQA 4XOJA 5F8XA 1T8MA 1XUGA 2F9VA 3F1SB 3BTTE 3NCVA 2GZVA 2WSSD 4IMZA 1ZHPA 4NIWA 3TK9A 2Z3DA 2SGQE 1LKAA 1GQ4A 1TRNA 3KDKA 4TY6A 2H2BA 2ZU2A 4WYTA 4HOPB 2TGPZ 1V2VT 1GI3A 1EPTB 3EGGC 4Y79A 5A09A 3E90B 4ABDA 2Z94A 3HGNA 1Q7XA 2PZDA 2EGKA 2BQ6B 3FN8A 4UE7H 1TP5A 2HNTF 1TRYA 1K2I1 3EA8A 1V6DA 1X5RA 1F5RA 2ZDKA 3H5CB 3LKWA 1HCGA 1SGNE 1EPTC 1SLXB 3MH6A 4ZAEA 3SZEA 5F6MA 4TY7A 1GDQA 2ZQ2A 4F49A 3KL6A 2ZU1A 4X1QU 2BTCE 2R9PA 1ZSJA 2BQ7B 4X6NA 3MNSA 4JCNA 1YPGH 1BHXB 3RC6A 3T62A 4BTUB 2G5MB 3NK8A 5ETXA 1UJUA 4OS2A 4F8KA 2BD5A 4O06A 3FAOA 3OU0A 1Y3YA 4I8GA 1YLNA 3CBXA 2BDGA 1EATA 4DW2U 1TAWA 1TE0A 1UCYE 1C4U2 1KMHB 1GHAG 3QDOA 1QR3E 1ZPZA 4NA8A 3RU4E 2AHME 5EPYA 2V3HH 4LXBH 1UHBA 2ANMH 1N6FA 2Q9VA 3LNXA 2C4FH 3K2UA 3RXSA 5CMXH 1PQ8A 2GGVB 3SW2B 1IOEA 2UUKB 4MPWA 2IOTA 2J5UA 2LOBA 3M5NA 4GLYA 3PMAB 1EJMA 1RZXA 2O8LA 1TIOA 1SR5C 3DFLA 3R0FA 4K1SA 2YTWA 5G1EA 3RXBA 1NRPH 4Y7AA 1O3OA 3A83A 1IHTH 1DVAH 3K6YA 1F5LA 1QQUA 3SU1A 2WINI 2ZPMA 3TH4H 1ELEE 2XBVA 4JK5A 1C5WB 2LELA 2KYLA 4Q7ZA 1VITF 3E1XB 2HVXA 4JOHA 1M5ZA 4Q6HA 5HM2A 1FZZA 2D90A 1GJ9B 4XRNA 3G01A 4P02A 4Z0KA 1GCDA 3EDXB 1QB6A 4JMYA 2DKRA 4AN7A 1G2LA 1L6OA 4D9QA 3JZ2B 1W7GH 2XXLA 2OC8A 3ZYDA 3ZVGA 2YT8A 1T32A 3TSWA 4AB9A 1FMGA 3NFLA 3AW0A 3A7WA 2Q6GA 2JH0D 1UCYK 2FMJA 5EYZA 1MTUA 2OSGA 2I4SA 1GBDA 3MWIU 2WPJS 2Y7ZA 1O33A 4E3BA 2OC0A 3SV8A 1TNGA 2AGIX 3F9FA 2A4QA 2STAE 2Y6TA 2QT5A 1W0JD 2V0BA 2M2AA 5JXBA 3SV9A 2IJD1 1XZ9A 2BLOA 2ZDVH 4NFEA 3O8CA 2PR3A 3UWJH 4TWYA 1RFNA 3IITA 2FOHA 1HNEE 2B8OH 2M0VA 1BJUA 3AW1A 3L3TA 4Z8JA 1P1EA 1Y3WA 1LPKB 1ELCA 2VWLA 2YMSB 2H5CA 3MU4A 1OKXA 2F4LA 2ZTYA 5EODA 2ZF0H 2TPIZ 2WUBA 4ABJA 2BLVA 4F48B 1ANEA 2A7JA 4I8LA 4NWLA 1MBMA 1Y8TA 1NFXA 3DUXH 4RT0A 1GBKA 1LVOA 1G30B 4AFSA 4L8NA 1V2UT 3RC4A 1KXCA 1TLDA 3ZRTA 5DKMA 3I29A 3AVZA 1O32A 2YUBA 1MTNB 1BTPA 4TYDA 4GVUA 2ZEBA 1O2VA 5EQRA 4B75A 4PQWA 5B42A 2A4OA 5JYIA 1FY3A 2DLUA 4I8KA 2ZGXH 4DVAU 1AY6H 4FVDA 2TBSA 3VQFA 4WXVA 1GI7B 1F92A 1V2RT 1FCFA 1D9IA 2ULLA 4ISIH 4JZDH 1MTNC 1KTSB 1M9UA 4CHAB 4VGCB 1EZSC 1GJ7B 2GKVE 3S9CA 1EKBB 3VXEH 1QIXB 1NTPA 4J1YA 9LPRA 1TX7A 1MFLA 5IK2D 1UTNA 5EW1H 1WXRA 1GBTA 1YCPM 1A1RA 1NM6A 1UHBB 1WOFA 1O39A 1HXEH 3URDA 2EJYA 4OM9A 4VGCC 1WTHD 4A1VA 4AX9H 4IN1A 4ISNA 1C4Y2 4IBLH 3GISB 2PSYA 1O3KA 1K0HA 1WQVH 3GCHB 2P16A 2ZFSA 1FPHH 4H4FA 1G3EA 4IW4E 3QDZB 4MPXA 2XCFA 3VPKA 3GY4A 2YT7A 3RXEA 1O2XA 3MO3A 4FU9A 4YM9A 2PFEA 2Q6DA 4MPVA 1NC6A 5HXFA 1BRAA 4XBCA 1WHDA 4AYYB 5C5OA 1P2NA 2B0FA 3GCTF 3A8AA 4DOQA 2F43B 4YTAA 2AH4X 2XC4A 1OP0A 1C1WH 4WMFA 4FUEA 2CV3A 5CHBA 2XYAA 3A87A 1NT1A 1QJ7B 3C27B 5E0JA 4CRGA 5A8YA 1RTKA 2OS6A 5DP9A 3KCGH 4K69A 2BQWB 1R6JA 3SI3H 5A0CA 2DB5A 3OYPA 1V2WT 1EZXC 1XXDA 4Y7BA 2P94A 3Q3YA 1YY3A 4OEPA 1DUEA 1SGDE 1SHYA 4Y76A 2FE5A 3TJVA 3TJUA 1A0HB 5LPEA 3OSYA 3TLOA 1RTFB 2XWBI 1C5MD 3SUGA 4GHNA 4TT3D 4ABHA 1P57B 5K7RA 3RLYH 2J95A 3SI4H 2R3UA 1WTGH 2DM8A 2OINA 4NMQA 1GBMA 4TWWA 3ZV9A 1H9LB 2O9QA 3TIUA 1C1NA 2UWLA 2QBWA 1ZJDA 5HMAA 4K76A 4BTIB 4JL7A 1TGCA 4O3UA 2H5DA 1QRZA 1QLCA 2LP6A 2PLXA 3SOSA 1O3GA 1QJ6B 1UITA 3I1EA 3QX5H 1P12E 2ZCKP 2XW9A 1C5UA 4FETA 4DY7B 5FPSA 4DCDA 2Z3CA 2KAIB 3MQKC 1TPAE 2DC2A 1QBOA 1F0UA 3NPSA 3BTHE 2EEKA 1ETTH 3MO9A 4AFUA 1S85A 2F9BH 3ITIA 1AGJA 2ZPLA 3DCLA 3WKLA 2X7ZA 1AFEH 2QXHA 2A5KA 4OGXA 4Q4LA 2TGAA 5FX6A 3BTQE 2ZA5A 4E7NA 1ANBA 1H4WA 2EV8A 7GCHG 4Y0ZE 1LPGB 1ANCA 1PPBH 5DP6A 1HAPH 1TPPA 2GT8A 1DE7H 4D9RA 4KFWA 4DT7B 1JRSA 3KNXA 3P8NA 3RU4T 2CMYA 2L74A 2AGGX 1BZXE 1S83A 2Z9LA 1V2PT 3KN2A 2FYQA 2G55A 4ZUHA 2HPQH 2XBXA 2ZFRH 1GHBG 1D3PB 2A4GA 3EGKH 1GMHF 2FOFA 1AQ7A 4JYUH 3BTKE 1OYTH 3M3SA 1MTSA 2GCHF 1VJ9U 4NXPA 1QGFA 3U1JB 2TRMA 1EP5A 2VIPA 3VEQB 5FPTA 5JB9S 2FOGA 1S0QA 2KRGA 8KME2 5KEDA 2PGBB 1HUTH 3UAIC 5DK1A 4ASHA 4EDJA 1Q31A 2M3MA 3UY9A 3ODDA 1AKSA 4Y8ZA 3PB1E 2BYGA 1HAVA 5T6FA 3RMLH 2REYA 1W10U 3VB3A 2XOKD 1FY4A 2CS5A 1P04A 3BTDE 1VA8A 1WI2A 2L6OA 1EJAA 1SGIB 1GBEA 5A8ZA 2FOBA 1OSSA 1UVUH 1VJAU 1TQ7B 5HIYA 1W9EA 2QN5T 3HKIB 1O3AA 1TPOA 2VSVA 4AGJA 2C90B 1GWAA 5TJXA 1DDJA 3PV5A 1BMAA 1LHGH 1S82A 2BD3A 4X6PA 3RXLA 1FX0B 1K1JA 2F3CE 2HWLB 3RXPA 4JZIA 2B9LA 2J34A 3E16B 1CO7E 2ZDMA 4FUJA 1C2HA 1O3IA 1IQKA 2VU8E 4ISHH 1G3DA 1P0SH 1GMDF 1UJ1A 3VQGA 3FFGA 2HOBA 1DICA 2ZIQH 2M5TA 3GY7A 1C5ZB 1GPZA 2M0ZA 1QFKH 4ZROA 5F67A 1AN1E 1GVKB 2JWEA 2XWAA 1NESE 2FO9A 5C20A 4WF8A 4BANB 2KPKA 2OMJA 2PTNA 3NUMA 2RFKC 4JORA 1W12U 4B1TA 4Y6DA 2XNDD 2P3WA 1HBTH 3LGWA 5FCKA 1SQAA 2GV6A 8GCHF 2EC9H 1KXAA 1FIZA 3KDGA 2WPIS 1SGCA 1VZQH 1N6DA 5GIBA 1C9PA 1SGFA 3MI4A 3DA9B 2A7HA 1NROH 1SSXA 1TABE 1P2QA 2VINA 3A7ZA 1X5NA 3VXFH 2FP7B 4OS5A 1OP2A 3SNCA 4JOEA 1L0ZA 3UNSA 1CSOE 1Z8IB 3URCA 1TP3A 1PFXC 2AINA 4GCHF 1OYQA 1L4DA 1BQYA 1TNIA 1L4ZA 2EDPA 2AERH 4ZKNU
chains in the Genus database with same CATH topology
1HGTH 4IC5A 1V1TA 1Y5BT 1T4VH 1G3CA 1OBZA 5E6PB 2F9OA 3FZZA 3DJAA 1IQNA 1GJ8B 1AB9B 4NMPA 3RL7A 3TNSA 2G4TA 3FP7E 2BD8A 2ZCHP 1LQEA 5ESTE 2ZI2H 3CS7A 3KHFA 1C9TA 1OWEA 3QTVH 2Z9JA 1P06A 4JZ1A 3DORA 1UEWA 5DO4H 2Y7XA 3TH2H 4NIXA 1PQ7A 2OC1A 4A1XA 1AB9C 2UUYA 3DD2H 2PKSC 1TPSA 1G37A 1GI5A 1WSSH 5FCRA 4Y71A 2F83A 1LKBA 1GBBA 3GDSA 4JOJA 4ZKSU 1TNHA 3W95A 5JBCS 3ATLA 3LGUA 5FB8C 2J2UA 1GM1A 4K2YA 3EA9A 4NIVA 1AKSB 1SQTA 1UK2A 2AWWA 1HAVB 5IL9A 1TBZH 1GBLA 1BTZA 2VGCB 1UTPA 1MKXH 2R0LA 2ASUB 2D8IA 3RLEA 1NFWA 2A5AA 4NFFA 4RN6A 3V7TA 2EI6A 1TB6H 1QL8A 2DE9A 1PPEE 2ZFTA 3BIUH 2VGCC 2EGNA 1I92A 2G52A 1DANH 3SNEA 5HFDA 1PYTC 2SFAA 5EGMA 1THPB 4A6LA 4K8YA 3T28A 2LC6A 3QJNA 1FONA 1CHOG 1O3NA 2ZHEH 2W5EA 1NU9A 1RIWB 3DHKH 3T27A 3S9BA 1RRKA 1SGPE 4MVNA 1LHCH 1O2LA 3UQOA 1O2HA 2BDIA 2BB4A 5B6OA 2VH0A 1MTVA 7LPRA 2EXGA 1L1NA 3SHUA 2AMQA 4BAKB 2PW8H 3W94A 1D6RA 1Y3UA 1W3CA 2G00A 2R4HA 1QB1A 1XM1A 4NMOA 4IMQA 3GABA 3RU4D 4NMRA 1LTOA 3CC0A 3RM2H 3ATIA 2L4SA 1XX9A 1GI9B 1J14A 3O8DA 1TMUH 2VZ5A 5GXPA 1P03A 3GY8A 2OBOA 1NRNH 2VIWA 2Q3GA 3CENA 1S6FA 1BTUA 3WY8A 3SU5A 2Q1JA 1X6DA 3PWCA 1OX1A 1OWIA 1BTWA 1IU0A 1OPHB 2PA1A 3K82A 5A0BA 1QQ4A 1AWHB 4ZHAA 5T3HA 3KZDA 2O8TA 3U9AH 1J9CH 5HGGA 5DPAA 3MYWA 3JXTA 4R0IA 1SVPA 3SQHE 1CA8B 4FUIA 2BD2A 3HKJB 4MLFB 3SN8A 3TNTA 1T4UH 1A0LA 2CHAB 2EHRA 1ELVA 4BNRA 1KXDA 1N6YA 9ESTA 1Y7NA 5JDUB 1DLKB 3A7YA 5K0HA 2CGAA 4ZHMU 3A7VA 1S6HA 1O3PB 1WYKA 1ESBA 1GI8B 1YLCA 3MMGA 3QZRA 4SGAE 4JOPA 3RM0H 3QUMP 1WF8A 1C1TA 1MMJN 2W3KA 5JBTA 3SU2A 2FN5A 1SC8U 4IN2A 1ZTJA 3OTPA 4UD9H 1AZ8A 2DAZA 2R0KA 3ZZ5A 3O5NA 2J92A 1FN8A 3EA7A 1AI8H 1AE5A 3BEIB 3UQVA 1UVOA 3DIWA 2STBE 2ZPQA 2YUYA 1UK3A 1E38B 3TITA 5AFZH 5EOKA 1FAXA 3P8GA 1F0RA 2ZDLA 1YPHE 1NPMA 1V2NT 2I6SA 2I0LA 2OUAA 2AYWA 4KELA 2DJTA 1OXGA 2ZGJA 2FOMB 3B8JA 1BMLA 1QA7A 2OD3B 3RMNH 2QG1A 1JBUH 2M0TA 4UDWH 3FANA 1LMWB 2F0AA 4NA9H 5ILBA 2GZ9A 5E11A 1OS8A 1YP9A 4X2XA 2BD4A 4B2BA 3PO1B 5EG4A 2BXTH 1TMTH 1HJ9A 2P8OB 2W26A 1ARCA 1JWTA 3A8BA 1MKWH 1DITH 3MH4A 3UTUH 1UTJA 5GCHG 5F8TA 1TOCB 2BD9A 2KPLA 1O5GH 1YPHC 3SV7A 2ODYB 4JOKA