1KY9A

Crystal structure of degp (htra)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
343
structure length
311
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE DO
publication title Crystal structure of DegP (HtrA) reveals a new protease-chaperone machine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 311
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ky9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A01
1O3AA 3D65E 3A7TA 2FS8A 1TLDA 1WF8A 1RXPA 1HCGA 3TSWA 1EX3A 1OZIA 1L1GA 2Z9IA 1YPHE 4R2ZA 3OX7U 1O3OA 1HAGE 1KIGH 2W3KA 4REYA 4JOKA 2A5KA 2FTLE 3M5NA 1AVWA 3NXPA 2FTMA 1X45A 1DXPA 2ALVA 2ZC9H 4P2AB 3SGBE 4ZH8A 3QK1A 1O5FH 1ELFA 1ZJKA 2HNTF 4OEPA 2HVXA 3O8CA 2NU4E 1CA0B 1HBTH 2DM8A 8GCHG 3NKKA 2Z3CA 2J4IA 3SGQE 3ATWA 2J92A 2L4SA 3SW2B 3EA9A 4MNWA 1SLXB 1ZMLA 1MQ6A 1WHAA 3UNQA 2ULLA 2YNBA 4K1EA 4E06H 1V6BA 2CSJA 1Y5AT 3JZ1B 5A2PA 4WMFA 2ANMH 4I32A 4CRDA 1KWAA 1DICA 2QKTA 1W3CA 4Y76A 2H2ZA 2PKTA 4BANB 4NMQA 3MNBA 1MFGA 3LU9B 3HGNA 3HGPA 2A45B 2SGDE 5DP6A 4X1PU 2H5DA 2FWWA 2OCSA 4FU8A 1V2RT 4BNRA 1O3DA 4X8TH 1F7ZA 2ZCHP 3QUMP 4XFQA 3GCTF 2ODPA 3MNCA 3GY3A 1CGIE 3FZDA 4X2WA 5HGGA 5C2ZA 2F9PA 4JZDH 2ZZUH 1VITH 1XUGA 1BFEA 1L6OA 2DAZA 3GICB 3LC5A 2M0TA 5FCKA 2Q1JA 1V5LA 1BRBE 4Y79A 1YPGH 1VITG 2WYJA 2DC2A 1BMMH 1RTKA 2EEHA 1OXGA 2D8WA 3KGPA 3LONA 1A5IA 1W10U 2GKVE 5TCAA 3R0HA 5J4SA 1CT0E 1HYLA 2XRCA 3SU1A 3SHAH 2B7DH 3FANA 5I46H 4INLA 1IQMA 3P17H 2X7ZA 2Y7XA 4OGYA 3GY8A 1HPGA 1TIOA 1JRTA 1C2JA 3M3SA 1SSXA 5J4QA 4EDJA 2BM2A 2UUJB 4K8YA 2TGAA 2EDPA 2ZTYA 4X8SH 1Z7KA 4M7GA 1OWKA 1TPAE 1FN8A 1O3BA 1UEQA 4KELA 1GI0A 4UU5A 4JOFA 4KGAA 4D76A 1HUTH 2PW8H 3ZZ3A 1EOJA 4ABIA 1TPOA 1T2MA 3M37A 4IN1A 1YF4A 2VRFA 2EI8A 3M3VA 2WINI 2EEIA 1V6DA 3RL8A 1NRRH 4QT8C 4SGAE 4CREA 1FMGA 1W11U 2MX6A 3MU0A 1UVOA 3HPTB 1T31A 2DMZA 2YOLA 3PYHA 3ZYEA 3KZDA 5GCHF 2OINA 1C5RA 5HF4A 1UK3A 5HEBA 1ZSKA 1VCQA 1D5GA 1A7SA 2GCHG 1LHCH 3MU1A 2BDCA 4D9QA 2TGDA 1MKWH 4NIVA 5DP3A 3P6ZB 1S81A 4MVNA 2GVFA 4BTTB 1AN1E 2QXIA 1P10A 1SGTA 3UOUA 2H6MA 4YLQH 5FXLA 5SGAE 3NWUA 1GQ5A 2W7SA 1BHXF 3MO9A 2ZA5A 1VA8A 1VJ6A 3ZVFA 2VSVA 1GWAA 1RFNA 2BDBA 1CHOG 4K72A 5K0HA 3E8LA 1BHXB 5F8TA 3ATLA 4UFEH 2BD7A 4BTIB 3PO1C 4X6OA 4X6MA 1IQEA 4ISNA 1YC0A 1YP9A 3E90B 5JB8S 2J9NA 3MHWU 3SV9A 2PSYA 1IHSH 4FU7A 3EGGC 1JMOH 3UREA 1UJ1A 3E1XB 3RU4T 2M10A 1ELBA 1H8IH 2FOGA 2BTCE 4Z0KA 1XKBC 1OS8A 3KQDA 1UVTH 5T6FA 3ZV8A 4AX9H 1C1PA 1QRZA 1L0ZA 1GI4A 4JOJA 1ANDA 1SQTA 1UK2A 3A7VA 4Y8XA 3L6PA 3URDA 2F9NA 2CHAC 2QAAA 5GIBA 3D49H 5EQSA 2GP9B 1P2OA 1J17T 2SNWA 3K9XB 3GY4A 4KTUA 4GHQA 1S0QA 5C20A 4NZQA 1CO7E 1KYNA 4ZHLU 1QR3E 1C1TA 2OS6A 1QJ1B 1WQVH 1A0HB 3WKMA 4TPYA 2GMTB 1XUFA 1G2LA 1G9OA 2PZDA 1QNJA 1F92A 2OC0A 2QKVA 3ATMA 1TX6A 1F5LA 2WPHS 1BITA 1O2XA 4AGKA 4BXSA 2SGAA 1TP5A 3VGCB 3DJ1A 2YT7A 1AD8H 1O2UA 3S7HB 1AQ7A 3U69H 2QKUA 3BEUA 4CRGA 3MU5A 4E35A 5E1YA 4FGMA 2LA8A 1EPTB 2QT5A 2A5AA 2PSXA 2FMJA 1N7TA 4KFVA 2BDIA 3LGUA 1GPZA 4H6TA 2A4RA 5FHTA 4GPGA 2P8OB 1IQFA 4AB9A 1ANBA 1TWXB 2A5IA 2NWNA 4LZ1H 1NRQH 1O35A 1F0TA 4X1QU 3SBKA 1GI2A 3NUMA 4CRAA 1A5HA 1GBMA 1G3CA 1AZ8A 1Y3UA 1YGCH 1P9SA 2G5NA 3QDZB 1N8OB 1C2LA 2XYAA 1AUTC 1MZDA 5HFEA 4TY6A 3SUFA 3FP8E 4H42U 1FC9A 3P8FA 2KBSA 2G2LA 3ATKA 1Q3PA 2IWPA 2KJDA 2YUBA 2O8WA 1ARBA 3TGJE 2R4HA 3BIUH 4ZAEA 1GHXH 2O8LA 1HAZB 4DVAU 3SOEA 4YT6H 5JB9S 3DIWA 2BXUH 1WG6A 4NNMA 3F68H 1O31A 3CBZA 1ESBA 3RDZA 2ZF0H 2XW9A 1DLEA 5DP9A 3TPIZ 2HE2A 5HM9A 2GV6A 4CR5A 3NCLA 5TCCA 1MTSA 1B0EA 3U8TH 1P0SH 2PTNA 1EZSC 2BZ6H 2AGEX 4J2YB 4Z33A 2W7RA 1OWHA 1U6QA 1S5SA 2VU8E 3O8RA 2GCTC 3K65B 1QB6A 1GI5A 4A1VA 2WUCA 3FP6E 1P02A 4R8TB 1XZ9A 1MTUA 3U9AH 2O2TA 4K75A 4JOGA 2W7UA 3RXTA 1PJPA 3QIKA 4B2AA 2VVUA 3I29A 2ZQ1A 3NGHA 1BBRE 1TA6A 2YNAA 2IWOA 3SJIA 3TITA 5EU8A 1CT4E 2EAQA 1IQJA 3N7OA 1TNLA 2RCEA 1XKAC 2BLOA 3Q3XA 2F3CE 2ZFPH 3HKIB 1WYKA 4IMQA 1HJ8A 2A2XH 2JETB 4O3UA 3ZZ9A 1TBRH 1DANH 4ABJA 1EZUC 1QL8A 1Z6EA 1GI3A 3SV8A 2OZFA 3UIRA 2TRMA 4ZKRU 4CR9A 4HGCA 4Y6DA 3AVZA 1WJLA 1ZLRA 3ZVGA 5DO4H 1V2JT 1EJNA 2FOAA 2SGFE 3PMHB 4NWKA 3M3TA 1OPHB 1Y5BT 4X1NU 1LVBA 1XM1A 2CXVA 5E6PB 2QF3A 4YO9A 1Z87A 5FPYA 2NU3E 2ZNKH 1UTKA 2GGVB 1K1LA 4WYTA 1EOLA 1JWTA 2AH4X 3PMAB 1V2KT 1MKXH 4AZ2B 3RLEA 2OC7A 2P16A 4UFGH 5EOKA 1BE9A 3Q00A 4MPVA 3CS0A 1QA0A 1MTNB 1QBNA 2V35A 3MO6A 1O2ZA 5I7ZA 2XCFA 5DTHA 3P8OA 4NMSA 3S7KB 2QBWA 1Z8GA 2FN5A 1EB2A 1OX1A 3BG8A 4XDEA 2Y7ZA 3SU4A 1AO5A 2OLGA 2ZKSA 2EGKA 3RXAA 1GJAB 1ELGA 2OCVB 3RXGA 3CH8A 4H11A 4ZKOU 1RRKA 2BDYA 2FOBA 4SGBE 1BTYA 5JYIA 1CA8B 1LQEA 3KHFA 6LPRA 1J15A 3HPKA 3KNXA 1ZJDA 1RTFB 1GHBF 3RXRA 2H1UA 1X5NA 4JOEA 3LGWA 5K7RA 1V2ST 2VGCB 2P59A 1Q2WA 1Y3VA 4NIWA 3R3GB 3QLPH 1RD3B 4NIXA 2G55A 3M61U 2Z9JA 2W26A 3VB7A 2ZG0H 2EGNA 3T29A 1KDQB 3T62A 1K1NA 4B2BA 1PDRA 2UUKB 3P8GA 1P9UA 2Y5GA 4LXBH 1O2WA 5LPFA 2ZFSA 4INKA 2EI6A 3SJOA 1K1PA 1ZOMA 4HFPB 4X0WU 2D92A 1UCYH 4K1TA 3CBYA 1G36A 1FPCH 1GI1A 4K6YA 1E0FD 1P3CA 1EJAA 1NFYA 6ESTA 2BVSH 3RMNH 1GGDB 1O5GH 2WUBA 4AB8A 4DG4A 1OP0A 2THFB 4X1SU 4MDSA 4Y0YE 2HPQH 3E0PB 2IOTA 3GCHB 3SN8A 3T25A 1GL1A 5FBIA 4WJG2 3MMGA 4H4FA 1PPFE 1O2YA 1P03A 1SQAA 1HDTH 1ID5H 2TGTA 1TABE 1TRYA 1GBDA 1YYY1 2L4TA 3UR9A 1MU6B 4P0CA 5EYZA 3PROA 1MKWK 1VJAU 4WXIA 7GCHF 2ZEBA 3QGLA 5C5NA 4UEHH 5AFZH 1VZQH 4GAWA 3BTQE 1ELEE 1PPCE 2B0FA 4CH8B 1MD8A 1IU0A 3V7TA 1HAVA 3SHUA 3HVQC 4A1XA 1A46H 2ZTXA 3LGIA 1BA8B 4Q2KA 3NZIA 1Y5UT 2FI3E 4VGCC 5F67A 1C4Y2 1HIAB 1HJAC 1TGCA 1G9IE 1O36A 1O33A 1D6WA 2K1ZA 3HKJB 1SLVB 1W9QA 2QN5T 2B8OH 2WL7A 2I6VA 1UTQA 4OS4A 1NFWA 3LJOA 3SUEA 3SNEA 2DLUA 4NFFA 1QURH 2AGIX 5A0CA 1TGSZ 2G81E 5GXPA 1MCVA 1IHJA 1T8OA 3A8CA 3RC5A 2FOMB 5BRRE 1P06A 4E34A 4O97A 3QJMA 2ZWLH 3BPUA 5E11A 1HFDA 1TALA 4WH8A 3TH2H 3GCHC 1TOMH 2P3FH 4BTUB 1RY4A 1NC6A 1KLTA 1N1LA 4I31A 3E16B 5HXFA 2OC8A 1NY22 1BTZA 2M3MA 2AGGX 8GCHF 2XBVA 2QXGA 3TH4H 1UJDA 4ABFA 1SGIB 1BJVA 3LH3A 1GMCG 2QF0A 1HAPH 2OBOA 1LO6A 1NPMA 2J2UA 2Z94A 4TWWA 3UUZA 1GMDG 1UEZA 1F5KU 5H4IB 2P93A 1C5UA 2FEQH 4YDPA 1DWDH 3RMMH 2A7CA 8ESTE 2H2CA 3DJAA 1T4VH 1GHVH 4GVDA 1ZSJA 2OUAA 3KQEA 1AB9C 4NMPA 3F9GA 4WMEA 1ZMJA 1SG8B 4UFDH 4ZXXH 4F8KA 5HFBA 3OY5U 1MTVA 1P2KA 4FUBA 5HEYA 3S9CA 2VVVA 3LGVA 2I0LA 2FS9A 3M7TA 2EEJA 3CC0A 2ALPA 4MNYA 3SJKA 5F6MA 2G00A 2UWOA 1Z71A 1TNJA 3RC4A 2PWXA 2HRVA 1QQUA 4LOYH 1EP6A 2A7JA 1SQOA 4I33A 5C1UA 3PDZA 2BB4A 4K60A 1XXFA 1TNKA 1C1MA 3VXFH 2ZCLP 2OSGA 3KZEA 1SR5C 4Q7YA 2R0LA 3ODDA 2CS5A 3TNSA 3L33A 5L2ZH 2D90A 4AYYB 3TK5A 5A8ZA 1DUAA 3ZZ8A 1GJ4H 1WCZA 2Y6TA 4I8JA 4B2CA 2G5MB 2ZFTA 2AWUA 4XSKU 1GMHG 2FM2A 3RXQA 1Z8RA 3BTME 4ISLA 1C2HA 3E17A 2VIQA 3ESTA 2BZAA 3PMJA 2H9TH 2JREA 1K32A 1N6FA 1OYQA 1P09A 2PKAB 3EYDA 5CE1A 2R9PA 3SV7A 2KAIB 4Y0ZE 1VGCC 3U8OH 1FV9A 1DY9A 1QGFA 1THSH 2FLBH 2QGRA 2QG1A 3RLWH 7ESTE 3BTKE 3OSYA 1CBWC 1TE0A 4ABBA 2D8IA 3EQ0H 1PPBH 1ZHRA 3HPMA 3UOPA 2UZCA 2OBQA 2A2QH 2KPKA 1IAUA 3V3MA 4D9RA 1JIRA 4YOGA 1QAUA 2HPPH 2VPHA 1ZPZA 3UQVA 3TJUA 4FUHA 1FC7A 2REYA 1Q3XA 3GY2A 1TBQH 1AWFH 1TGNA 1NT1A 1ARCA 1XVOA 9LPRA 2OP9A 3AXAA 3TGIE 4OS7A 1GI7B 2LC6A 5E22A 2V3OH 1GHAG 2ZO3H 4ESTE 3M35A 1GJ7B 2W4FA 7KMEH 3T28A 2KRGA 1AVGH 1O2HA 1ZGIA 3LIWA 1C5ZB 1C1SA 1O3MA 4U32A 1FC6A 3M5LA 1BTPA 2ZPSA 2GCHF 3SNCA 5GPIB 2PR3A 1P2JA 1SL3A 1C5YB 4IW4E 1HXFH 1P05A 3LH1A 1AKSA 2HE4A 1TOCB 7LPRA 3CYYA 2D2DA 2BD4A 4DURA 1PPHE 1LHGH 2O8MA 4NCYA 1ABIH 1O2LA 1AY6H 4ZXYH 1LPGB 1C5TA 3DFJA 1YPMH 1O32A 1ZTJA 2V6NA 3A87A 4IS5A 4JCNA 1GBTA 1CHGA 1C1RA 1FONA 1O5BB 1UHBA 2TIOA 5DJ7A 5EG4A 3RXMA 4ABEA 2FDAA 2FI4E 1C2IA 5E2OA 3I18A 3P70B 1XMNB 5DGJA 1CA0C 2HNTC 5EZ0A 1ABJH 4ISOA 2G5VA 1GBCA 4IC6A 1AE5A 1XXDA 1J14A 1THPB 1YBWA 2BVRH 1AHTH 4AGJA 5I25A 1O2JA 1EUFA 2PKUA 1O0DH 3M7UA 2G51A 3RC6A 1UTPA 2XWBI 2FOHA 2PNTA 3GCOA 3ZVEA 1IQLA 2JH0D 1G3DA 2G52A 3F9HA 3P8NA 3QDOA 3PWBA 4Y7BA 1C1VH 1W2KH 1LVOA 4MG3A 1A2CH 4Q2NA 1BMLA 1ACBE 2ZPMA 1PQ5A 4DY7B 3RXHA 2DB5A 1O2VA 1FY8E 2AERH 4B74A 3T5FH 1O5CB 1MCTA 3OTJE 1WQSA 1QAVB 5DP4A 1Y3YA 5F8XA 2RA3A 3STJA 1C5LH 1WU1A 5LGOA 1ORFA 2R2WU 3T26A 1U37A 2EHRA 4RSPA 1KXEA 1CGHA 2EEKA 2I6SA 1C1WH 1ETSH 3AAVA 4JYTA 2Z17A 2CF9H 1GVKB 1OP8A 1SFIA 1EB1H 1TNHA 4NNLA 5G4BA 1O3CA 5L30H 1INCA 1OWIA 3VFEA 1EZXC 1Y3WA 4HZHA 1H4WA 3AW1A 3SHWA 1HAOH 4GHNA 3EDXB 2AWXA 4HOPB 1RS0A 3R69A 4DOQA 2FZZA 3EGHC 4E7NA 1TQ7B 1UEWA 3ZZ4A 4JOHA 3TSVA 1TQ0B 1KEFA 2DJTA 4IBLH 1GM1A 3WY8A 4BAKB 4NIYA 4UDWH 4TWYA 1ZUBA 3RL7A 2ZPRA 1CQQA 3GCTG 3T27A 2V3HH 3SJ9A 1QLCA 2I4SA 3A81A 1DLKB 3SGAE 3SUDA 2RA0A 3GYMA 1DXWA 1TB6H 2D26C 3ZZDA 1MH0A 4JL7A 1YM0A 3ID4A 1BCUH 3RXKA 3ODFA 4NXPA 1KXDA 1YPHC 2BLWA 5JBAS 2WPIS 6CHAB 2R0KA 1LHEH 1V2OT 1MAYA 4K8BA 1GJ6A 2F9UA 2OPGA 1SGDE 1R6JA 3JXTA 1AU8A 1SGYE 3MH4A 1ZYOA 3HK3B 4A6LA 1C2FA 2XC4A 2KL1A 1XUKA 4FUJA 3IWMA 4AG2A 4NWLA 2SNVA 1TGTA 4CHAB 2P3WA 3RXFA 3F6UH 2BYAX 4X6PA 5IYTA 2ZP0H 4X1RU 5A0AE 1IHTH 2EC9H 2AYWA 4NMOA 1TYNA 2ZU3A 4NXQA 1DITH 2BY5X 3U8RH 1Z8JB 1IQGA 3PV4A 1DX5M 1TGBA 1V2VT 3AAUA 5HF1A 2MHOA 4I8GA 1BBRK 1C5OH 3JZ2B 4WH6A 2FO9A 1ELDE 1UCYE 4UU6A 3GY6A 2RDLA 1FAKH 2GDEH 1C5VA 2VIWA 2WPJS 4Y7AA 1BTXA 4BAMB 1GJ8B 2IJOB 5C1XA 3UR6A 1LMWB 5ETXA 3S0NA 2Y82A 1SOTA 4UFFH 5GCHG 3ZYDA 2KOMA 1S82A 1C5PA 1ELVA 1MMJN 1C5MD 5FAHA 2IPHA 2R2MB 2PUXB 5C5OA 4UONA 6GCHF 1O30A 1OYTH 3RXPA 1BRAA 2FODA 5E0HA 3UWJH 3PLBA 1O5EH 1PQAA 4DIHH 1O2GH 4A1TA 3PV2A 4A7IB 4YOIA 4WYUA 1F2SE 4OS5A 2H9HA 2Y5FA 3MOCA 3TJNA 1EAWA 3DUXH 4CBNA 3BN9A 3WKLA 3BTFE 1QRWA 1SGFA 2CGAA 4NMTA 4D7GA 4WXVA 1ZTLA 3OY6U 1DVAH 2AEIH 2GMTC 3RXCA 2KAWA 4FU9A 1DE7H 2EDZA 5BPEA 2ANWA 1TA2A 3S69A 1V2LT 3L3TA 3VGCC 1MZAA 1GHWH 1FY3A 2BD9A 2Y5HA 3BEFB 1T8LA 1W9EA 2FESH 4ZKSU 1BDAA 5HFCA 4OAJA 1EPTC 1QB9A 1S84A 4CRFA 3PLKA 2TPIZ 1N6DA 1WUNH 4MPUA 2BY6X 5FCRA 1MD7A 2P8OC 3FVFB 1YCPH 4IMZA 3S9AA 4OS1A 2F5YA 1A3BH 2G8TA 1SMFE 3GY7A 1XX9A 1BQYA 1O3NA 1QHRB 1T7CA 3TSZA 5HFDA 1P2QA 2ZIQH 3SV2H 1ZSLA 3W94A 2NU1E 1N8OC 5DPAA 2ENOA 4THNH 1G2MA 3P92A 3RXJA 4BAHB 1QQ4A 3SORA 2GTBA 4U30A 4FVBA 1O34A 1PQ8A 3VB5A 5ESTE 4FUEA 4Z6AH 1W14U 2QYIA 1BRUP 4RKOB 1GBEA 1GL0E 1GCDA 2QIQA 2VNTA 3ZZAA 4NGAH 2LC7A 1SHYA 1C1QA 2A0QB 1DOJA 2QCYA 3VB6A 2F9BH 1MQ5A 5FX5A 2K1QA 1QTFA 2GV7A 4HI3A 8KME2 3K1RA 1BTWA 1WSSH 1ZHPA 3ZVBA 1AI8H 1A1RA 1DWEH 1O3EA 3FP7E 1PFXC 2B5TB 4GCHF 4PQWA 1MBMA 1SOZA 1S6FA 4I7YH 2BYGA 1TMBH 1WAYB 2J94A 2Q3GA 2FX4A 3L4FD 1HV7A 1XUIA 2CN0H 3GISB 2YT8A 1C4U2 2GT7A 2ZHQH 3ZVDA 1OWDA 3OYPA 1FPHH 3E0NB 3MWIU 4D8NA 2EJYA 1UJVA 4NSVA 3O5NA 4OGXA 4U01A 2BQ6B 2SGEE 5DK1A 1SC8U 4X2XA 4TYDA 3HK6B 1BB0B 5AF9H 1AGJA 1SBWA 5A8YA 2KYLA 2GZ9A 4OS6A 2B9LA 5JDUB 3E91A 1D3QB 3CP7A 1UJUA 4OEOA 1O3IA 2STAE 2JETC 1LPZB 2ZU4A 3E3TA 1BUIA 1RGQA 2PUQH 2A1DB 1DPOA 3A80A 4NA9H 2KJKA 1P04A 5HDYA 1NN6A 1LKBA 2A4OA 4AOQA 1BRCE 1YPJH 4JYVH 3O8BA 1MFLA 2LOBA 2RRMA 3SV6A 4YYXA 2BY9X 1S85A 1MU8B 1WI4A 1FZZA 4O9VA 2QXJA 1PYTC 2GZ8A 1M9UA 2H9EH 1O3GA 2BDAA 2E7KA 5CHAB 2ASUB 4B73A 3K50A 2VIDA 1MTNC 5LPEA 1QY6A 1C2DA 1EJMA 1NROH 2AIQA 5A2MH 5H3JA 1NO9H 3NPSA 2JINA 1O39A 1A3EH 1W0ZU 3ZV9A 1GI9B 1TRNA 4MQAA 2UUFB 3A85A 3BEIB 3QWCH 1EAXA 1GVLA 1L2EA 5FPTA 1IQKA 3ZZCA 1RGRA 4Y11E 4ZROA 1GHZA 1VCPA 1ZHMA 5A09A 2L97A 2FP7B 1P2IA 1C5WB 3UFAA 3R68A 2CF8H 4JZFH 5DP8A 3QO6A 3F9FA 1LHFH 1QL9A 3V12A 1OOKB 1O3FA 2ESTE 3GDSA 1O2TA 2XBWA 1OBXA 1EAUA 3K6ZA 3IITA 3Q77A 3RXDA 3S9BA 2ZGJA 5LPRA 3TU7H 1C2MA 2OQSA 1TONA 1TPPA 2OC1A 2SGQE 3A83A 2AMDA 1O2MA 3MH5A 2FNEA 2VGCC 2Q9VA 2XXLA 2BX4A 2BOHB 3RXLA 4AG1A 2VWOA 1GI8B 4XE4A 1E34B 2Z9LA 1KXAA 1WHDA 4H6SB 4L8NA 3ZRTA 3A89A 2F9VA 4MPAA 4G69A 3HATH 1OBZA 4IC5A 1UTNA 2VIVA 4DIIH 1L1JA 3GJ9A 1FY5A 3A8AA 4Y8YA 1V2PT 1NM6A 3SU6A 1TPSA 4RN6A 1MBQA 1O37A 1GG6B 4DGJA 1O2NA 5EPNA 1HJ9A 4MNXA 1UM7A 2LUIA 1GMHF 1UTOA 1KSNA 1YLCA 4IGDA 5JPMH 4DW2U 3GOVB 1EASA 4GVUA 2ZU1A 3KHVA 1UF1A 3QTVH 4Y71A 1GHBG 2AINA 1UTJA 3PB1E 4RKJB 4AN7A 2LPRA 1IQIA 1GGDC 2HOBA 4Q80A 2Z6BD 3O8DA 3CENA 2G4UA 2UWPA 3BG4B 1M5ZA 1P12E 2QXHA 1MUEB 2ZDAH 3A7ZA 1OKXA 1RJXB 1WTHD 2KPLA 2BD2A 2DE8A 2F9OA 2HNTE 3BIVH 1S6HA 4PROA 3M5OA 5G1DA 2IN2A 2OTVA 1ZTKA 1GI6A 1NU7B 3DFLA 3Q76A 1GCTB 5T6DA 4DCDA 4JYUH 2M0VA 1E36B 1L4ZA 1JOUB 3TK6A 1UMAH 4CBOA 4AMHA 4UE7H 1WF7A 4XHVA 1VB7A 2VB0A 4GSOA 3OTPA 1HRTH 1O2RA 5EXMA 2Y80A 1EPTA 1EAIA 4JORA 5AVDA 2ZPQA 1KY9A 4TY7A 2ZHWH 3MFJA 4YLUA 1V2MT 1DM4B 2ZDKA 1O38A 1O2PA 5DG6A 2FYRA 4FUDA 3LJJA 3ZZ5A 2Z7FE 4X6NA 2ZI2H 3RUOA 2I1NA 1LVMA 1K22H 5GJ4B 2ZPLA 1DSUA 3EGKH 5F8ZA 2WV4A 3LDXH 3ZVCA 1D3PB 1AUJA 4ISIH 1C4V2 2K20A 1DY8A 2AMPA 2SGPE 3U1JB 2DKRA 1I92A 3PS4A 1YLDA 5HYOA 3NFLA 3MTYA 1GBIA 3BTDE 1N6YA 2JIKA 2J38A 2JOAA 3GDUA 3MYWA 1K1JA 2V90A 1I16A 1X6DA 1X5RA 4CH2B 2P94A 1GHYH 3GSLA 1VITF 1MTWA 1Z6JH 4LZ4B 1V1TA 1BZXE 1PPGE 2FI5E 4BAQB 2ZU2A 3SQHE 5E21A 1RIWB 4FUIA 5EQRA 1QBVH 4BXWA 5EXNA 3RXUA 1RTLA 1LQDB 3QN7A 5E0JA 4J1YA 4E05H 1O2QA 1QA7A 1N99A 5L6NH 3M7QA 1C2GA 1UHPA 3I4WA 1ELCA 1W7XH 2BX3A 1WH1A 2XC0A 2GD4B 3EE0B 4K2YA 1HNEE 3K6YA 2BOKA 3EA7A 3UTUH 3FFGA 1PPZA 4XOJA 3TIUA 1RZXA 1WIFA 2FPZA 3RXOA 1HLTH 1XUJA 3SOSA 3SNAA 2BXTH 3R0FA 2CSSA 5L2YH 1O2OA 1B8QA 3LT3A 2GT8A 1ESAA 2QA9E 1E37B 4MNVA 1G3EA 3PTNA 2W3IA 2FIRH 1WV7H 1VCWA 4Q2QA 3SU2A 1WTGH 1YCPK 4Y8ZA 3RXBA 1A5GH 1O2IA 1AVXA 1LVYA 3NK8A 1O2SA 4OS2A 3ZZ6A 1B7XB 2WPKS 1AFQB 5EW2H 1DDJA 3BTGE 3LOXA 1S83A 2HGAA 1P8VC 1PQ7A 2VWMA 3KF2A 4K78A 1SLUB 5JBTA 1GJCB 2EGOA 4K3JA 5B6OA 1AZZA 2VIPA 2ZFQH 1FI8A 1T8MA 2ZCKP 1OBYA 1RIWC 3U98H 2CMYA 1WI2A 2C8YB 1O3KA 3VXEH 2SFAA 2CJIA 1JIMA 3Q3YA 1Y3XA 2F83A 4K1SA 1QJ7B 4AFZA 1CHOF 1FIZA 1S0RA 4KTSA 1U38A 1MKXK 3QTOH 1E35B 1SGNE 2EXGA 1MC7A 1GVZA 5AFYH 5FPSA 1SGFG 1CGJE 2BQWB 1P1EA 1T32A 1V2WT 4YM9A 5B6LA 1W0YH 1UM1A 2HALA 1GJBB 3KIDU 1UTMA 2H2BA 1G37A 3MU8A 1C5SA 1HAHH 5C1YA 2ZTZA 1C9TA 1AFEH 3IG6B 2F91A 1WOFA 4GUXA 4DJZB 1GQ4A 1TMUH 4A5TS 2XBXA 3PLPA 4JZEH 2Q6DA 4MTBA 3A8BA 4JK6A 2QV1A 4MLFB 1AFQC 3DT0H 3LNYA 2QY0B 4INHA 4WF8A 3W95A 1P01A 1KDQA 2XNIA 3SZNA 4E7RG 1AWHB 3RMOH 5HJ1A 1QJ6B 3CBXA 1HB0B 1TNIA 3PO1B 4ZHAA 1WFGA 4FUFA 1FDPA 1JXPA 2ZECA 2FOFA 3QX5H 5AHGH 5ESBA 1XUHA 2EA3A 3MNSA 2C93B 5DKMA 1NS3A 2FOEA 3TK9A 3A7YA 4Q6HA 1K1OA 1T8NA 3A84A 1EZQA 1THRH 3KQCA 1W8BH 5D13A 1P2MA 1V2NT 2PGBB 2BDGA 1UCYK 1NRNH 4D7FA 1KTSB 2H3LA 3B9FH 4LK4A 4BOHA 1OWEA 2VSPA 2GDDA 3QJNA 2CHAB 4NZLA 4AFQA 4YESB 1IOEA 3SU5A 2VZ5A 3B76A 3ID1A 1LPKB 1EXFA 1ZR0A 2I0IA 3TLOA 4CRCA 2ZDVH 5EXLA 2P3TB 1O5DH 2BY7X 1LTOA 2C3SA 4KP0A 3GYLB 1N7FA 5E2PA 2BLVA 4JK5A 5FX6A 4FVDA 1NTEA 2VWNA 3D23A 4ASHA 2BD5A 1KLJH 5HFFA 2PV9B 1QIXB 3UPEA 3TH3H 2WYGA 4X2YA 3BTHE 4Q6SA 4XBCA 1HIAA 4WVPE 1TFXA 8LPRA 1KTTB 4B75A 1HAVB 2TGPZ 1UK4A 2Z9GA 2H3MA 3KEEA 1OWJA 1ZGVA 1ANCA 1V3XA 4HTCH 4X8VH 2ZHDA 2ZDNA 3MO3A 1C2EA 3ZZBA 3SQEE 2AFQB 2C90B 2OGPA 1MAXA 3V0XA 3ATIA 2P95A 2FX6A 3BF6H 2WPLS 3PMBB 1AE8H 3BTWE 2EDVA 4Z8JA 1OSSA 2M0ZA 5JXBA 1G3BA 2O9QA 3GDVA 2KQFA 2XBYA 1KXBA 4NXRA 1C5QA 2VIOA 3PV5A 2KV8A 1C5NH 2KA9A 1ZMNA 2BY8X 2VWLA 3A7XA 3U1IB 4JZIA 5HEDA 5CMXH 3TVJB 1Z1JA 3NFKA 1E38B 3H5CB 1HXEH 1GBAA 3UWIA 3ZVAA 2A7HA 3RLYH 1C1OA 3STIA 1ZPCA 1C1UH 2M5TA 5C3NA 2QC2A 4ISHH 3A82A 4YTAA 3TGKE 3SI4H 5T3HA 2KOJA 1ZRKA 2DLSA 1O3LA 2PA1A 2EV8A 5GDSH 1HGTH 1HAXB 4X2VA 1K9OE 2HWLB 4YOJA 2AIPA 1TQ3A 1UVUH 2H5CA 2NU0E 4MPXA 2PTCE 2Q6GA 3SHCH 1V2QT 2HGTH 4ABHA 4WWYA 1QBOA 1YPKH 1EATA 2GCTB 2ANKH 1BMNH 1SI5H 6CHAC 2I6QA 1O3JA 3TNTA 1BTHH 2F0AA 4GLYA 5HETA 2ZHFH 1IU2A 2BVXH 4I8HA 5EW1H 3FY5A 2ODYB 2YUYA 3ELAH 1SB1H 4FXGH 4JMYA 3RU4E 2M0UA 2R3UA 3SFJA 2G4TA 5T6GA 2JXOA 3MI4A 5E0GA 4JOPA 1BIOA 2O8UA 3SUZA 2J34A 3PWCA 1ZZZA 2LNCA 3DA9B 5C67A 3LNXA 5GWZA 1GBBA 4CHAC 3QGJA 1RGWA 3PDVA 3SNBA 1ELAA 1CVWH 2FOCA 2WV5A 2Q6FA 3O46A 1ZRBA 3VEQB 3K82A 2GZVA 1NESE 5FB8C 3M36A 1K1IA 2ZGHA 1TAWA 1GBKA 2UUYA 2C8ZB 2DE9A 3SO3A 1K21H 9ESTA 2JILA 1DWBH 1LCYA 1ELTA 1U39A 2RG3A 2ZDMA 4WY3A 1CT2E 2CV3A 1GBJA 2WPMS 1C1NA 2BD3A 1FY4A 1F0SA 1YPEH 2FCFA 1O3PB 3TJVA 5ABWA 2PKAA 3LKWA 2JH6D 3SU0A 4DT7B 1GDQA 2A32A 2KAIA 1W7GH 1UITA 4K76A 3LC3A 3PM3A 2A4QA 2JKHA 4FUCA 2DUCA 2XWAA 1X7AC 3DORA 1QRXA 1QB1A 1P1DA 2XCNA 3DJ3A 1Q31A 3RMLH 2V0BA 3T2NA 4Q7XA 3GY5A 4F49A 5A8XA 4I8LA 1W9OA 1KXCA 1LHDH 1SGQE 1H8DH 3BSQA 3VB4A 4ABDA 1K1MA 2XTTB 5JBBS 4NFEA 3BTEE 1K28D 3EAJA 1BJUA 2D1JA 4NMVA 3QZQA 3VB3A 4NA7A 1VJ9U 1Z86A 4Q7ZA 2ZFRH 4CRBA 1DFPA 2OD3B 3Q3KA 1W13U 3TMHA 1L4DA 1HAIH 1F0RA 1K2I1 1J16A 5EPYA 2ILNA 1CE5A 2HLCA 1A0LA 4K5ZA 3RXSA 4R0IA 4Y10E 1Q3OA 3ENSB 3SI3H 2VJ1A 1J9CH 1ESTA 4ZHMU 2ZQ2A 1DS2E 4O3TA 1TP3A 1O3HA 1GBHA 1D9IA 1DT2A 1TX7A 2NU2E 2GZ7A 3CS7A 3KN2A 2TBSA 4YZUA 3P95A 3OU0A 4B76A 6GCHG 1AKSB 2BLQA 1DUEA 4ABGA 5TJXA 4JZ1A 1FN6A 2PHBA 1X8SA 1GJ9B 2C8WB 2BQ7B 5GNDA 2UWLA 5HMAA 2EI7A 3G01A 3H7TA 4E3BA 1Z1IA 1NZQH 2KG2A 2JH5D 4N6XA 1FCFA 1VAEA 1G32B 1N6EA 3BV9B 1UHBB 1FLEE 1N6XA 1FNIA 3MNXA 1SGRE 3KL6A 1GJ5H 4B71A 1NFUA 2ZGCA 5F03A 1CU1A 1XVMA 1BTUA 1B5GH 2IWNA 4O03A 1H1BA 2OQUA 3A86A 3RXEA 2PLXA 4O06A 3LGYA 3SU3A 2Z9KA 1TMTH 3QGNB 1D6RA 4Q2PA 2KJPA 3A8DA 1YPLH 3RXIA 1H9IE 1W12U 1P2NA 2VVCA 4YT7H 3RXVA 1BMAA 1SGEE 1LKAA 1NTPA 1EKBB 1D4PB 1P3EA 1Y7NA 2AMQA 1VR1H 3C27B 1YKTA 1P11E 1NF3C 1QAVA 1PYTD 2GX4A 1SLWB 1T4UH 1LDTT 2C8XB 4NA8A 4VGCB 1FAXA 2BMGB 3A88A 4WMDA 1JRSA 1HJAB 3A7WA 1BOQA 1J8AA 1ANEA 4ZMAH 3DD2H 1GDNA 4KTCA 3RU4D 2C4FH 1GMCF 1TNGA 3FAOA 1B0FA 3I77A 2FE5A 3QE1A 1G30B 1P57B 1BT7A 1TX8A 1GMDF 3RM0H 1IQNA 1EQ9A 1QL7A 2XC5A 2VH0A 5EODA 3ZZ7A 3LPRA 2Y81A 2VINA 2Z3EA 5FBEA 3M5MA 1FQ3A 3MH6A 1GBFA 4HOPA 1F0UA 4RI0A 1Y59T 4XBDA 5IDKA 4U2WA 3EA8A 4KKDA 1X5QA 1D3TB 2EEGA 3UNRA 1H9HE 4AFUA 1Q7XA 2PKSB 5JBCS 1NRPH 4GCHG 1FY1A 2AS9A 5EQQA 2I04A 5LH8A 1TRMA 1HAYB 3GCNA 2Z3DA 3V13A 1AIXH 1V2TT 4TPIZ 2STBE 3TJOA 2ZGXH 1V2UT 5GLJA 3RM2H 1SGCA 1UFXA 1YCPM 1CSOE 2ZHEH 2A31A 2FXRA 2VH6A 2BD8A 4LMMA 1GJDB 2VWRA 1H9LB 3QZRA 3VQGA 1FUJA 4B1TA 5CHAC 2BHGA 1C9PA 3FZZA 4A92A 2O8TA 4MPWA 4NSYA 2W5EA 1AB9B 3SJ8A 1EP5A 3I1EA 1SPJA 4AFSA 3ID2A 2PFEA 2RCZA 2A4GA 1FXYA 2ZGBH 1DSTA 3ITIA 2ZDLA 2ZFFH 5DP7A 3KQBA 1A0JA 1A4WH 4BAOB 1Y8TA 5A0BA 3URCA 1DWCH 1TBZH 4UD9H 1O2KA 2J95A 1UVSH 4KFWA 1WBGB 2ANYA 5EGMA 4Q2OA 1SGPE 1ETTH 4NG9H 2OQ5A 1YBOA 1BBRH 3KCGH 3PTBA 1U3BA 1PPEE 3B23B 3D62A 5HM2A 5G1EA 1C5XB 4XBBA 5E8EH 3ID3A 1GBLA 1QCPA 3H7OA 5DP5A 5F3XA 2PKSC 1GHAF 3UY9A 2FYQA 1JBUH 4AORA 1V62A 1D3DB 1Z8IB 1IQHA 3LGTA 3SUGA 1FJSA 1UVPA 1ZPBA 1QFKH 3GGEA 4ZUHA 1KLIH 1KXFA 1VGCB 2V1WA 3UNSA 3VQFA 2JWEA 1SFQB 1O5AB 3RP2A 1GG6C 2YTWA 2KOHA 1CBWB 1NU9A 2ZU5A 3I78A 3E6PH 1ETRH 2OMJA 4ABAA 1AMHA 1ZOKA 1UO6A 1SVPA 3VPKA 4ZKNU 4I8KA 4Q3HA 3C1KA 2IWQA 3MH7A 3SNDA 4FUGA 1V5QA 3B8JA 5PTPA 7GCHG 1A61H 2BDHA 3BG4C 1F5RA 3AASA 2ODQA 1GDUA 3F1SB 4X8UH 1UEPA 1SHHB 4GHTA 2PDZA 1C2KA 3K2UA 2PGQB 1NRSH 3MU4A 1N7EA 2OXSA 2R3YA 4F4OC 1NFXA 1GCTC 1FIWA 1OP2A 3DHKH 3BTTE 2AWWA 2FLRH 4NMRA 3F9EA 4AYVB 4IN2A 1UTLM 3UQOA 4GVCA 3AW0A 2P3UB 1L1NA 4K69A 1WFVA
chains in the Genus database with same CATH superfamily
1O3AA 3D65E 3A7TA 2FS8A 1TLDA 1WF8A 1RXPA 1HCGA 3TSWA 1EX3A 1OZIA 1L1GA 2Z9IA 1YPHE 4R2ZA 3OX7U 1O3OA 1HAGE 1KIGH 2W3KA 4REYA 4JOKA 2A5KA 2FTLE 3M5NA 1AVWA 3NXPA 2FTMA 1X45A 1DXPA 2ALVA 2ZC9H 4P2AB 3SGBE 4ZH8A 3QK1A 1O5FH 1ELFA 1ZJKA 2HNTF 4OEPA 2HLDD 2HVXA 3O8CA 2NU4E 1CA0B 1HBTH 2DM8A 8GCHG 3NKKA 2Z3CA 2J4IA 2IJD1 3SGQE 3ATWA 2J92A 2L4SA 3SW2B 3EA9A 4MNWA 1SLXB 1ZMLA 1MQ6A 1WHAA 3UNQA 2ULLA 2YNBA 4K1EA 4E06H 1V6BA 2CSJA 1Y5AT 2IPQX 3F3BA 3JZ1B 5A2PA 4WMFA 2ANMH 4I32A 4CRDA 1KWAA 1DICA 2QKTA 1W3CA 4Y76A 2H2ZA 2PKTA 4BANB 4NMQA 3MNBA 1MFGA 3LU9B 3HGNA 3HGPA 2A45B 2SGDE 5DP6A 4X1PU 3F2GA 2H5DA 2FWWA 2OCSA 4FU8A 1V2RT 4BNRA 1O3DA 3WW7A 4X8TH 1F7ZA 2ZCHP 3QUMP 4XFQA 3GCTF 2ODPA 3MNCA 3GY3A 1CGIE 3FZDA 4X2WA 5HGGA 5C2ZA 2F9PA 4JZDH 2ZZUH 1VITH 1XUGA 1BFEA 1L6OA 2DAZA 3GICB 3LC5A 2M0TA 5FCKA 2Q1JA 3DSGA 3MQKC 1V5LA 1BRBE 4Y79A 1YPGH 2F43B 1VITG 2WYJA 2DC2A 1BMMH 1RTKA 2EEHA 1OXGA 2D8WA 3KGPA 3LONA 1A5IA 1W10U 2GKVE 5TCAA 3R0HA 5J4SA 1CT0E 1HYLA 2XRCA 3SU1A 2QE7D 3SHAH 2B7DH 3FANA 5I46H 5KECA 4INLA 1IQMA 3P17H 2X7ZA 2Y7XA 4OGYA 3GY8A 2K8IA 1HPGA 1TIOA 5EJZA 1JRTA 1C2JA 3M3SA 4B6EA 1SSXA 5J4QA 4EDJA 2BM2A 2UUJB 4K8YA 2TGAA 2EDPA 2ZTYA 4X8SH 1Z7KA 4M7GA 1OWKA 1TPAE 1FN8A 1O3BA 1UEQA 4KELA 1GI0A 4UU5A 1OHHD 4JOFA 4KGAA 4D76A 1HUTH 2PW8H 3ZZ3A 1EOJA 4ABIA 1TPOA 1T2MA 3M37A 3VG8A 4IN1A 1YF4A 2VRFA 2EI8A 3M3VA 2WINI 2EEIA 1V6DA 3RL8A 1NRRH 4QT8C 4SGAE 4CREA 1FMGA 1W11U 2MX6A 3MU0A 1UVOA 3HPTB 1T31A 2DMZA 2YOLA 3PYHA 3ZYEA 3KZDA 5GCHF 2OINA 1C5RA 5HF4A 1UK3A 5HEBA 1ZSKA 1VCQA 1D5GA 1A7SA 2GCHG 1LHCH 3MU1A 2BDCA 4D9QA 2TGDA 1MKWH 4NIVA 5DP3A 3P6ZB 1S81A 4MVNA 2GVFA 4BTTB 1AN1E 2QXIA 1P10A 1SGTA 3UOUA 2H6MA 4YLQH 5FXLA 5SGAE 3NWUA 1GQ5A 2W7SA 1BHXF 3MO9A 2ZA5A 1VA8A 1VJ6A 3ZVFA 2VSVA 1GWAA 1RFNA 2BDBA 1CHOG 4K72A 5K0HA 3E8LA 1BHXB 5F8TA 3ATLA 4UFEH 2BD7A 4BTIB 3PO1C 4X6OA 4X6MA 1IQEA 4ISNA 1YC0A 1YP9A 5ILBA 3E90B 5JB8S 2J9NA 3MHWU 3SV9A 2PSYA 1IHSH 4FU7A 3EGGC 1JMOH 3UREA 1UJ1A 3E1XB 3RU4T 2M10A 1ELBA 1H8IH 2FOGA 2BTCE 4Z0KA 1XKBC 3UAIC 1OS8A 3KQDA 1UVTH 5T6FA 3ZV8A 4AX9H 1C1PA 1QRZA 1L0ZA 1GI4A 4JOJA 1ANDA 1SQTA 1UK2A 3A7VA 4Y8XA 3L6PA 3URDA 2F9NA 2CHAC 2QAAA 5GIBA 3D49H 5EQSA 2GP9B 1P2OA 1J17T 2SNWA 3K9XB 3GY4A 4KTUA 4GHQA 1S0QA 5C20A 4NZQA 1CO7E 1KYNA 4ZHLU 1QR3E 1C1TA 2OS6A 1QJ1B 2JIZD 1WQVH 1A0HB 3WKMA 4TPYA 2GMTB 1XUFA 3N99A 1G2LA 1G9OA 2PZDA 1QNJA 1F92A 2OC0A 2QKVA 3ATMA 1TX6A 1F5LA 2WPHS 1BITA 1O2XA 4AGKA 4BXSA 2SGAA 1TP5A 3VGCB 3DJ1A 2YT7A 1AD8H 1O2UA 3S7HB 1AQ7A 3U69H 2QKUA 3BEUA 4CRGA 3MU5A 4E35A 5E1YA 4FGMA 2LA8A 1EPTB 2QT5A 2A5AA 2PSXA 2FMJA 1N7TA 4KFVA 2BDIA 3LGUA 1GPZA 4H6TA 2A4RA 5FHTA 4GPGA 2P8OB 1IQFA 4AB9A 1ANBA 1TWXB 2A5IA 2NWNA 4LZ1H 1NRQH 1O35A 1F0TA 4X1QU 3SBKA 1GI2A 2RDEA 3NUMA 4CRAA 1A5HA 1GBMA 1G3CA 1AZ8A 1Y3UA 1YGCH 1P9SA 2G5NA 3QDZB 1N8OB 1C2LA 2XYAA 1AUTC 1MZDA 5FL7D 5HFEA 4TY6A 3SUFA 3FP8E 4H42U 1FC9A 3P8FA 2KBSA 2G2LA 3ATKA 1Q3PA 2IWPA 2KJDA 2YUBA 2O8WA 1ARBA 3TGJE 2R4HA 3BIUH 4ZAEA 4B6FA 1GHXH 2O8LA 1HAZB 4DVAU 3SOEA 4YT6H 5JB9S 3DIWA 2BXUH 1WG6A 4NNMA 3F68H 1O31A 3CBZA 1ESBA 3RDZA 2ZF0H 2XW9A 1VKYA 1DLEA 5DP9A 5EJLA 3TPIZ 2HE2A 5HM9A 2GV6A 4CR5A 1H8HD 3NCLA 5TCCA 1MTSA 1B0EA 3U8TH 1P0SH 2PTNA 1EZSC 2BZ6H 2AGEX 4J2YB 4Z33A 2W7RA 1OWHA 1U6QA 1S5SA 2VU8E 3O8RA 5KEDA 2GCTC 3K65B 1QB6A 1GI5A 4A1VA 2WUCA 3FP6E 1P02A 4R8TB 1XZ9A 1MTUA 3FO8D 3U9AH 2O2TA 4K75A 4JOGA 2W7UA 3RXTA 1PJPA 3QIKA 4B2AA 2VVUA 3I29A 2ZQ1A 3NGHA 1BBRE 1TA6A 2YNAA 3GS9A 2IWOA 3OEED 3SJIA 3TITA 5EU8A 1CT4E 2EAQA 1IQJA 2J98B 3N7OA 1TNLA 2RCEA 1XKAC 2BLOA 3Q3XA 2F3CE 2ZFPH 3HKIB 1WYKA 4IMQA 1HJ8A 2A2XH 2JETB 4O3UA 3ZZ9A 1TBRH 1DANH 4ABJA 1EZUC 1QL8A 1Z6EA 1GI3A 3SV8A 2OZFA 3UIRA 2TRMA 4ZKRU 4CR9A 4HGCA 4Y6DA 3AVZA 1WJLA 1ZLRA 3ZVGA 5DO4H 1V2JT 1EJNA 2FOAA 2SGFE 3PMHB 4ZCNA 4NWKA 3M3TA 1OPHB 1Y5BT 4X1NU 1LVBA 1XM1A 2CXVA 5E6PB 1YWUA 2QF3A 1Z87A 3OEHD 2NU3E 2ZNKH 1UTKA 2GGVB 1K1LA 4WYTA 1EOLA 1JWTA 2AH4X 3PMAB 1V2KT 1MKXH 4AZ2B 3RLEA 2OC7A 2P16A 4UFGH 2WHXA 5EOKA 1BE9A 3Q00A 4MPVA 3CS0A 1QA0A 1MTNB 1QBNA 2V35A 3MO6A 1O2ZA 5I7ZA 2XCFA 5DTHA 3P8OA 4NMSA 3S7KB 2QBWA 1Z8GA 2FN5A 1EB2A 1OX1A 3BG8A 4XDEA 2Y7ZA 3SU4A 1AO5A 2OLGA 2ZKSA 2EGKA 3RXAA 1GJAB 1ELGA 2OCVB 3RXGA 3CH8A 4H11A 4ZKOU 2LELA 1RRKA 2BDYA 2FOBA 4SGBE 1BTYA 5JYIA 1CA8B 2W6JD 1LQEA 3KHFA 6LPRA 1J15A 3HPKA 3KNXA 1ZJDA 1RTFB 1GHBF 2PP6A 1S6LA 2V7QD 3RXRA 2H1UA 1X5NA 4JOEA 3LGWA 5K7RA 1V2ST 2VGCB 2P59A 1Q2WA 1Y3VA 4NIWA 4ASUD 3R3GB 3QLPH 1RD3B 4NIXA 2G55A 3M61U 2Z9JA 2W26A 3VB7A 2ZG0H 2EGNA 3T29A 1KDQB 3T62A 1K1NA 4B2BA 1PDRA 2UUKB 3P8GA 1P9UA 2Y5GA 4LXBH 1O2WA 5LPFA 2ZFSA 4INKA 2EI6A 3SJOA 1K1PA 1ZOMA 4HFPB 4X0WU 2D92A 1UCYH 4K1TA 3CBYA 1G36A 1FPCH 1GI1A 4K6YA 1E0FD 1P3CA 1EJAA 1NFYA 6ESTA 2BVSH 3RMNH 1GGDB 1O5GH 2WUBA 4AB8A 4DG4A 1OP0A 2THFB 4X1SU 4MDSA 4Y0YE 2HPQH 3E0PB 2IOTA 3GCHB 3SN8A 3T25A 1UW7A 1GL1A 5FBIA 4WJG2 3MMGA 4H4FA 1PPFE 1O2YA 1P03A 1SQAA 1HDTH 1ID5H 3F0OA 2TGTA 1TABE 1TRYA 1GBDA 1YYY1 2L4TA 3UR9A 1MU6B 4P0CA 5EYZA 3PROA 1MKWK 1VJAU 4WXIA 7GCHF 2ZEBA 3QGLA 5C5NA 4UEHH 5AFZH 1VZQH 4GAWA 3BTQE 5FPYA 1ELEE 1PPCE 2B0FA 4CH8B 1MD8A 1IU0A 3V7TA 1HAVA 3SHUA 3HVQC 4A1XA 1A46H 2ZTXA 5IL9A 3LGIA 1BA8B 4Q2KA 3NZIA 1Y5UT 2FI3E 4VGCC 5F67A 1C4Y2 1HIAB 3F0PA 1HJAC 1TGCA 1G9IE 1O36A 1O33A 1D6WA 2K1ZA 3HKJB 2GEFA 1SLVB 1BMFD 1W9QA 2QN5T 2B8OH 2WL7A 2I6VA 1UTQA 4OS4A 1NFWA 3LJOA 3SUEA 3SNEA 2DLUA 4NFFA 1W0JD 1QURH 2AGIX 5A0CA 1TGSZ 2G81E 5GXPA 1MCVA 1IHJA 1T8OA 3A8CA 3RC5A 2FOMB 5BRRE 1COWD 1P06A 4E34A 4O97A 2KZ4A 3QJMA 2ZWLH 3BPUA 5E11A 3OAAD 1HFDA 1TALA 4WH8A 3TH2H 3GCHC 1TOMH 2P3FH 4BTUB 1RY4A 1NC6A 1KLTA 1N1LA 4I31A 2WV9A 3E16B 5HXFA 2OC8A 1NY22 1BTZA 2M3MA 2AGGX 8GCHF 2XBVA 2QXGA 3TH4H 1UJDA 4ABFA 1SGIB 1BJVA 3LH3A 1GMCG 2QF0A 1HAPH 2OBOA 1LO6A 1NPMA 2J2UA 2Z94A 4TWWA 3UUZA 1GMDG 1UEZA 1F5KU 5H4IB 2P93A 1C5UA 2FEQH 4YDPA 1DWDH 3RMMH 2A7CA 8ESTE 2H2CA 3DJAA 1T4VH 1GHVH 4GVDA 1ZSJA 2OUAA 3KQEA 1AB9C 4NMPA 3F9GA 4WMEA 1ZMJA 1SG8B 4UFDH 4ZXXH 4F8KA 5HFBA 3OY5U 1MTVA 1P2KA 4FUBA 3DSOA 5HEYA 3S9CA 2VVVA 3LGVA 2I0LA 2FS9A 3M7TA 2EEJA 3CC0A 2ALPA 4MNYA 3SJKA 5F6MA 2G00A 2UWOA 1Z71A 1TNJA 3RC4A 2PWXA 2HRVA 1QQUA 4LOYH 1EP6A 2A7JA 2YMSD 1SQOA 4I33A 5C1UA 3PDZA 2BB4A 4K60A 1XXFA 1W0KD 1TNKA 1C1MA 3VXFH 2ZCLP 2OSGA 3KZEA 1SR5C 4Q7YA 2R0LA 3ODDA 2CS5A 3TNSA 3L33A 5L2ZH 2D90A 4AYYB 3TK5A 5A8ZA 1DUAA 3ZZ8A 1GJ4H 1WCZA 2Y6TA 4I8JA 4B2CA 2G5MB 2ZFTA 2AWUA 4XSKU 1GMHG 2FM2A 3RXQA 1Z8RA 3BTME 4ISLA 2F4LA 1C2HA 3E17A 2VIQA 3ESTA 2BZAA 3PMJA 2H9TH 2JREA 1K32A 1N6FA 1OYQA 1P09A 2PKAB 3EYDA 5CE1A 2R9PA 3SV7A 2KAIB 4Y0ZE 3EE7A 1VGCC 3U8OH 1FV9A 1DY9A 1QGFA 1THSH 2FLBH 2QGRA 2QG1A 3RLWH 7ESTE 3BTKE 3OSYA 1CBWC 1TE0A 4ABBA 2D8IA 3EQ0H 1PPBH 1ZHRA 3HPMA 3UOPA 2J97A 2UZCA 2OBQA 2A2QH 2KPKA 1IAUA 3V3MA 4D9RA 5IK2D 1JIRA 4YOGA 1QAUA 2HPPH 2VPHA 1ZPZA 3UQVA 3TJUA 4FUHA 1FC7A 2REYA 1Q3XA 3GY2A 1TBQH 1AWFH 1TGNA 1NT1A 1ARCA 1XVOA 9LPRA 2OP9A 3AXAA 3TGIE 4OS7A 1GI7B 2LC6A 5E22A 2V3OH 1GHAG 2ZO3H 4ESTE 3M35A 1GJ7B 2W4FA 7KMEH 3T28A 2KRGA 1AVGH 1O2HA 1ZGIA 3LIWA 1C5ZB 1C1SA 1O3MA 4U32A 1FC6A 3M5LA 1BTPA 2ZPSA 2GCHF 3SNCA 5GPIB 2PR3A 1P2JA 1SL3A 1C5YB 4IW4E 1HXFH 1P05A 3LH1A 1AKSA 2HE4A 1TOCB 7LPRA 3CYYA 2D2DA 2KR7A 2BD4A 4DURA 1PPHE 1LHGH 2O8MA 4NCYA 1ABIH 1O2LA 1AY6H 4ZXYH 1LPGB 1C5TA 3DFJA 1YPMH 1O32A 1ZTJA 2V6NA 3A87A 3OE7D 4IS5A 4JCNA 1GBTA 1CHGA 1C1RA 1FONA 1O5BB 1UHBA 2TIOA 5DJ7A 5EG4A 3RXMA 4ABEA 2FDAA 2FI4E 1C2IA 5E2OA 3I18A 3P70B 1XMNB 5DGJA 1CA0C 2HNTC 3KDGA 5EZ0A 1ABJH 5F53A 4ISOA 1EFRD 2G5VA 1GBCA 3WWFA 4IC6A 1AE5A 1XXDA 1J14A 1THPB 1YBWA 2AHME 1AHTH 2BVRH 4AGJA 1O2JA 5I25A 1EUFA 2PKUA 1O0DH 3M7UA 2G51A 3RC6A 1UTPA 3U28C 2XWBI 2FOHA 2PNTA 3GCOA 3ZVEA 1IQLA 2JH0D 1G3DA 2G52A 3F9HA 3P8NA 3QDOA 3PWBA 4Y7BA 1C1VH 1W2KH 1LVOA 4MG3A 1A2CH 4Q2NA 1BMLA 1ACBE 2ZPMA 1PQ5A 4DY7B 3WWBA 3RXHA 2DB5A 1O2VA 1FY8E 2AERH 3N7EA 4B74A 3T5FH 1O5CB 1MCTA 3OTJE 2EY4C 1WQSA 1QAVB 5DP4A 1Y3YA 5F8XA 2RA3A 3STJA 5EJ1A 1C5LH 1WU1A 5LGOA 1ORFA 2R2WU 3T26A 1U37A 2EHRA 4RSPA 1KXEA 1CGHA 2EEKA 2I6SA 1C1WH 1ETSH 3AAVA 4JYTA 2Z17A 2CF9H 1GVKB 1OP8A 1SFIA 1EB1H 1TNHA 4NNLA 5G4BA 2M2AA 1O3CA 5L30H 1INCA 1OWIA 3VFEA 1EZXC 1Y3WA 4HZHA 1H4WA 3AW1A 3SHWA 1HAOH 4GHNA 3EDXB 2AWXA 4HOPB 1RS0A 3R69A 4DOQA 2FZZA 3EGHC 4E7NA 1TQ7B 1UEWA 3ZZ4A 4JOHA 3TSVA 1TQ0B 1KEFA 2DJTA 4IBLH 1GM1A 3WY8A 4BAKB 4NIYA 4UDWH 4TWYA 1ZUBA 3RL7A 2ZPRA 1CQQA 3GCTG 3T27A 2V3HH 3SJ9A 1QLCA 2I4SA 3A81A 1DLKB 3SGAE 3SUDA 2RA0A 3GYMA 1DXWA 1TB6H 2D26C 3ZZDA 3AK5A 1MH0A 4JL7A 1YM0A 3ID4A 1BCUH 3RXKA 3ODFA 4NXPA 1KXDA 1YPHC 2BLWA 5JBAS 2WPIS 6CHAB 2R0KA 1LHEH 1V2OT 1MAYA 4K8BA 1GJ6A 2F9UA 2OPGA 1SGDE 1R6JA 3JXTA 1AU8A 1SGYE 3MH4A 1ZYOA 3HK3B 4A6LA 1C2FA 2XC4A 2KL1A 1XUKA 4FUJA 3IWMA 4AG2A 3PRBA 4NWLA 3DCLA 2SNVA 1TGTA 4CHAB 2P3WA 3RXFA 3F6UH 2BYAX 4X6PA 4XRNA 5IYTA 2ZP0H 4X1RU 5A0AE 4FETA 1IHTH 2EC9H 2AYWA 4NMOA 4FOUC 1TYNA 2ZU3A 4NXQA 1DITH 2BY5X 2LP6A 3U8RH 1Z8JB 1IQGA 3PV4A 1DX5M 1TGBA 1V2VT 2WPDD 3AAUA 5HF1A 2MHOA 4I8GA 3DSPA 1BBRK 1C5OH 3JZ2B 4WH6A 2RFKC 1X9ZA 2FO9A 1ELDE 1UCYE 4Q4LA 4UU6A 3GY6A 2RDLA 1FAKH 2GDEH 1C5VA 2VIWA 2WPJS 4Y7AA 1BTXA 4BAMB 1GJ8B 2IJOB 5C1XA 3UR6A 1LMWB 5ETXA 3S0NA 2Y82A 1SOTA 4UFFH 5GCHG 3ZYDA 2KOMA 1S82A 1C5PA 1ELVA 1MMJN 1C5MD 5FAHA 2IPHA 4JJ0A 2PUXB 2R2MB 5C5OA 4UONA 6GCHF 1O30A 1OYTH 3RXPA 1BRAA 2FODA 5E0HA 3PRDA 3PLBA 1O5EH 1PQAA 3UWJH 4DIHH 1O2GH 4A1TA 3PV2A 2QF5A 4A7IB 4YOIA 4WYUA 1F2SE 4OS5A 1K0HA 1MABB 2H9HA 2Y5FA 3MOCA 3TJNA 1EAWA 3DUXH 4CBNA 3BN9A 3WKLA 3BTFE 1QRWA 1SGFA 2CGAA 4NMTA 4D7GA 4WXVA 5C0UA 1ZTLA 3OY6U 1DVAH 2AEIH 2GMTC 3RXCA 2KAWA 4FU9A 1DE7H 2EDZA 5BPEA 2ANWA 1TA2A 1YLNA 3S69A 1V2LT 3L3TA 3VGCC 1MZAA 1GHWH 1FY3A 2BD9A 2Y5HA 3BEFB 1T8LA 1W9EA 2FESH 4ZKSU 1BDAA 5HFCA 4OAJA 1EPTC 1QB9A 1S84A 4CRFA 3PLKA 2TPIZ 1N6DA 1WUNH 4MPUA 2BY6X 5FCRA 1MD7A 2P8OC 3FVFB 1YCPH 4IMZA 3S9AA 4OS1A 2F5YA 1A3BH 2G8TA 1SMFE 3GY7A 1XX9A 1BQYA 1O3NA 1QHRB 1T7CA 3TSZA 5HIYA 5HFDA 1P2QA 2ZIQH 3SV2H 1ZSLA 3W94A 2NU1E 1N8OC 5DPAA 2ENOA 4THNH 1G2MA 3P92A 3RXJA 4BAHB 1QQ4A 3SORA 2GTBA 4U30A 4FVBA 1O34A 1PQ8A 3VB5A 5ESTE 4FUEA 4Z6AH 1W14U 2QYIA 1BRUP 4RKOB 1GBEA 1GL0E 1GCDA 2QIQA 2VNTA 3ZZAA 4NGAH 2LC7A 1SHYA 1C1QA 2A0QB 1DOJA 2QCYA 3VB6A 2F9BH 1MQ5A 5FX5A 2K1QA 1QTFA 2GV7A 4HI3A 8KME2 3K1RA 1BTWA 1WSSH 1ZHPA 3ZVBA 1AI8H 1A1RA 1DWEH 3N7DA 1O3EA 4HG6A 3FP7E 1PFXC 2B5TB 4GCHF 4PQWA 1MBMA 1SOZA 1S6FA 4I7YH 2BYGA 1TMBH 1WAYB 2J94A 2Q3GA 2FX4A 3L4FD 1HV7A 1XUIA 2CN0H 3GISB 2YT8A 1C4U2 2GT7A 2ZHQH 3ZVDA 1OWDA 3OYPA 1FPHH 3E0NB 3MWIU 4D8NA 3ZIAD 2EJYA 1UJVA 4NSVA 3O5NA 4OGXA 4U01A 2BQ6B 2SGEE 3NCVA 5DK1A 1SC8U 4X2XA 4TYDA 3HK6B 1BB0B 5AF9H 1AGJA 1SBWA 5A8YA 2KYLA 2GZ9A 4OS6A 2B9LA 4Z1MD 3E91A 5JDUB 1D3QB 3CNRA 3CP7A 1UJUA 4OEOA 1O3IA 2STAE 2JETC 1LPZB 2ZU4A 3E3TA 1BUIA 1RGQA 2PUQH 2A1DB 1DPOA 3A80A 4NA9H 2KJKA 1P04A 3GABA 5HDYA 1NN6A 1LKBA 2A4OA 4AOQA 1BRCE 1YPJH 4JYVH 3O8BA 1MFLA 2LOBA 2RRMA 3SV6A 4YYXA 2BY9X 1S85A 1MU8B 1WI4A 2JJ1D 1FZZA 4O9VA 2QXJA 1PYTC 2GZ8A 1M9UA 2H9EH 1O3GA 2BDAA 2E7KA 2WZQA 5CHAB 4OM9A 2ASUB 4B73A 4AC9A 3K50A 2HVYB 2VIDA 1MTNC 5LPEA 1QY6A 1C2DA 1EJMA 1NROH 2AIQA 5A2MH 5H3JA 1NO9H 3NPSA 2JINA 1O39A 1A3EH 1W0ZU 3ZV9A 1GI9B 1TRNA 4MQAA 2UUFB 3A85A 3BEIB 3QWCH 1EAXA 1GVLA 1L2EA 5FPTA 1IQKA 3UB0A 3ZZCA 1RGRA 4Y11E 4ZROA 1GHZA 1VCPA 1ZHMA 5A09A 2L97A 2FP7B 1P2IA 4P02A 1C5WB 3UFAA 3R68A 2CF8H 4JZFH 5DP8A 3QO6A 3F9FA 1LHFH 1QL9A 3V12A 1OOKB 1O3FA 2ESTE 3GDSA 1O2TA 2XBWA 1OBXA 1EAUA 3K6ZA 4TT3D 3IITA 3Q77A 3RXDA 3S9BA 2ZGJA 4ACBA 5LPRA 4XD7D 3TU7H 1C2MA 2OQSA 1TONA 1TPPA 2OC1A 2SGQE 3A83A 2AMDA 1O2MA 3MH5A 2FNEA 2VGCC 2Q9VA 2XXLA 2BX4A 2BOHB 3RXLA 4AG1A 2VWOA 1GI8B 4XE4A 1E34B 2Z9LA 1KXAA 1WHDA 4H6SB 4L8NA 3ZRTA 3A89A 2F9VA 4MPAA 4G69A 3HATH 1OBZA 4IC5A 1UTNA 2VIVA 4DIIH 1L1JA 3GJ9A 1FY5A 3A8AA 4Y8YA 1V2PT 1NM6A 3SU6A 1TPSA 4RN6A 1MBQA 1O37A 2KCOA 1GG6B 4DGJA 1O2NA 5EPNA 1HJ9A 4MNXA 2V3MA 1UM7A 2LUIA 1GMHF 1KMHB 1KSNA 1UTOA 1YLCA 4IGDA 5JPMH 4DW2U 3GOVB 1EASA 4GVUA 2ZU1A 3KHVA 1UF1A 3QTVH 4Y71A 1GHBG 2AINA 1UTJA 3PB1E 4RKJB 4AN7A 2LPRA 1IQIA 1GGDC 2HOBA 2YMSB 4Q80A 2Z6BD 2XNDD 3O8DA 3CENA 3KQ5A 2G4UA 2UWPA 3BG4B 1M5ZA 1P12E 2QXHA 1MUEB 2ZDAH 3A7ZA 1OKXA 3FN8A 1RJXB 1WTHD 2KPLA 2BD2A 2DE8A 2F9OA 2HNTE 3BIVH 1S6HA 4PROA 3M5OA 5G1DA 2IN2A 2OTVA 1ZTKA 1GI6A 1E1QD 1NU7B 3DFLA 3Q76A 1GCTB 5T6DA 4DCDA 4JYUH 2M0VA 1E36B 1L4ZA 1JOUB 3TK6A 1UMAH 4CBOA 4AMHA 1E79D 4UE7H 1WF7A 4XHVA 1VB7A 2VB0A 4GSOA 3OTPA 1HRTH 1O2RA 5EXMA 2Y80A 1EPTA 1EAIA 4JORA 5AVDA 2ZPQA 1KY9A 4TY7A 2ZHWH 3MFJA 4YLUA 5EIYA 1V2MT 1DM4B 2ZDKA 1O38A 1O2PA 5DG6A 2FYRA 4FUDA 1YY3A 3LJJA 3ZZ5A 2Z7FE 4X6NA 2ZI2H 3RUOA 2I1NA 1LVMA 1K22H 5GJ4B 2ZPLA 1DSUA 3EGKH 5F8ZA 2WSSD 2WV4A 3LDXH 3ZVCA 2OK5A 1D3PB 1AUJA 4ISIH 1C4V2 2K20A 1DY8A 2AMPA 2SGPE 3U1JB 2DKRA 1I92A 3PS4A 1YLDA 5CDFE 3NFLA 5HYOA 3MTYA 1GBIA 3BTDE 1N6YA 2JIKA 2J38A 2JOAA 3GDUA 3MYWA 1K1JA 2V90A 1I16A 1SKYE 1X6DA 1X5RA 4CH2B 2YMSC 2P94A 5HIZA 1GHYH 3GSLA 1VITF 1MTWA 1Z6JH 4LZ4B 1V1TA 1BZXE 3NRLA 1PPGE 2FI5E 4BAQB 2ZU2A 3SQHE 5E21A 1RIWB 4FUIA 5EQRA 1QBVH 4BXWA 5EXNA 3RXUA 1RTLA 1LQDB 3QN7A 5E0JA 4J1YA 4E05H 1O2QA 1QA7A 1N99A 5L6NH 3M7QA 1C2GA 1UHPA 5HKKD 3I4WA 1ELCA 1W7XH 2BX3A 1WH1A 2XC0A 2GD4B 1QZ8A 1NBME 3EE0B 4K2YA 1HNEE 3K6YA 2BOKA 3EA7A 3UTUH 3FFGA 1PPZA 4XOJA 3TIUA 1RZXA 1WIFA 2FPZA 3RXOA 1HLTH 1XUJA 3SOSA 3SNAA 2BXTH 3R0FA 2CSSA 5L2YH 1O2OA 1B8QA 3LT3A 2GT8A 1ESAA 2J98A 2QA9E 1E37B 4MNVA 1G3EA 3PTNA 2W3IA 2FIRH 1WV7H 1VCWA 4Q2QA 3SU2A 1WTGH 1YCPK 4Y8ZA 3KYFA 3RXBA 4F48B 1A5GH 1O2IA 2EQNA 1AVXA 1LVYA 3NK8A 1O2SA 4OS2A 3ZZ6A 1B7XB 2WPKS 1AFQB 5EW2H 1DDJA 3SZEA 3BTGE 3LOXA 1S83A 2HGAA 1P8VC 1PQ7A 2VWMA 2J5UA 4K78A 1SLUB 3KF2A 5JBTA 1GJCB 2EGOA 4K3JA 5B6OA 3H09A 1AZZA 5C17A 2VIPA 2ZFQH 1FI8A 1T8MA 2ZCKP 1OBYA 1RIWC 3U98H 2CMYA 1WI2A 2C8YB 1O3KA 3VXEH 2SFAA 2CJIA 1JIMA 3Q3YA 1Y3XA 2F83A 4K1SA 1QJ7B 4AFZA 3SYJA 5CHBA 1CHOF 1FIZA 1S0RA 4KTSA 1U38A 1MKXK 3QTOH 1E35B 1SGNE 2EXGA 1MC7A 1GVZA 5AFYH 5FPSA 1SGFG 1CGJE 2BQWB 1P1EA 1T32A 1V2WT 4YM9A 5B6LA 1W0YH 1UM1A 2HALA 1GJBB 3KIDU 1UTMA 2H2BA 1G37A 3MU8A 3F2HA 1C5SA 1HAHH 1WXRA 5C1YA 2ZTZA 1C9TA 1AFEH 3IG6B 2F91A 1WOFA 4GUXA 4DJZB 1GQ4A 1TMUH 4A5TS 2XBXA 3PLPA 4JZEH 5DSFA 2Q6DA 4MTBA 3A8BA 4JK6A 2QV1A 4MLFB 1AFQC 3DT0H 3LNYA 2QY0B 4INHA 4WF8A 3W95A 1P01A 1KDQA 2XNIA 3SZNA 4E7RG 1AWHB 3RMOH 5HJ1A 1QJ6B 3CBXA 4YXWD 1HB0B 1TNIA 3PO1B 4ZHAA 1WFGA 4YO9A 4FUFA 1FDPA 2JSNA 1JXPA 2ZECA 2FOFA 1FX0B 3QX5H 5AHGH 5ESBA 1XUHA 2EA3A 3MNSA 2C93B 5DKMA 3F2FA 1NS3A 2FOEA 3TK9A 3A7YA 4Q6HA 1K1OA 1T8NA 2KCYA 3A84A 1EZQA 1THRH 3KQCA 2VBCA 4M9FA 1W8BH 5D13A 1H8ED 1P2MA 1V2NT 2PGBB 4RT0A 2BDGA 1UCYK 1NRNH 4D7FA 1KTSB 2H3LA 3B9FH 4LK4A 4BOHA 5KGOA 1OWEA 2VSPA 2GDDA 3QJNA 2CHAB 4NZLA 4AFQA 4YESB 1IOEA 3SU5A 2VZ5A 3B76A 3ID1A 1LPKB 1EXFA 1ZR0A 2I0IA 3TLOA 4CRCA 2ZDVH 5EXLA 2P3TB 1O5DH 2BY7X 1LTOA 2C3SA 4KP0A 3GYLB 1N7FA 5E2PA 2BLVA 4JK5A 5FX6A 4FVDA 1NTEA 2VWNA 3D23A 4ASHA 2BD5A 1KLJH 5HFFA 2PV9B 1QIXB 5T1VA 3TH3H 2WYGA 3UPEA 1NBMD 4X2YA 3BTHE 4Q6SA 4XBCA 1HIAA 4WVPE 1TFXA 8LPRA 1KTTB 4B75A 1HAVB 2TGPZ 1UK4A 2W6ID 2Z9GA 2H3MA 3KEEA 1OWJA 1ZGVA 1ANCA 1V3XA 4HTCH 4X8VH 2ZHDA 2ZDNA 3MO3A 1C2EA 3ZZBA 3SQEE 2AFQB 2C90B 2OGPA 1MAXA 3V0XA 3ATIA 2P95A 2FX6A 3BF6H 2WPLS 3PMBB 1AE8H 3BTWE 2EDVA 4Z8JA 1OSSA 2M0ZA 5JXBA 1G3BA 2O9QA 3GDVA 2KQFA 2XBYA 1KXBA 4NXRA 1C5QA 2VIOA 3PV5A 2KV8A 1C5NH 2KA9A 1ZMNA 2BY8X 2VWLA 3A7XA 3U1IB 4JZIA 5HEDA 5CMXH 3TVJB 1Z1JA 3NFKA 1E38B 3H5CB 1HXEH 1GBAA 3UWIA 3ZVAA 2A7HA 3RLYH 1C1OA 3STIA 1ZPCA 1C1UH 2M5TA 5C3NA 2QC2A 4ISHH 3A82A 4YTAA 3TGKE 3SI4H 2L6OA 5T3HA 2KOJA 1ZRKA 2DLSA 1O3LA 2PA1A 2EV8A 5GDSH 1HGTH 1HAXB 4X2VA 1K9OE 2HWLB 4YOJA 2AIPA 1TQ3A 1UVUH 2H5CA 2NU0E 4MPXA 2PTCE 2Q6GA 3SHCH 1V2QT 2HGTH 4ABHA 4WWYA 1QBOA 1YPKH 1EATA 2GCTB 2ANKH 1BMNH 1SI5H 6CHAC 2I6QA 1O3JA 3TNTA 1BTHH 2F0AA 4GLYA 5HETA 2ZHFH 2JJ2D 1IU2A 2BVXH 4I8HA 5EW1H 3FY5A 2ODYB 2YUYA 3ELAH 1SB1H 4FXGH 4JMYA 3RU4E 2M0UA 2R3UA 3SFJA 2G4TA 5T6GA 2JXOA 3MI4A 5E0GA 4JOPA 1BIOA 2O8UA 3SUZA 2J34A 3PWCA 1SQRA 1ZZZA 2LNCA 3DA9B 5C67A 3LNXA 5GWZA 1GBBA 4CHAC 3QGJA 1RGWA 3PDVA 3SNBA 1ELAA 1CVWH 2FOCA 2WV5A 2Q6FA 3O46A 1ZRBA 5DN6D 3VEQB 3K82A 2GZVA 1NESE 5FB8C 3M36A 1K1IA 2ZGHA 1TAWA 1GBKA 2UUYA 2C8ZB 2DE9A 3SO3A 1K21H 9ESTA 2JILA 1DWBH 1LCYA 1ELTA 1U39A 2RG3A 2ZDMA 4WY3A 1CT2E 2CV3A 1GBJA 2WPMS 1C1NA 2BD3A 1FY4A 1F0SA 1YPEH 2FCFA 1O3PB 3TJVA 5ABWA 2PKAA 3LKWA 2JH6D 3SU0A 4DT7B 1GDQA 2A32A 2KAIA 1W7GH 1UITA 4K76A 3LC3A 2KX4A 3PM3A 2A4QA 2JKHA 4FUCA 2DUCA 1E1RD 2XWAA 1X7AC 3DORA 4JJ3A 1QRXA 1QB1A 1P1DA 2XCNA 3DJ3A 1Q31A 3RMLH 2V0BA 3T2NA 4Q7XA 3GY5A 5B42A 4F49A 5A8XA 4I8LA 1W9OA 1KXCA 1LHDH 1SGQE 1H8DH 3BSQA 3VB4A 4ABDA 1K1MA 2XTTB 5JBBS 4NFEA 3BTEE 1K28D 3EAJA 1BJUA 2D1JA 4NMVA 3QZQA 3VB3A 4NA7A 1VJ9U 1Z86A 4Q7ZA 2ZFRH 4CRBA 1DFPA 2OD3B 3Q3KA 1W13U 3TMHA 1L4DA 1HAIH 1F0RA 1K2I1 1J16A 5EPYA 2L74A 2ILNA 1CE5A 2HLCA 1A0LA 4K5ZA 3RXSA 4R0IA 4Y10E 2KCAA 1Q3OA 3ENSB 3SI3H 2VJ1A 1J9CH 1ESTA 3KDKA 4ZHMU 2ZQ2A 1DS2E 4O3TA 1TP3A 1O3HA 1GBHA 1D9IA 1DT2A 1TX7A 2NU2E 2GZ7A 3CS7A 3KN2A 2TBSA 4YZUA 3P95A 3OU0A 4B76A 6GCHG 1AKSB 2BLQA 1DUEA 4ABGA 5TJXA 4JZ1A 1FN6A 2PHBA 1X8SA 1GJ9B 4P00A 2C8WB 2BQ7B 5GNDA 2UWLA 5HMAA 2EI7A 3G01A 3H7TA 4ACAA 4E3BA 1Z1IA 1NZQH 2KG2A 2JH5D 4N6XA 3KYGA 5C0TA 1FCFA 1VAEA 1G32B 1N6EA 3BV9B 1UHBB 1FLEE 1N6XA 1FNIA 3MNXA 1SGRE 3KL6A 1GJ5H 4B71A 1NFUA 2ZGCA 5F03A 1CU1A 1XVMA 1BTUA 1B5GH 2IWNA 2KM0A 4O03A 1H1BA 2OQUA 5C94A 3A86A 3RXEA 2PLXA 4O06A 3LGYA 4FLNA 3SU3A 2Z9KA 2GJGA 1TMTH 3QGNB 2QF4A 1D6RA 4Q2PA 2KJPA 3A8DA 1YPLH 3RXIA 1H9IE 1W12U 1P2NA 2VVCA 4YT7H 3RXVA 1BMAA 1SGEE 1LKAA 1NTPA 1EKBB 1D4PB 1P3EA 1Y7NA 2AMQA 1VR1H 3C27B 1YKTA 1P11E 1NF3C 1QAVA 1PYTD 2GX4A 1SLWB 1T4UH 1LDTT 2C8XB 4NA8A 4VGCB 1FAXA 2BMGB 3A88A 4WMDA 1JRSA 1HJAB 3A7WA 1BOQA 1J8AA 1ANEA 4ZMAH 3DD2H 1GDNA 4KTCA 3RU4D 2C4FH 1GMCF 1TNGA 3FAOA 1B0FA 3I77A 2FE5A 3QE1A 1G30B 1P57B 1BT7A 1TX8A 1GMDF 3RM0H 1IQNA 1EQ9A 1QL7A 1WDIA 2XC5A 3FKSD 2VH0A 5EODA 3ZZ7A 2K0QA 3LPRA 2Y81A 2VINA 2Z3EA 5FBEA 3M5MA 1FQ3A 3MH6A 1GBFA 4HOPA 1F0UA 4RI0A 1Y59T 4XBDA 5IDKA 4U2WA 3EA8A 4KKDA 2KFWA 1X5QA 1D3TB 2EEGA 2JDID 3UNRA 1H9HE 4AFUA 1Q7XA 2PKSB 5JBCS 1NRPH 4GCHG 1FY1A 2AS9A 5EQQA 2I04A 5LH8A 1TRMA 1HAYB 2CK3D 3GCNA 2Z3DA 3V13A 1AIXH 1V2TT 4TPIZ 2STBE 3TJOA 2ZGXH 1V2UT 5GLJA 3RM2H 1SGCA 1UFXA 1YCPM 2XOKD 1CSOE 2ZHEH 2A31A 2FXRA 2VH6A 2BD8A 4LMMA 1GJDB 2VWRA 1H9LB 3QZRA 3VQGA 1FUJA 4B1TA 5CHAC 2BHGA 1C9PA 3FZZA 4A92A 2O8TA 4MPWA 4NSYA 2W5EA 1AB9B 3SJ8A 1EP5A 3I1EA 1SPJA 4AFSA 3ID2A 2PFEA 2RCZA 4Q63A 2A4GA 1FXYA 2ZGBH 1DSTA 3ITIA 2ZDLA 2ZFFH 5DP7A 3KQBA 1A0JA 1A4WH 4BAOB 1Y8TA 5A0BA 3URCA 1DWCH 1TBZH 4UD9H 1O2KA 2J95A 1UVSH 4KFWA 1WBGB 2ANYA 5EGMA 4Q2OA 1SGPE 1ETTH 4NG9H 2OQ5A 1YBOA 1BBRH 3KCGH 3PTBA 1U3BA 1PPEE 3B23B 3D62A 5HM2A 5G1EA 1C5XB 4XBBA 5E8EH 3ID3A 1GBLA 1QCPA 3H7OA 5DP5A 5F3XA 2PKSC 1GHAF 3UY9A 2FYQA 1JBUH 4AORA 1V62A 1D3DB 1Z8IB 1IQHA 3LGTA 3SUGA 1FJSA 1UVPA 1ZPBA 1QFKH 3GGEA 4ZUHA 1KLIH 1KXFA 1VGCB 2V1WA 3UNSA 3VQFA 2JWEA 1SFQB 1O5AB 3RP2A 1GG6C 2YTWA 2KOHA 1CBWB 2KCPA 3OFND 1NU9A 2ZU5A 4TSFD 3I78A 3E6PH 1ETRH 2OMJA 4ABAA 1AMHA 1ZOKA 1UO6A 4I86A 1SVPA 3VPKA 4ZKNU 4I8KA 4Q3HA 3C1KA 2IWQA 3MH7A 3SNDA 4FUGA 1V5QA 3B8JA 5PTPA 7GCHG 1A61H 2BDHA 3BG4C 1F5RA 3AASA 2ODQA 1GDUA 3F1SB 4X8UH 4RT1A 1UEPA 1SHHB 4GHTA 3W1EA 2PDZA 1C2KA 3K2UA 2PGQB 1NRSH 3MU4A 1N7EA 2OXSA 2R3YA 4F4OC 1NFXA 1GCTC 1FIWA 1OP2A 3DHKH 3BTTE 2AWWA 2FLRH 4NMRA 3F9EA 4AYVB 4DT4A 4IN2A 3FOAA 1UTLM 3UQOA 4GVCA 3AW0A 2P3UB 4F55A 1L1NA 4K69A 1WFVA
chains in the Genus database with same CATH topology
1O3AA 3D65E 3A7TA 2FS8A 1TLDA 1WF8A 1RXPA 1HCGA 3TSWA 1EX3A 1OZIA 1L1GA 2Z9IA 1YPHE 4R2ZA 3OX7U 1O3OA 1HAGE 1KIGH 2W3KA 4REYA 4JOKA 2A5KA 2FTLE 3M5NA 1AVWA 3NXPA 2FTMA 1X45A 1DXPA 2ALVA 2ZC9H 4P2AB 3SGBE 4ZH8A 3QK1A 1O5FH 1ELFA 1ZJKA 2HNTF 4OEPA 2HVXA 3O8CA 2NU4E 1CA0B 1HBTH 2DM8A 8GCHG 3NKKA 2Z3CA 2J4IA 3SGQE 3ATWA 2J92A 2L4SA 3SW2B 3EA9A 4MNWA 1SLXB 1ZMLA 1MQ6A 1WHAA 3UNQA 2ULLA 2YNBA 4K1EA 4E06H 1V6BA 2CSJA 1Y5AT 3JZ1B 5A2PA 4WMFA 2ANMH 4I32A 4CRDA 1KWAA 1DICA 2QKTA 1W3CA 4Y76A 2H2ZA 2PKTA 4BANB 4NMQA 3MNBA 1MFGA 3LU9B 3HGNA 3HGPA 2A45B 2SGDE 5DP6A 4X1PU 2H5DA 2FWWA 2OCSA 4FU8A 1V2RT 4BNRA 1O3DA 4X8TH 1F7ZA 2ZCHP 3QUMP 4XFQA 3GCTF 2ODPA 3MNCA 3GY3A 1CGIE 3FZDA 4X2WA 5HGGA 5C2ZA 2F9PA 4JZDH 2ZZUH 1VITH 1XUGA 1BFEA 1L6OA 2DAZA 3GICB 3LC5A 2M0TA 5FCKA 2Q1JA 1V5LA 1BRBE 4Y79A 1YPGH 1VITG 2WYJA 2DC2A 1BMMH 1RTKA 2EEHA 1OXGA 2D8WA 3KGPA 3LONA 1A5IA 1W10U 2GKVE 5TCAA 3R0HA 5J4SA 1CT0E 1HYLA 2XRCA 3SU1A 3SHAH 2B7DH 3FANA 5I46H 4INLA 1IQMA 3P17H 2X7ZA 2Y7XA 4OGYA 3GY8A 1HPGA 1TIOA 1JRTA 1C2JA 3M3SA 1SSXA 5J4QA 4EDJA 2BM2A 2UUJB 4K8YA 2TGAA 2EDPA 2ZTYA 4X8SH 1Z7KA 4M7GA 1OWKA 1TPAE 1FN8A 1O3BA 1UEQA 4KELA 1GI0A 4UU5A 4JOFA 4KGAA 4D76A 1HUTH 2PW8H 3ZZ3A 1EOJA 4ABIA 1TPOA 1T2MA 3M37A 4IN1A 1YF4A 2VRFA 2EI8A 3M3VA 2WINI 2EEIA 1V6DA 3RL8A 1NRRH 4QT8C 4SGAE 4CREA 1FMGA 1W11U 2MX6A 3MU0A 1UVOA 3HPTB 1T31A 2DMZA 2YOLA 3PYHA 3ZYEA 3KZDA 5GCHF 2OINA 1C5RA 5HF4A 1UK3A 5HEBA 1ZSKA 1VCQA 1D5GA 1A7SA 2GCHG 1LHCH 3MU1A 2BDCA 4D9QA 2TGDA 1MKWH 4NIVA 5DP3A 3P6ZB 1S81A 4MVNA 2GVFA 4BTTB 1AN1E 2QXIA 1P10A 1SGTA 3UOUA 2H6MA 4YLQH 5FXLA 5SGAE 3NWUA 1GQ5A 2W7SA 1BHXF 3MO9A 2ZA5A 1VA8A 1VJ6A 3ZVFA 2VSVA 1GWAA 1RFNA 2BDBA 1CHOG 4K72A 5K0HA 3E8LA 1BHXB 5F8TA 3ATLA 4UFEH 2BD7A 4BTIB 3PO1C 4X6OA 4X6MA 1IQEA 4ISNA 1YC0A 1YP9A 5ILBA 3E90B 5JB8S 2J9NA 3MHWU 3SV9A 2PSYA 1IHSH 4FU7A 3EGGC 1JMOH 3UREA 1UJ1A 3E1XB 3RU4T 2M10A 1ELBA 1H8IH 2FOGA 2BTCE 4Z0KA 1XKBC 1OS8A 3KQDA 1UVTH 5T6FA 3ZV8A 4AX9H 1C1PA 1QRZA 1L0ZA 1GI4A 4JOJA 1ANDA 1SQTA 1UK2A 3A7VA 4Y8XA 3L6PA 3URDA 2F9NA 2CHAC 2QAAA 5GIBA 3D49H 5EQSA 2GP9B 1P2OA <