1KY9A

Crystal structure of degp (htra)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
343
structure length
311
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE DO
publication title Crystal structure of DegP (HtrA) reveals a new protease-chaperone machine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 311
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ky9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ky9A01
3S9AA 1ZTLA 2W4FA 2ZFSA 3GY7A 3PWCA 3PYHA 4Y0ZE 4AGKA 5LH8A 4D8NA 1F7ZA 1F5LA 1O3DA 2BXUH 2EEJA 2BY5X 1HLTH 2OUAA 2ZEBA 3RLWH 1BA8B 3SU1A 2A4GA 4H11A 1GHVH 2O8MA 1T8NA 1OWHA 1G3BA 3RXFA 2R9PA 1LHGH 1HUTH 2LOBA 2NU4E 5E1YA 3ZZAA 2Z3CA 1N6FA 7ESTE 1CE5A 2QYIA 1P2IA 4DCDA 4Y76A 3U69H 4HFPB 4YZUA 1OP0A 1NRPH 4NIYA 1TMBH 1QQUA 5GPIB 1NPMA 1TGBA 1Y3UA 3R0FA 3UNQA 2KOJA 2GTBA 1L6OA 1HB0B 3K82A 3SV8A 3URCA 2GGVB 9LPRA 1ESTA 2BD9A 1XXDA 1Y5BT 2BVXH 1UVUH 2G52A 2FOGA 4A1TA 2KBSA 1LVMA 1LO6A 1K22H 1B0FA 4WVPE 2YNBA 3LONA 2EDVA 4MVNA 4FXGH 1C5NH 3NWUA 1MBMA 1UTPA 3SUGA 1HJ9A 1DLEA 2PNTA 3ZVAA 4X8SH 2XC4A 5D13A 1YPHC 2G51A 1HYLA 1F0UA 3TPIZ 1YF4A 3GCTF 2ZDNA 1FMGA 1JXPA 4RKJB 4OAJA 2FOHA 2BLVA 1XUKA 2QAAA 1X8SA 2QBWA 1ELDE 3SGBE 1D5GA 4NMRA 2FEQH 3M3SA 1C1OA 2XW9A 3JZ1B 1AD8H 3LGWA 5FAHA 1EB2A 3TGIE 1F0RA 4ISHH 3DT0H 3SU3A 1Z8GA 2A4OA 1AZZA 3UPEA 2OBOA 3Q3KA 1ZHMA 2Q6FA 2W7RA 1YPGH 3VXFH 2H5CA 1G30B 4WMFA 2JILA 4B71A 3GDVA 3BTME 4YESB 3TH2H 1EPTC 3A7YA 3L6PA 2XRCA 3DJ3A 3U8OH 1C1PA 1MZDA 3RP2A 1GBDA 4UFFH 4BAQB 1SFQB 1DLKB 5GDSH 5FB8C 1QHRB 1RZXA 2JETC 4UU6A 3GY6A 1N6YA 2OQSA 1EPTA 4INKA 1H4WA 2NU3E 1P8VC 2PKAA 2UUJB 1DPOA 2BY9X 8KME2 4FUFA 1C1VH 2HOBA 4I8JA 5F03A 8LPRA 2EDPA 1O3OA 1YYY1 1ZMLA 4WYTA 3S9BA 2J9NA 5DP5A 3RMMH 4NNLA 3BPUA 4KFWA 1W0ZU 4G69A 2D26C 5C1XA 2TRMA 2TGAA 3SJIA 2DMZA 5JDUB 4OS6A 4NA9H 2OZFA 1ELTA 3BTDE 1BT7A 4RKOB 3KQEA 1Z1JA 1YM0A 5EW1H 1BB0B 2VJ1A 1W9EA 1Y3YA 2B8OH 2C8YB 3ZZ3A 1TE0A 3RDZA 1TIOA 1HAOH 1TGCA 1AKSA 1SC8U 1RGQA 1ESAA 2QXJA 1FONA 1UJ1A 1HIAB 4B2CA 1MTNC 3SNCA 5A2MH 1BRBE 1VCWA 3V12A 4NXPA 4E05H 1GJAB 5FPTA 2ODYB 2ZTZA 1SVPA 2C3SA 3RXCA 1LCYA 1HAPH 2KAIB 3R68A 3RXVA 1NFYA 1VGCB 1N6XA 1E0FD 2Q3GA 1GHWH 2RA0A 2BD4A 2NU1E 3VB4A 4A1XA 3STJA 1C2HA 4AORA 5AFZH 4HOPA 1MC7A 2THFB 3P17H 4I8HA 1Z87A 2AERH 3L33A 5HEBA 4X8TH 3SU6A 4YTAA 1IQMA 1U6QA 1DS2E 1ANBA 4A6LA 3UNRA 1WQSA 3UQOA 4JYUH 4FUJA 1LHEH 1PPGE 4JOKA 3TJVA 4UEHH 4R2ZA 4Y0YE 1IAUA 1O38A 2J92A 1O5AB 1GHXH 3VQFA 2PSXA 1Q2WA 3BSQA 1DANH 1NZQH 2PTCE 3LGUA 2ZGCA 1OBYA 5LPFA 3TK6A 2BOHB 1UTNA 5F3XA 3H7TA 2C4FH 1KXAA 3BG4B 1ZOKA 1O2XA 3U98H 2QXIA 4GSOA 2FP7B 2H3LA 4ZKSU 1BTHH 1YKTA 1BTXA 1KXBA 4NG9H 4AG2A 1TP3A 1JIMA 1TNIA 3RXDA 2XBYA 4CRFA 2KPKA 2G00A 1V2QT 2BVSH 2R0KA 1QA7A 2PV9B 5EG4A 1C9PA 1SFIA 3FVFB 3ZZ5A 2A5IA 4JZIA 2EEHA 2LUIA 3T2NA 1DWBH 1KDQB 1KWAA 3ZVBA 1WFVA 2O8LA 3RXMA 1QTFA 6GCHG 1QBVH 5EQRA 1LHFH 4IC5A 4BOHA 2WPJS 5L6NH 1QL8A 3S0NA 3JXTA 3I1EA 1L0ZA 3RXKA 1UHPA 1MCVA 3F6UH 1AWFH 2PGQB 2SNWA 3OY5U 2BZ6H 4XBDA 5AVDA 4WY3A 3O46A 3UWIA 1WCZA 5AF9H 1CBWB 1TP5A 2TBSA 2VIDA 4MG3A 3RMLH 1TWXB 2ENOA 1FN6A 4AG1A 3PV4A 2HE4A 1SR5C 1BJVA 4YDPA 1O2NA 3LPRA 5DJ7A 4BNRA 1EAXA 5GLJA 1UTJA 2IWNA 2ZG0H 1F5KU 2V1WA 3O8BA 2XCFA 2ZIQH 3AVZA 3LU9B 3Q3XA 4BTTB 3BEUA 4VGCC 2JH6D 2G5VA 1GI8B 5TJXA 1C1RA 3ITIA 3KQCA 1UTMA 1EOJA 3UNSA 3Q76A 4UFEH 4TY6A 5TCCA 3M36A 1FC9A 2ZF0H 2D2DA 3QWCH 3MOCA 5JPMH 1S0RA 3RXQA 1SGPE 1GI6A 3DIWA 1G32B 1NO9H 1O2OA 1PQ7A 1LPZB 2KA9A 1SOTA 2WUCA 4YLQH 1DWDH 1O2IA 2OP9A 1A5IA 4NGAH 2FESH 1S83A 1ELAA 4H4FA 1GBHA 4RSPA 2VPHA 2P3WA 1DM4B 1EP5A 1ZYOA 4F8KA 2VWLA 3EGKH 4LZ4B 2Y6TA 3PM3A 1C4U2 4J1YA 1E34B 3KF2A 3SI4H 3P70B 4ABFA 2OC8A 2QCYA 2WUBA 2BB4A 1KXDA 2J95A 1NRQH 1MQ6A 4NFEA 3IITA 4JK6A 1ID5H 2QIQA 4H42U 1MMJN 1O31A 1TQ0B 3D62A 1V2OT 4MNVA 4Y8ZA 5HF1A 2EI6A 1Z1IA 1PPFE 1L1NA 1N7FA 1WYKA 2RCZA 3RXRA 2Y5HA 4NMVA 4NFFA 1GMCG 1HJAC 2YTWA 3D23A 3ZZ8A 1WJLA 1O2RA 3ZZBA 1DVAH 1P04A 3OU0A 3RL8A 1BITA 1KLIH 2BQ6B 3V0XA 1C1TA 3PLPA 1V2MT 3V13A 3UOUA 2GCTC 3RM0H 3GY3A 1O2UA 2BDYA 4X2WA 4YT6H 1CA0C 3A80A 2FWWA 1A1RA 5EW2H 1BBRK 1C1QA 2HGTH 1TABE 3NPSA 1V5QA 2OS6A 1ETRH 1O5BB 1G9IE 1SGDE 2OC1A 1ZHPA 1C5XB 1GBIA 3V3MA 1PQAA 3L3TA 3MU8A 2UWLA 1V2JT 3VGCB 3M37A 1O3HA 2FE5A 2JREA 4NZQA 2F83A 3A7ZA 4Q2NA 1GBEA 1K1LA 1S81A 1UTLM 8GCHF 2G4UA 2H6MA 1LKAA 3SJKA 4GUXA 2FX4A 4K75A 1ZJDA 3AAVA 3A8CA 1LKBA 1A46H 2CF8H 4MLFB 2PUQH 1JIRA 4A1VA 4NIWA 1NROH 2W26A 2G81E 3NGHA 5DP4A 4O03A 2GX4A 4I8LA 1MQ5A 4OEPA 1V2LT 2YUBA 1F0TA 4BXWA 1NN6A 1T7CA 4YT7H 4JOHA 1W2KH 1O3GA 2ZDMA 3KQBA 3DUXH 2FOAA 1SG8B 4NMQA 2ZQ2A 2M5TA 1OS8A 1SL3A 3DD2H 1CVWH 5G1EA 2Q6GA 4UDWH 2PSYA 3T25A 2C93B 1T32A 3E8LA 4OS7A 5F67A 1N7TA 3UOPA 2W7UA 3BTFE 1FY1A 3LGVA 2L97A 3HGPA 1VJ9U 4A7IB 2PA1A 3E6PH 2C8WB 2EI7A 2JWEA 3RXJA 4WXVA 1TALA 5E0GA 4GPGA 1O5GH 4I8GA 1AVWA 1ZGIA 2R2WU 1WSSH 2EI8A 1O2HA 4NIVA 4AMHA 1QB1A 3CBZA 2BDAA 1MTWA 1C2LA 3BIUH 1O0DH 2D90A 4IN1A 1EATA 2D8IA 1K28D 2A7CA 1NY22 1P1DA 3EYDA 4KFVA 3A8DA 4GVCA 3RXOA 2JKHA 4DURA 1E37B 1GDUA 3G01A 5EXLA 2DJTA 1GMHF 1R6JA 2EA3A 4HGCA 3A84A 6CHAC 5HEDA 2J94A 1Z6JH 2IWQA 2H9EH 3EE0B 1PQ5A 5AFYH 1GGDC 4Q2OA 1GL0E 1G36A 7LPRA 3MHWU 1OPHB 4E7NA 1G3DA 2SNVA 5F6MA 1A5HA 2FZZA 4JZDH 2CSJA 7GCHG 4GCHG 3SUEA 4ZHLU 1MCTA 1MD8A 2GZ8A 4RI0A 1HFDA 3OY6U 4I8KA 1TQ3A 2AWUA 2OC7A 3LH3A 1O3CA 1WI4A 3U9AH 3A81A 4P2AB 1WV7H 2WYGA 3OTPA 2BX3A 1CA0B 1IQKA 4BTUB 1N6DA 2EC9H 1H9HE 2IOTA 1LMWB 1DE7H 2F9UA 4ZKOU 3SHUA 1ELEE 3MFJA 4ZUHA 1IOEA 1D3TB 2BYGA 4IS5A 3SORA 5E6PB 2UZCA 1C5OH 5C20A 1FNIA 2FO9A 2XC5A 4XBCA 4ZKRU 4JOJA 4BAHB 1AZ8A 3HATH 2GD4B 3UR6A 5C3NA 1AIXH 2OD3B 3A89A 4BXSA 4X6MA 1SLWB 1EZSC 2Z17A 3UY9A 1PFXC 1QAUA 1AFEH 1P12E 1TPPA 1QAVA 1EUFA 2FTLE 1A0HB 1RY4A 1TNGA 4AX9H 4ZKNU 3I77A 3PO1C 1RGWA 2KYLA 2R4HA 1K1JA 2CHAC 4KTCA 4IW4E 2VWRA 1CT2E 3U1IB 1UHBB 4LZ1H 4JYVH 1FC6A 3DORA 2M0ZA 1L1JA 3K2UA 3SNDA 2FOFA 3GCOA 2PKSC 4JZEH 5CMXH 3TLOA 1G3CA 1BRAA 4MPWA 1V2PT 1BBRH 5DGJA 4F4OC 1GCTC 2I0IA 1CHOG 3FZDA 2AIQA 3UREA 4WWYA 5EOKA 1ELGA 5CHAB 1TPSA 3BTKE 2HNTE 2G55A 3VPKA 4K8BA 2BD5A 1DWCH 3EGGC 2BQ7B 3PB1E 1M9UA 3PMHB 2FCFA 3CC0A 4JZ1A 2GZ9A 3B8JA 3BEIB 1C5SA 2QA9E 1MKWK 5HFDA 3QIKA 5GCHG 3DFJA 1O2WA 1WF8A 2FODA 3QO6A 4XSKU 2F9NA 3FANA 1TX7A 1QJ1B 1RGRA 1H9IE 4CHAC 1VJ6A 2P94A 1C1MA 1YPHE 3TK9A 1QQ4A 5B6OA 4O97A 3E16B 1GHBG 2O2TA 2GDEH 2R3UA 4I33A 1H8DH 2ZPRA 1P11E 1ZRKA 1BMLA 3LH1A 3L4FD 1NRSH 2F3CE 2EGOA 3PMAB 1DITH 2H2ZA 2MX6A 4NWKA 1SGYE 1TYNA 2Y5GA 4LXBH 1O36A 1V2VT 2Z9IA 4Y8XA 3SI3H 2ZHEH 5HGGA 2HE2A 2XWAA 2FYQA 4ZXXH 2VSPA 1GGDB 2I4SA 1QB6A 3QDOA 2ANWA 4SGAE 3CBYA 1O3LA 2HNTC 3MU5A 1KSNA 1C1SA 2HNTF 1BUIA 1AMHA 3FZZA 3QX5H 1K32A 2GMTC 1TA6A 4KTSA 1GBCA 2P3FH 2CJIA 1GMDG 4XDEA 2IJOB 5DO4H 2W3IA 1YPEH 4Z33A 1W10U 1XUHA 3PTNA 1YP9A 5H4IB 3NXPA 1O2QA 2Y80A 4GVUA 2BDCA 3TGKE 1ETTH 2ZZUH 1TGSZ 1G2MA 1HPGA 2ZQ1A 3QTVH 3PS4A 5BRRE 2YUYA 1L4DA 3ATIA 5F8ZA 4L8NA 3RU4D 1HAVB 3SGAE 2VVVA 1CHGA 1W7XH 2GP9B 3VB5A 5GJ4B 1ESBA 2ANMH 2ZCLP 1EZXC 3LNXA 1GG6B 1PQ8A 1MD7A 1WAYB 3BEFB 1W9OA 2PHBA 5DP6A 3CH8A 3UQVA 2KRGA 2OLGA 1PPZA 3CYYA 2NU2E 4D9QA 3RL7A 5LPRA 2ZKSA 2BLQA 4K1SA 4SGBE 2XTTB 3GICB 4FGMA 1GVKB 2BQWB 2CHAB 4MNYA 4INHA 4TWYA 5C5OA 2UWPA 2AWWA 1S85A 5ESTE 4AFSA 4FUEA 1UEZA 3KCGH 1D6RA 2PKSB 1VJAU 3UR9A 3LT3A 1OZIA 4MPVA 1BTYA 1GCTB 3M3VA 2H9TH 2KV8A 3MH6A 3K1RA 1GBAA 2A0QB 4NMOA 2VGCB 4KELA 4CBOA 1ZMJA 3RXIA 4AFUA 2I0LA 3E3TA 1E35B 1HAGE 4Q7XA 5J4SA 1YPKH 1P01A 3KZDA 1GVZA 1TFXA 4WF8A 4O3TA 4E06H 5L2YH 1ZR0A 2CXVA 2O9QA 4X6OA 2FOCA 3A8AA 3LJJA 2HRVA 3VB6A 5E22A 3T5FH 2VH0A 2Z7FE 4X8UH 1DSTA 4IMZA 4U32A 5HJ1A 4I31A 2A45B 1ABJH 1KYNA 2PGBB 1LTOA 3GCHC 4D76A 3ZV9A 2C8ZB 3IG6B 3ZZ7A 1C2KA 2DLUA 5E2OA 1O3BA 3BTHE 1L1GA 2I6SA 2FX6A 1A3EH 1A5GH 1C1WH 5HFCA 4B75A 1UK3A 3ENSB 1V2UT 1KY9A 1NU9A 3HK3B 4X1RU 1X6DA 2L4SA 3K9XB 3MO3A 2H3MA 1SHYA 1W0YH 2VIVA 3P8FA 1K1MA 4OS5A 4PROA 2A4QA 2M0UA 1VA8A 5BPEA 1X5NA 2J4IA 5G1DA 1X5RA 1TOCB 1UMAH 3ZVFA 1UM1A 1BTZA 2PKTA 3URDA 4DIHH 1VITG 1FC7A 1UTQA 1AY6H 1TB6H 4O9VA 2EEGA 1MKWH 4U30A 2OXSA 3RUOA 1KXFA 2GMTB 1GQ5A 1MTSA 1A0JA 3Q77A 1J14A 3TVJB 1SHHB 1EX3A 2OTVA 3CS7A 4OS1A 4WMEA 3ID1A 1QBOA 1XZ9A 4B1TA 3UIRA 2ALVA 1O2PA 2V35A 4BAMB 1GPZA 1W9QA 2B0FA 4ABIA 5A0CA 1LHDH 3TGJE 2VZ5A 1AGJA 1Y3XA 1GI1A 1ELVA 1GBJA 1GJ5H 1Q31A 3LGYA 5DP3A 3GJ9A 3ESTA 1NT1A 5FPYA 3QGLA 1D3DB 5FXLA 5K0HA 2VB0A 3C27B 1ZSJA 2BVRH 5K7RA 2FLRH 4MQAA 1INCA 2H2CA 1OWDA 1P05A 2GCHG 2WPIS 3MNCA 4LK4A 5JXBA 4U2WA 2C8XB 1EAUA 3R3GB 1ELBA 3ZVGA 1V2WT 1THPB 4Q2KA 1SGFG 2STBE 2XXLA 1VAEA 3MH7A 1EJMA 1IHTH 2VIWA 4CR5A 1V6BA 3E1XB 4AB9A 3P6ZB 2OC0A 4XBBA 3SV7A 1TPAE 2A4RA 3PLKA 2FOBA 1ZUBA 3RU4E 1UFXA 1GJ9B 4LMMA 1X45A 2PZDA 3AASA 4K60A 8ESTE 3A85A 1QRWA 4K1TA 1S5SA 1MBQA 4DGJA 2JIKA 2WPKS 2A2QH 1EPTB 1Y8TA 2QKUA 2WV4A 2OBQA 5GWZA 2EDZA 3LNYA 1UVSH 1HJ8A 2PKAB 3EDXB 1DXWA 1B5GH 4JOEA 1DXPA 3E17A 1EAIA 1SI5H 2ZP0H 2JETB 5JBTA 1P03A 4D7GA 2VH6A 3SQHE 2D92A 3TH4H 4DG4A 2LPRA 4XFQA 4JOPA 2B9LA 2G5NA 3T28A 2OCSA 1GJ8B 1NFWA 1O5EH 3SHCH 1AUTC 4Z6AH 2YT8A 1HGTH 1XMNB 3U8RH 2D8WA 2G8TA 1C5VA 3QJMA 3SU5A 3NUMA 4R0IA 1VZQH 2FYRA 4ABGA 1K1NA 2H5DA 1AKSB 1T31A 2KJKA 3HVQC 1OP8A 2B5TB 4JOFA 4DW2U 5ETXA 3LDXH 1GBTA 1O32A 1Q3OA 4J2YB 3HPTB 1QA0A 2XNIA 4E34A 2TGPZ 4UD9H 2A7JA 2Z9JA 3B9FH 4FUHA 1RFNA 4K1EA 4YM9A 1QR3E 1DFPA 1B0EA 1MTNB 1TBZH 1WFGA 1A4WH 2ZC9H 4HOPB 1DICA 1N8OC 2P3TB 1U3BA 2VWNA 1TX6A 1I92A 2FS8A 1KXEA 1TNLA 1V2NT 2BTCE 4X1PU 1IHJA 4X2XA 2V90A 1OOKB 2ZGXH 2BD7A 2JH0D 1PPCE 2VNTA 5EU8A 1T4UH 1SGRE 3U8TH 4NSYA 3E0PB 4OEOA 1QGFA 4H6TA 3N7OA 3TNSA 1O5DH 1P2KA 2SGDE 3SU0A 1ELCA 1O2YA 2Q1JA 3UFAA 1XUIA 4YO9A 2AWXA 2DAZA 2OMJA 5B6LA 1TQ7B 4JYTA 2BOKA 1U37A 1CGHA 4OS2A 3SJOA 2VSVA 1SGIB 1O3PB 3RMNH 5A8ZA 1QL9A 3B76A 4NXQA 5HF4A 1V1TA 2DC2A 1BQYA 5JYIA 1Z6EA 3M35A 5E8EH 1D6WA 1S6FA 4CBNA 1HAIH 1GJBB 3UUZA 4Y71A 1O3JA 1P2NA 1QCPA 1SSXA 4BAKB 4K76A 2LNCA 2ZFFH 1GMHG 1GL1A 2ZGBH 3O8DA 2CV3A 3E90B 1WG6A 2ZFQH 3MMGA 4ZMAH 2AMQA 1ZZZA 4FVBA 1P3EA 2D1JA 1O2JA 1SLXB 1OBXA 3TSVA 4B2AA 3DHKH 1JWTA 3T27A 1FY4A 3WKMA 2XBXA 1W14U 1GI5A 2O8UA 3HPMA 4CRCA 2F91A 4K69A 3RMOH 1CA8B 3O8CA 3SHWA 1HAXB 4WXIA 1AFQC 3FFGA 1HBTH 3A7XA 1AVXA 4K2YA 4GLYA 5LPEA 1BE9A 2BLWA 3SJ9A 3I4WA 1UO6A 1IHSH 2ZHWH 2RRMA 2ZPSA 1F0SA 3GCNA 1O5FH 1ZTJA 3S69A 2HALA 1C5QA 1HAYB 1BJUA 1KEFA 1A3BH 2BMGB 1P10A 1IQGA 1EJAA 2ZGHA 3RLYH 5FBIA 1WI2A 3TK5A 2HPPH 4FUGA 2GT8A 1TA2A 1Z7KA 1BHXF 2ANKH 1ZMNA 3R0HA 3GYLB 3SUDA 1C5RA 1YPJH 3M7QA 1QL7A 4INLA 2VWMA 2EV8A 1OX1A 2JOAA 3EQ0H 1DY8A 1WTHD 3SO3A 1XVMA 3SN8A 1G2LA 2OPGA 3BTTE 2FLBH 3MNXA 1C5LH 2Q6DA 1AE8H 3AXAA 3NFLA 3WKLA 1YCPK 1GHZA 3HKJB 4DOQA 4OGXA 2UUKB 1C2FA 2W5EA 3EA9A 4BANB 1C1UH 4ABBA 4VGCB 2RDLA 5FCRA 2A2XH 4X0WU 5DP9A 4M7GA 1GI4A 2AGIX 2VVCA 1BTPA 2HGAA 1SPJA 3GY2A 5IYTA 1Z8RA 3LC5A 3GISB 1VB7A 4ISLA 1C5UA 1RXPA 4B73A 2DKRA 2GDDA 2SGFE 5EGMA 4NZLA 2ZDAH 2VWOA 1SGEE 3PMJA 4WH6A 1MUEB 3IWMA 2L4TA 1QFKH 1LDTT 3KNXA 4X1NU 3SW2B 1O5CB 1W8BH 2NU0E 1AI8H 2P3UB 3I78A 1KIGH 3TJUA 1VCPA 3SUZA 3MI4A 1BCUH 3H7OA 2OSGA 3QLPH 1XM1A 3RXBA 5A2PA 3KHFA 1FDPA 1AB9C 1FN8A 4Q7ZA 3PROA 5HMAA 7KMEH 3ZYEA 1RTKA 5F8XA 2KQFA 4PQWA 4RN6A 5EPNA 3TIUA 1X7AC 2J2UA 2FI3E 1UK2A 1ZJKA 1YCPM 4AOQA 2PLXA 3MU1A 1ZHRA 1FUJA 3TITA 1GI2A 2J38A 1KTTB 3ATKA 3HGNA 3KEEA 4MPUA 1NC6A 3QUMP 3AAUA 4ZXYH 2ULLA 2A1DB 5DK1A 1PYTC 1J16A 2GV7A 1NS3A 1A7SA 2ZHQH 1GI0A 1GBLA 1GMCF 1P2OA 1J17T 2XC0A 1C5ZB 1HJAB 5I25A 3LGTA 1T4VH 2IPHA 1C2DA 1SGCA 2R0LA 4JOGA 2ZDVH 3SV9A 2ZDLA 4QT8C 5JB9S 2FI4E 1CQQA 1WUNH 1HDTH 3PTBA 1Y59T 1P06A 1QJ7B 2O8TA 1RTLA 3OYPA 4THNH 2SGQE 2GCTB 1G3EA 9ESTA 2SGAA 1AU8A 4GAWA 2Y82A 3SUFA 1MAXA 4CRDA 2G5MB 2FIRH 1CT4E 4ZAEA 2BD8A 4MPXA 5EYZA 4NIXA 5HEYA 1H1BA 1SBWA 2M0VA 1GQ4A 3ZZCA 2VVUA 4IBLH 1AFQB 1M5ZA 1TRNA 1UVPA 1IQEA 5T6GA 1FI8A 3HPKA 1UEWA 2J34A 3EA8A 2BDBA 1UCYE 2WV5A 4UFDH 1QB9A 2Y7XA 4X2YA 2AMDA 3MU0A 3RM2H 1DWEH 1O3KA 3M5LA 2FM2A 1MU6B 3ELAH 1P02A 2XBWA 2KOHA 3SNEA 3UTUH 1XUGA 5FBEA 3GCTG 4Q6SA 1ANCA 1WBGB 1GCDA 3CP7A 1RS0A 1FV9A 1YBOA 1GJ6A 2QF0A 2P95A 3A82A 1K1IA 1J9CH 2V6NA 3K65B 2JINA 2TGDA 1O2SA 2UUYA 1IQFA 1EXFA 1TNKA 5T6DA 1O2KA 1N7EA 2M0TA 3MO6A 4IN2A 1O2MA 2QV1A 3KQDA 2E7KA 1RD3B 3OTJE 1IQJA 4XHVA 3M5OA 4YOGA 1DY9A 1FY5A 4JORA 2Z3DA 1O39A 1K1OA 1FQ3A 3GDSA 2ZTXA 2I04A 1XVOA 2ZPLA 3GSLA 3ODDA 1CO7E 2I1NA 4H6SB 1X5QA 1N6EA 4Y7AA 1P09A 1NM6A 3FY5A 3U1JB 2ODQA 3SHAH 4CH2B 1NTEA 4Y6DA 1EKBB 1SGQE 4JL7A 3FAOA 1H9LB 3OX7U 1O3EA 2ANYA 1TONA 2ZO3H 1EQ9A 1F5RA 2P59A 3DFLA 5HFFA 1XXFA 4BAOB 1RIWC 2BZAA 1MKXK 2AFQB 1YCPH 1AB9B 2V3HH 1P2MA 1OBZA 1NRRH 1C1NA 2DUCA 4YLUA 1K2I1 1QBNA 2XBVA 5EODA 2F5YA 1B8QA 4FU9A 4XOJA 5CE1A 2ASUB 1ZLRA 2M10A 2FN5A 2F0AA 5E2PA 5I46H 2AMPA 2GT7A 4K5ZA 4AGJA 1W13U 6CHAB 2ZFPH 1YGCH 1CT0E 5A09A 4MPAA 3M3TA 1TBRH 4X2VA 1EJNA 1HV7A 7GCHF 4GCHF 2ZFTA 4UE7H 2PTNA 1SB1H 2CGAA 1UM7A 3M7TA 1TX8A 3RXGA 1TMTH 3MU4A 2LC7A 4JMYA 2WL7A 3ZV8A 4AYVB 5EXMA 2KL1A 2ZCKP 4CH8B 2XCNA 1HIAA 1VGCC 3VFEA 2AGEX 2SFAA 3F9GA 3PLBA 1EB1H 4WJG2 2REYA 2PW8H 1RTFB 2WPMS 3A7WA 1XKBC 2QN5T 1YLDA 5F8TA 4UU5A 3ZVDA 3QZQA 1WH1A 1E36B 1MZAA 2KAIA 1GBKA 2PUXB 4NMTA 1TOMH 2VIPA 2CSSA 4BTIB 3Q3YA 3VB7A 4E35A 1O3FA 5C2ZA 1ACBE 3I18A 4FUBA 3NFKA 1QAVB 1JBUH 3NZIA 1O37A 2STAE 3PDVA 2BLOA 3SV6A 5HDYA 2ZDKA 1FCFA 2EAQA 3M7UA 3FP8E 1BIOA 1C5WB 2KJDA 1HXEH 1VITH 2IWOA 2OQ5A 3K6ZA 1GHAF 1O2VA 4KP0A 4Q7YA 3PO1B 1Y5UT 2IN2A 3BG4C 1JRTA 2ZNKH 4I32A 3LJOA 3RXHA 4AFQA 4HI3A 1WTGH 4IC6A 3VQGA 2HWLB 1L4ZA 5H3JA 1CHOF 4DVAU 3CENA 5A0AE 1FAKH 1SLUB 5C1YA 3BF6H 3GY4A 4K6YA 1RJXB 1S0QA 1WOFA 2Y7ZA 1O3IA 1AE5A 3BTQE 1HAZB 5DP7A 4R8TB 2OQUA 1TNJA 1O2ZA 1S84A 1UITA 1GI7B 2PFEA 3P8GA 3ID4A 1S6HA 2BD3A 4XE4A 5GCHF 4ABEA 1LQDB 2F9BH 3A83A 1K1PA 5FHTA 1BBRE 2YOLA 1C5PA 2Z94A 4NSVA 1OWEA 3QE1A 4A5TS 3KL6A 2P8OC 2FNEA 4E3BA 4FUDA 1KDQA 2FS9A 4CHAB 3GY5A 2PKUA 1CBWC 5HFEA 5JBCS 1AN1E 1AQ7A 3BTEE 2W3KA 3MO9A 1RIWB 1FPCH 1D3PB 1GHBF 1GJCB 1GWAA 3M5MA 1V2RT 2FOEA 4B2BA 3P8OA 3MYWA 3ATLA 1MH0A 1N1LA 5JBAS 5EZ0A 2K20A 3F68H 1TAWA 2ODPA 2QXHA 2ZI2H 1P57B 1SQOA 2QY0B 1ZPZA 4IGDA 6ESTA 1DUEA 1NFXA 1QURH 1KTSB 1QIXB 2DLSA 4LOYH 2CS5A 4MNXA 3LIWA 1ZTKA 4CRBA 3PV5A 4FU7A 1O2TA 5A8XA 1YLCA 1UEQA 2BDGA 5EQQA 3NK8A 4ZHAA 4GVDA 1OP2A 2EJYA 3B23B 2ZA5A 2WYJA 2QGRA 4CRGA 3OSYA 2VINA 2Y81A 1O33A 3SBKA 2BXTH 4HZHA 1GMDF 1Z8IB 1DT2A 1IQLA 1WF7A 2HVXA 3A87A 3Q00A 2LC6A 4KTUA 1FJSA 4CREA 3BV9B 2JH5D 4NMPA 3HK6B 3UWJH 5FPSA 4B76A 1THSH 1MKXH 2AINA 1BTUA 1UCYK 3RXEA 5JBBS 1HCGA 1GI3A 1FIZA 1EZQA 2FPZA 4K78A 4Q6HA 1CSOE 2FTMA 4Q80A 1GM1A 1C5MD 1YC0A 2BX4A 4K3JA 3RXTA 1BTWA 3C1KA 2QF3A 3I29A 3RC4A 2GZVA 1XUFA 1LHCH 1V3XA 5DKMA 1NF3C 4X8VH 4CR9A 5HETA 4Y7BA 4K72A 1BMMH 1FY8E 1VCQA 2Z9LA 5A0BA 1HAHH 1MFGA 1P1EA 4EDJA 1Q3XA 1O3NA 1FIWA 3ZVCA 1THRH 1B7XB 2A31A 2A32A 1QY6A 2GKVE 3SU4A 1DOJA 1YBWA 2SGPE 1YPMH 4FU8A 4E7RG 5HXFA 5L30H 2JXOA 3ZVEA 1DDJA 1GHYH 1P9UA 4WH8A 4Q2QA 2HLCA 3QTOH 1UVTH 2V3OH 1DUAA 2CN0H 1XX9A 4YOIA 3S7HB 1O2GH 1ETSH 1H8IH 3LGIA 1ELFA 4A92A 1O35A 1U38A 1C4Y2 1I16A 4DIIH 1LVBA 3ZRTA 4X6NA 5T6FA 1FAXA 2P93A 2AEIH 3F9HA 4CRAA 1ORFA 2LA8A 1S82A 4U01A 5E0JA 1AVGH 2KPLA 1PYTD 5GIBA 2ESTE 1BOQA 4JCNA 2DM8A 4Y79A 2KG2A 5DTHA 4Q2PA 1JMOH 1V2TT 3VGCC 1MTVA 3RXAA 1IQIA 1UK4A 3A88A 1QLCA 2P8OB 4Y10E 1WHDA 2OINA 4MDSA 4FVDA 3GCHB 8GCHG 1FLEE 1BMNH 1OWKA 1P2JA 5G4BA 1P9SA 1MTUA 1UTOA 1U39A 2ZU5A 4OS4A 3ZZ4A 5JB8S 3ZZ6A 1MFLA 2ZFRH 2G4TA 5DG6A 3RU4T 2ZU1A 1EAWA 1PDRA 1KLTA 1IQNA 4TPYA 4ISIH 1IU0A 3TH3H 4TYDA 1C5YB 1EP6A 1LPKB 5HFBA 3F9EA 3A86A 1TMUH 2R3YA 2ZECA 1ZSKA 3QDZB 3QK1A 2GV6A 4TWWA 5A8YA 2H1UA 1C4V2 1NTPA 1VITF 2DB5A 2TIOA 3EAJA 1OXGA 4DY7B 2CMYA 1T8MA 3AW0A 3V7TA 3HKIB 3SV2H 1Z71A 1KXCA 2A5KA 1BRUP 5FCKA 3E91A 1BRCE 1SLVB 3F1SB 2G2LA 1TBQH 5GXPA 1PJPA 1CU1A 4AB8A 3RC6A 1TRYA 4ASHA 1A2CH 1TRMA 4Y11E 2ZCHP 1TLDA 1HRTH 1WQVH 3GOVB 2AS9A 3QZRA 4JZFH 3S9CA 3ATWA 4TY7A 4NXRA 1GBBA 3LOXA 2ZHFH 1SOZA 6LPRA 2PDZA 1N99A 1TGTA 4P0CA 1XKAC 3O5NA 1ZRBA 3KZEA 2V0BA 3RXLA 3D65E 1OWJA 2ALPA 2W7SA 2GCHF 5HM2A 1F92A 1VR1H 1SQAA 2YT7A 3T26A 2BY6X 4NWLA 2UUFB 3A7VA 4TPIZ 4I7YH 2HPQH 3TJNA 5DP8A 1TGNA 2Z3EA 3QN7A 2QT5A 4HTCH 2VRFA 2GVFA 3PDZA 4Z8JA 3GDUA 4ISOA 1T8LA 5IDKA 1SQTA 2SGEE 4WMDA 3R69A 3SJ8A 1D3QB 1ARCA 1SGFA 1Y7NA 2IWPA 3RLEA 4YYXA 4AYYB 3SU2A 3MNBA 2WPHS 5EQSA 3ZZ9A 5E21A 4Q3HA 1BZXE 1LQEA 1UJUA 1PPEE 2MHOA 3ID3A 5ABWA 1HXFH 6GCHF 2ZU3A 1NRNH 1C5TA 2WPLS 2VIQA 1XUJA 2BYAX 4D7FA 2EEIA 2I6QA 3KN2A 1UCYH 1Q7XA 1OWIA 1MU8B 2CF9H 4Z0KA 4NMSA 3MH5A 1C2JA 1OYQA 3DJAA 3SQEE 1Z8JB 1KLJH 1UTKA 4KKDA 1GDNA 5E0HA 2QKTA 1GJ4H 2B7DH 1G37A 1W11U 1NESE 1O30A 4UONA 1HNEE 4O06A 3SOSA 1EOLA 4OGYA 5TCAA 1K9OE 3VXEH 1GBFA 2AH4X 3ODFA 2FXRA 4REYA 2KOMA 1O34A 3CBXA 4F49A 1LPGB 3QGJA 1W7GH 3RXPA 3BG8A 2TGTA 4UFGH 5L2ZH 2ZPQA 4GHNA 2BY8X 5DPAA 1C9TA 2ZU4A 4ABJA 1K21H 1GJDB 1Z86A 1ABIH 3W94A 3K50A 2WINI 4B74A 2ZHDA 2K1QA 4JK5A 2BY7X 1UF1A 3H5CB 3BTWE 2RCEA 1N8OB 1AUJA 3BIVH 3TSWA 3M5NA 4NA7A 2VIOA 3D49H 3GY8A 3T29A 4ABDA 1UHBA 2Z9KA 1G9OA 5CHAC 4D9RA 2ILNA 2Y5FA 3PV2A 3ZZDA 2A5AA 1UJDA 1J15A 4NA8A 2QC2A 3FP7E 1ZPBA 3MWIU 1GDQA 1QNJA 3KGPA 3NKKA 1BDAA 2Z9GA 4ZHMU 1PPBH 1FXYA 3QGNB 4AZ2B 3E0NB 1SGTA 2RA3A 2ZU2A 5FX6A 2O8WA 1GBMA 1E38B 2ZTYA 3M61U 1GJ7B 3P92A 5ESBA 2OCVB 2DE8A 3PMBB 5E11A 1AWHB 1PPHE 2FOMB 4MTBA 4X1SU 3JZ2B 3S7KB 3T62A 3PWBA 1QRZA 3STIA 1ARBA 1P3CA 2QG1A 2EHRA 2BD2A 1NFUA 1ZGVA 3TSZA 1QJ6B 1FPHH 3MTYA 3TJOA 1NU7B 1GVLA 1BFEA 1JOUB 2K1ZA 4Y8YA 1WU1A 2XWBI 1DX5M 1A61H 3ZYDA 2NWNA 2I6VA 5C5NA 2KAWA 4NCYA 3W95A 4ZH8A 1TNHA 1ZSLA 3DA9B 4AN7A 1J8AA 1D4PB 1WIFA 1W12U 1ANEA 1P0SH 2BDHA 4ABHA 2XYAA 1C2MA 1O3AA 1F2SE 1RRKA 1AO5A 3EA7A 3KHVA 1EASA 1C2EA 2AGGX 1FZZA 1V2ST 3TU7H 2Z6BD 3TMHA 3A7TA 1WHAA 4WYUA 2F9PA 5I7ZA 2F9VA 2EGKA 2EXGA 1FY3A 3ATMA 3KIDU 4DJZB 3SOEA 2ZWLH 5EPYA 2BDIA 1UJVA 1OSSA 1A0LA 2FI5E 2FDAA 2VU8E 3DJ1A 2ZPMA 3LC3A 1V62A 1EZUC 5C1UA 3A8BA 3SGQE 3VB3A 3BTGE 1Y3VA 5FX5A 4GHTA 1O3MA 3SFJA 2H9HA 1LVOA 1IQHA 3NCLA 5LGOA 3WY8A 3ID2A 4MNWA 2C90B 1BHXB 1SGNE 1DSUA 3FP6E 3P8NA 4ESTE 2KJPA 3RXSA 4FUIA 1C2IA 4K8YA 4YOJA 4NNMA 1CGIE 1Q3PA 4N6XA 2EEKA 4DT7B 3CS0A 2P16A 5EXNA 3O8RA 1GI9B 1Y3WA 2M3MA 3F9FA 1GG6C 4ISNA 2PR3A 2YNAA 4KGAA 2AIPA 1P2QA 2DE9A 3VEQB 1HAVA 1QRXA 2FMJA 1ZOMA 3EGHC 5T3HA 1MAYA 4GHQA 1BMAA 2EGNA 4IMQA 3RXUA 1CGJE 1V6DA 3MNSA 3GGEA 5AHGH 1JRSA 1ZPCA 1GHAG 1UVOA 3TNTA 5HYOA 4ABAA 2GZ7A 4X1QU 1AHTH 3K6YA 2BHGA 1OYTH 3RC5A 1T2MA 1W3CA 2ZGJA 2PWXA 2F9OA 1T8OA 1V5LA 3QJNA 1D9IA 2RG3A 5PTPA 1O2LA 1UEPA 3SNAA 2AYWA 5SGAE 2H2BA 2R2MB 3SZNA 2X7ZA 2BM2A 5GNDA 3MH4A 2Q9VA 1TPOA 2VGCC 4AFZA 5HM9A 4ZROA 1LVYA 3LKWA 1SMFE 2QXGA 2UWOA 2OGPA 1Y5AT 1L2EA 1IU2A 3SNBA 3AW1A 3GYMA 5J4QA 3P95A 4X6PA 3BN9A 1OKXA 2QKVA 2TPIZ 2A7HA 4O3UA 1C2GA 1V2KT 1ANDA 5C67A 1YPLH 4FUCA
chains in the Genus database with same CATH superfamily
3S9AA 1ZTLA 2W4FA 2ZFSA 3GY7A 3PWCA 3PYHA 4Y0ZE 4AGKA 5LH8A 4D8NA 1F7ZA 1F5LA 1O3DA 2BXUH 2EEJA 2BY5X 1HLTH 2OUAA 2ZEBA 3RLWH 1BA8B 3SU1A 2A4GA 4H11A 1GHVH 2O8MA 1T8NA 1OWHA 1G3BA 3RXFA 2R9PA 1LHGH 1HUTH 2LOBA 2NU4E 5E1YA 3ZZAA 2Z3CA 1N6FA 7ESTE 1CE5A 2QYIA 1P2IA 4DCDA 4Y76A 3U69H 4HFPB 4YZUA 1OP0A 1NRPH 4NIYA 1TMBH 1QQUA 5GPIB 1NPMA 1TGBA 1Y3UA 3R0FA 3UNQA 1VKYA 2KOJA 2GTBA 1L6OA 1HB0B 3K82A 3SV8A 3URCA 2GGVB 9LPRA 1ESTA 2BD9A 1XXDA 1Y5BT 2BVXH 1UVUH 2G52A 2FOGA 4A1TA 2KBSA 1LVMA 1LO6A 1K22H 1B0FA 4WVPE 4RT1A 2YNBA 3LONA 2EDVA 4MVNA 4FXGH 1C5NH 3NWUA 1MBMA 1UTPA 3SUGA 1HJ9A 1DLEA 2PNTA 5ILBA 3ZVAA 4X8SH 2XC4A 5D13A 1YPHC 2G51A 1HYLA 1F0UA 2KCAA 3TPIZ 1YF4A 3GCTF 2ZDNA 1FMGA 1JXPA 4RKJB 4OAJA 2FOHA 2BLVA 1XUKA 2QAAA 1X8SA 2QBWA 1ELDE 3SGBE 1D5GA 4NMRA 2FEQH 3M3SA 1C1OA 2XW9A 3SZEA 3JZ1B 1AD8H 3LGWA 5FAHA 1EB2A 3TGIE 1F0RA 4ISHH 3DT0H 3SU3A 1Z8GA 2A4OA 2QF5A 1AZZA 3UPEA 2OBOA 3Q3KA 1ZHMA 2Q6FA 2W7RA 4ACBA 1COWD 1YPGH 3VXFH 2H5CA 1G30B 4WMFA 2JILA 3KDGA 4B71A 5CDFE 3GDVA 3BTME 4YESB 3FO8D 3TH2H 1EPTC 3A7YA 3L6PA 2XRCA 3DJ3A 3U8OH 1C1PA 1MZDA 3RP2A 1GBDA 4UFFH 4BAQB 1SFQB 1DLKB 5GDSH 5FB8C 1QHRB 1RZXA 2JETC 4UU6A 3GY6A 1N6YA 2WPDD 2OQSA 1EPTA 4INKA 1H4WA 2NU3E 1P8VC 2PKAA 2UUJB 1DPOA 2BY9X 8KME2 4FUFA 1C1VH 2HOBA 1BMFD 4I8JA 5F03A 8LPRA 2EDPA 1O3OA 1YYY1 1ZMLA 4FETA 4WYTA 3S9BA 2J9NA 5DP5A 3RMMH 4NNLA 3BPUA 4KFWA 1W0ZU 4G69A 2D26C 5C1XA 2TRMA 2TGAA 3SJIA 2DMZA 5JDUB 4OS6A 4NA9H 2OZFA 1ELTA 3BTDE 2IJD1 1BT7A 4RKOB 3KQEA 1Z1JA 1YM0A 5EW1H 1BB0B 2CK3D 2VJ1A 1W9EA 1Y3YA 2B8OH 2C8YB 3ZZ3A 1TE0A 3RDZA 1TIOA 1HAOH 1TGCA 1AKSA 1SC8U 1RGQA 1ESAA 2QXJA 1FONA 1UJ1A 1HIAB 4B2CA 3OEED 1MTNC 3SNCA 5A2MH 1BRBE 1VCWA 3V12A 4F55A 4NXPA 4E05H 1GJAB 5FPTA 2ODYB 2W6JD 2ZTZA 1SVPA 2C3SA 3RXCA 1LCYA 1HAPH 2KAIB 3NCVA 3R68A 1NFYA 3RXVA 1VGCB 1N6XA 1E0FD 2Q3GA 1GHWH 2RA0A 2BD4A 2NU1E 3VB4A 4A1XA 3STJA 1C2HA 4AORA 5AFZH 4HOPA 1MC7A 2THFB 3P17H 4I8HA 1Z87A 2AERH 3L33A 5HEBA 4X8TH 3SU6A 4YTAA 2GEFA 1IQMA 2QE7D 1U6QA 1DS2E 1W0KD 1ANBA 4A6LA 3UNRA 1WQSA 3UQOA 4JYUH 4FUJA 1LHEH 1PPGE 4JOKA 3TJVA 4UEHH 2KZ4A 4R2ZA 4Y0YE 1IAUA 1O38A 2J92A 1O5AB 1GHXH 3VQFA 3PRDA 2PSXA 1Q2WA 3BSQA 1DANH 1NZQH 2PTCE 3LGUA 2ZGCA 1OBYA 5LPFA 4TSFD 3TK6A 2BOHB 1UTNA 5F3XA 3H7TA 2C4FH 1KXAA 3BG4B 1ZOKA 3PRBA 1O2XA 3U98H 2QXIA 4GSOA 2FP7B 2H3LA 4ZKSU 1BTHH 1YKTA 1BTXA 1KXBA 4NG9H 4AG2A 1TP3A 1JIMA 5HIZA 1TNIA 3RXDA 2XBYA 4CRFA 5KEDA 2KPKA 2G00A 1V2QT 2BVSH 2R0KA 1QA7A 4Z1MD 2PV9B 5EG4A 1C9PA 1SFIA 3FVFB 3ZZ5A 2A5IA 4JZIA 2EEHA 2LUIA 3T2NA 1DWBH 1KDQB 1KWAA 3ZVBA 1WFVA 2O8LA 3RXMA 1QTFA 6GCHG 1QBVH 5EQRA 1LHFH 4IC5A 4BOHA 2WPJS 2WZQA 5L6NH 1QL8A 3S0NA 3JXTA 3I1EA 1L0ZA 3RXKA 1UHPA 1MCVA 3F6UH 1AWFH 2PGQB 2SNWA 3OY5U 2BZ6H 4XBDA 5AVDA 4WY3A 3O46A 3UWIA 1WCZA 5AF9H 1CBWB 1TP5A 2TBSA 2VIDA 4MG3A 3RMLH 1TWXB 2ENOA 1FN6A 4AG1A 3PV4A 2HE4A 1SR5C 1BJVA 4YDPA 1O2NA 3LPRA 5DJ7A 4BNRA 1EAXA 5GLJA 1UTJA 2IWNA 2ZG0H 1F5KU 2V1WA 3O8BA 2XCFA 2ZIQH 3AVZA 3LU9B 3Q3XA 4BTTB 3BEUA 4VGCC 5DN6D 2JH6D 2G5VA 1GI8B 5TJXA 1C1RA 3ITIA 3KQCA 1UTMA 1EOJA 3UNSA 3Q76A 4FOUC 4UFEH 4TY6A 5TCCA 3M36A 1FC9A 2ZF0H 2D2DA 3QWCH 3MOCA 5JPMH 1S0RA 3RXQA 1SGPE 1GI6A 3DIWA 1G32B 1YLNA 1NO9H 1O2OA 5EJLA 1PQ7A 1LPZB 1YWUA 2KA9A 1SOTA 2WUCA 4YLQH 1DWDH 1O2IA 2OP9A 1A5IA 4NGAH 2FESH 1S83A 1ELAA 4H4FA 1GBHA 4RSPA 2VPHA 2P3WA 1DM4B 1EP5A 1ZYOA 4F8KA 2VWLA 3EGKH 4LZ4B 2Y6TA 3PM3A 1C4U2 4J1YA 2J97A 1E34B 3KF2A 3SI4H 3P70B 4ABFA 2OC8A 2QCYA 2WUBA 2BB4A 1KXDA 2J95A 1NRQH 1MQ6A 4NFEA 3IITA 4JK6A 1ID5H 2QIQA 4H42U 4XRNA 1MMJN 1O31A 1TQ0B 3D62A 1V2OT 4MNVA 4Y8ZA 5HF1A 2EI6A 1Z1IA 1PPFE 1L1NA 1N7FA 1WYKA 2RCZA 3RXRA 2Y5HA 4NMVA 4NFFA 1GMCG 1HJAC 2YTWA 3D23A 3ZZ8A 1WJLA 1O2RA 3ZZBA 1DVAH 1P04A 3OU0A 3RL8A 1BITA 1KLIH 2BQ6B 3V0XA 1C1TA 2AHME 3PLPA 1V2MT 3V13A 3UOUA 2GCTC 3RM0H 3GY3A 1O2UA 2BDYA 4X2WA 4YT6H 1CA0C 3A80A 2FWWA 1A1RA 5EW2H 1BBRK 1C1QA 2HGTH 1TABE 3NPSA 1V5QA 2OS6A 1ETRH 1O5BB 1G9IE 1SGDE 2OC1A 1ZHPA 1C5XB 1GBIA 3V3MA 1PQAA 3L3TA 2EQNA 3MU8A 2UWLA 1V2JT 3VGCB 1OHHD 2JSNA 3M37A 1O3HA 2FE5A 2JREA 3KYGA 4NZQA 2F83A 3A7ZA 4Q2NA 1GBEA 1K1LA 1S81A 1UTLM 8GCHF 2G4UA 2H6MA 1LKAA 3SJKA 4GUXA 2FX4A 4K75A 1ZJDA 3AAVA 3A8CA 1LKBA 1A46H 2CF8H 4MLFB 2PUQH 1JIRA 4A1VA 4NIWA 1NROH 2W26A 2G81E 3NGHA 5DP4A 4O03A 2GX4A 4I8LA 1MQ5A 4OEPA 1V2LT 2YUBA 1F0TA 4BXWA 1NN6A 1T7CA 4YT7H 4JOHA 1W2KH 1O3GA 2ZDMA 3KQBA 3DUXH 2FOAA 1SG8B 4NMQA 2ZQ2A 2M5TA 1OS8A 1SL3A 3DD2H 1CVWH 5G1EA 2Q6GA 4UDWH 2PSYA 3T25A 2C93B 1T32A 3E8LA 4OS7A 5F67A 1N7TA 3UOPA 2W7UA 3BTFE 1FY1A 3LGVA 5KGOA 2L97A 3HGPA 1VJ9U 4A7IB 2PA1A 2LELA 3E6PH 2C8WB 2EI7A 2JWEA 3RXJA 4WXVA 1TALA 5E0GA 4GPGA 1O5GH 4I8GA 1W0JD 1AVWA 1ZGIA 2R2WU 4B6FA 1WSSH 2EI8A 1O2HA 4NIVA 4AMHA 1QB1A 3CBZA 2BDAA 1MTWA 1C2LA 3BIUH 1O0DH 1E1RD 2D90A 4IN1A 5C0TA 1EATA 2D8IA 1K28D 2A7CA 1NY22 1P1DA 3EYDA 4KFVA 3A8DA 4GVCA 3RXOA 2JKHA 4DURA 1E37B 1GDUA 3G01A 3GS9A 5EXLA 2DJTA 1GMHF 1R6JA 2EA3A 4HGCA 3A84A 6CHAC 5HEDA 2J94A 1Z6JH 2IWQA 2H9EH 3EE0B 1PQ5A 5AFYH 3UB0A 1GGDC 4Q2OA 3ZIAD 1GL0E 4AC9A 5C0UA 1G36A 7LPRA 3MHWU 1OPHB 4E7NA 1G3DA 2SNVA 5F6MA 1A5HA 2FZZA 4JZDH 2CSJA 7GCHG 4GCHG 3SUEA 4ZHLU 1MCTA 2YMSC 1MD8A 2GZ8A 4RI0A 1HFDA 3OY6U 4I8KA 1TQ3A 2AWUA 2OC7A 3FOAA 3LH3A 1O3CA 1WI4A 3U9AH 3A81A 4P2AB 1WV7H 2WYGA 3OTPA 2JJ2D 2BX3A 1CA0B 1IQKA 4BTUB 1MABB 1N6DA 2EC9H 1H9HE 2IOTA 1LMWB 1DE7H 2F9UA 4ZKOU 3SHUA 1ELEE 3MFJA 4ZUHA 1IOEA 1D3TB 2BYGA 4IS5A 3SORA 5E6PB 2UZCA 3KDKA 1C5OH 5C20A 1FNIA 2FO9A 2XC5A 4XBCA 4ZKRU 4JOJA 4BAHB 1AZ8A 4Q4LA 5HKKD 3HATH 2GD4B 3UR6A 5C3NA 1AIXH 2OD3B 3A89A 4BXSA 4X6MA 1SLWB 1EZSC 2Z17A 3UY9A 1PFXC 1QAUA 1AFEH 1P12E 1TPPA 1QAVA 1EUFA 2FTLE 1A0HB 1RY4A 1TNGA 4AX9H 4ZKNU 3I77A 3PO1C 1RGWA 2KYLA 2R4HA 1K1JA 2CHAC 4KTCA 4IW4E 2VWRA 1CT2E 3U1IB 1UHBB 4LZ1H 4JYVH 1FC6A 3DORA 2M0ZA 1L1JA 3K2UA 3SNDA 2FOFA 3GCOA 2PKSC 4JZEH 5CMXH 3TLOA 1G3CA 1BRAA 4MPWA 1V2PT 1BBRH 2WSSD 5DGJA 4F4OC 1GCTC 2V3MA 2I0IA 1CHOG 3FZDA 2AIQA 3UREA 4WWYA 5EOKA 1ELGA 5CHAB 1TPSA 3BTKE 2HNTE 2G55A 3VPKA 4K8BA 2BD5A 1DWCH 3EGGC 2BQ7B 3PB1E 1M9UA 3PMHB 2FCFA 3CC0A 4JZ1A 2GZ9A 3B8JA 3BEIB 3WWFA 1C5SA 2QA9E 1MKWK 5HFDA 3QIKA 5GCHG 3DFJA 1O2WA 1WF8A 4ZCNA 2FODA 3QO6A 4XSKU 2F9NA 3FANA 1TX7A 1QJ1B 1RGRA 1H9IE 4CHAC 1VJ6A 2P94A 3N99A 1C1MA 2KX4A 1YPHE 3TK9A 2WHXA 1QQ4A 5B6OA 2QF4A 3E16B 4O97A 1GHBG 2O2TA 2GDEH 2R3UA 4I33A 1H8DH 2ZPRA 1P11E 1ZRKA 1BMLA 3LH1A 3L4FD 1NRSH 2F3CE 2EGOA 3PMAB 1DITH 1YY3A 2H2ZA 1H8ED 2MX6A 4NWKA 1SGYE 1TYNA 2Y5GA 4LXBH 1O36A 1V2VT 2Z9IA 4Y8XA 3SI3H 2ZHEH 5HGGA 2HE2A 3F3BA 2XWAA 2FYQA 4ZXXH 2VSPA 1GGDB 2I4SA 1QB6A 3QDOA 2ANWA 4SGAE 3CBYA 1O3LA 2HNTC 3MU5A 1KSNA 1C1SA 2HNTF 1BUIA 1AMHA 3FZZA 3QX5H 1K32A 4ACAA 2GMTC 1TA6A 4JJ3A 4KTSA 1GBCA 2P3FH 2CJIA 2M2AA 1GMDG 5T1VA 4XDEA 2IJOB 5DO4H 2W3IA 1YPEH 4Z33A 1W10U 1XUHA 3PTNA 1YP9A 5H4IB 3NXPA 1O2QA 2Y80A 4GVUA 2BDCA 3TGKE 1ETTH 2ZZUH 1TGSZ 1G2MA 1HPGA 2ZQ1A 3QTVH 3PS4A 5BRRE 2YUYA 1L4DA 3ATIA 5F8ZA 4L8NA 3RU4D 3W1EA 1HAVB 3SGAE 2VVVA 1CHGA 1W7XH 2GP9B 3VB5A 5GJ4B 1ESBA 2ANMH 2ZCLP 1EZXC 3LNXA 1GG6B 1PQ8A 1MD7A 1WAYB 3BEFB 1W9OA 2PHBA 5DP6A 3CH8A 3UQVA 2KRGA 2OLGA 1PPZA 3CYYA 2NU2E 4D9QA 3RL7A 5LPRA 2ZKSA 2BLQA 4K1SA 4SGBE 2XTTB 3GICB 4FGMA 1GVKB 2BQWB 2CHAB 4MNYA 4INHA 4TWYA 5C5OA 2UWPA 2AWWA 1S85A 5ESTE 4AFSA 4FUEA 1UEZA 3KCGH 1D6RA 2PKSB 1VJAU 3UR9A 3LT3A 1OZIA 4MPVA 1BTYA 1GCTB 3M3VA 2H9TH 2KV8A 3MH6A 3K1RA 1GBAA 2A0QB 4NMOA 2VGCB 4KELA 4CBOA 1ZMJA 3RXIA 4AFUA 2I0LA 3E3TA 1E35B 1HAGE 2K0QA 4Q7XA 5J4SA 1YPKH 1P01A 3KZDA 1GVZA 1TFXA 4WF8A 4O3TA 4E06H 5L2YH 1ZR0A 2CXVA 2O9QA 4X6OA 2FOCA 3A8AA 3LJJA 2HRVA 3VB6A 5E22A 3T5FH 2VH0A 2Z7FE 4X8UH 1DSTA 4IMZA 4U32A 5HJ1A 4I31A 2A45B 2J5UA 2F4LA 1ABJH 1KYNA 2PGBB 1LTOA 3GCHC 4D76A 3ZV9A 2C8ZB 3IG6B 3ZZ7A 1C2KA 5EIYA 2DLUA 5E2OA 1O3BA 3BTHE 1L1GA 2I6SA 2V7QD 2FX6A 1A3EH 1A5GH 1C1WH 5KECA 5HFCA 4B75A 1UK3A 3ENSB 1V2UT 1KY9A 1NU9A 3HK3B 4X1RU 1X6DA 2L4SA 3K9XB 3MO3A 2H3MA 1SHYA 1W0YH 2PP6A 2VIVA 1K1MA 3P8FA 4OS5A 2A4QA 4PROA 2M0UA 1VA8A 5DSFA 5BPEA 1X5NA 2J4IA 5G1DA 1X5RA 1TOCB 1UMAH 3ZVFA 1UM1A 1BTZA 2PKTA 3URDA 2K8IA 4DIHH 1VITG 1FC7A 1UTQA 1AY6H 3VG8A 1TB6H 4O9VA 2EEGA 1MKWH 4U30A 2OXSA 3RUOA 1KXFA 2GMTB 1GQ5A 1MTSA 1A0JA 3Q77A 1J14A 3TVJB 1SHHB 1EX3A 2OTVA 3CS7A 4OS1A 4WMEA 3ID1A 1QBOA 1XZ9A 4B1TA 3UIRA 2ALVA 1O2PA 2V35A 4BAMB 1GPZA 1W9QA 2B0FA 4XD7D 4ABIA 5A0CA 1LHDH 3TGJE 2VZ5A 1AGJA 1Y3XA 1GI1A 1ELVA 1GBJA 1GJ5H 1Q31A 3LGYA 5DP3A 3GJ9A 3ESTA 1NT1A 5FPYA 3QGLA 1D3DB 5FXLA 5K0HA 2VB0A 3C27B 1ZSJA 2BVRH 5K7RA 2FLRH 4MQAA 1INCA 2H2CA 1OWDA 1P05A 2GCHG 2WPIS 3MNCA 4LK4A 5JXBA 4U2WA 2C8XB 1EAUA 2XNDD 3R3GB 1ELBA 3ZVGA 1V2WT 1THPB 4Q2KA 1SGFG 2STBE 2XXLA 1VAEA 3MH7A 1EJMA 1IHTH 2VIWA 4CR5A 1V6BA 3E1XB 4AB9A 3P6ZB 2OC0A 4XBBA 3SV7A 1TPAE 2A4RA 3PLKA 2FOBA 1ZUBA 3RU4E 1UFXA 1GJ9B 4LMMA 1X45A 2VBCA 2PZDA 3F2HA 3AASA 4K60A 8ESTE 3A85A 1QRWA 4K1TA 1S5SA 1MBQA 4DGJA 2JIKA 2WPKS 2A2QH 1EPTB 1Y8TA 2QKUA 2WV4A 2OBQA 5GWZA 2EDZA 3LNYA 1UVSH 1HJ8A 2PKAB 3EDXB 1DXWA 1B5GH 4JOEA 1DXPA 3E17A 1EAIA 1SI5H 2ZP0H 2JETB 5JBTA 1P03A 4D7GA 2VH6A 3SQHE 2D92A 3TH4H 4DG4A 2LPRA 4XFQA 4JOPA 2B9LA 2G5NA 3T28A 2OCSA 1GJ8B 1NFWA 1O5EH 3SHCH 1AUTC 4Z6AH 2YT8A 1HGTH 1XMNB 3U8RH 2D8WA 2G8TA 1C5VA 3QJMA 3SU5A 3NUMA 4P02A 4R0IA 1VZQH 2FYRA 4ABGA 1K1NA 2YMSD 2H5DA 3OEHD 1AKSB 1T31A 2KJKA 3HVQC 1OP8A 2B5TB 4JOFA 4DW2U 5ETXA 3LDXH 1GBTA 1O32A 1Q3OA 4J2YB 3HPTB 1QA0A 2XNIA 4E34A 2TGPZ 4UD9H 2A7JA 2Z9JA 3B9FH 5FL7D 4FUHA 2KR7A 1RFNA 4K1EA 4YM9A 1QR3E 1DFPA 1B0EA 1MTNB 1TBZH 1WFGA 3FKSD 1A4WH 2ZC9H 4HOPB 1DICA 1N8OC 2P3TB 1U3BA 2VWNA 1TX6A 3KQ5A 1I92A 2FS8A 1KXEA 1TNLA 1V2NT 2BTCE 4X1PU 1IHJA 4X2XA 2V90A 1OOKB 2ZGXH 2BD7A 2JH0D 4JJ0A 1PPCE 2VNTA 5EU8A 1T4UH 1SGRE 3U8TH 4NSYA 3E0PB 4ASUD 4OEOA 1QGFA 4H6TA 3N7OA 3TNSA 1O5DH 1P2KA 2SGDE 3SU0A 1ELCA 1O2YA 3F0OA 2Q1JA 3UFAA 1XUIA 4YO9A 1UW7A 2AWXA 2DAZA 2OMJA 5B6LA 1TQ7B 4JYTA 2BOKA 1U37A 1CGHA 4OS2A 3SJOA 2VSVA 1SGIB 1O3PB 3RMNH 5A8ZA 5C17A 1QL9A 3B76A 4NXQA 5HF4A 1V1TA 2DC2A 1BQYA 5JYIA 1Z6EA 3M35A 5E8EH 1D6WA 1S6FA 4CBNA 1HAIH 1GJBB 3UUZA 4Y71A 1O3JA 1P2NA 1QCPA 1SSXA 2RDEA 4BAKB 4K76A 2LNCA 2ZFFH 1GMHG 1GL1A 2ZGBH 3O8DA 2CV3A 3E90B 1WG6A 2ZFQH 3MMGA 4ZMAH 2AMQA 1ZZZA 4FVBA 1P3EA 2D1JA 1O2JA 1SLXB 1OBXA 3TSVA 4B2AA 3DHKH 1JWTA 3WW7A 3T27A 1FY4A 3WKMA 2XBXA 1W14U 1GI5A 2O8UA 3HPMA 4CRCA 2F91A 3GABA 4K69A 3RMOH 1CA8B 3O8CA 3SHWA 5CHBA 1HAXB 4WXIA 1AFQC 3FFGA 1HBTH 3A7XA 1AVXA 4K2YA 4GLYA 5LPEA 1BE9A 2BLWA 3SJ9A 3I4WA 1UO6A 1IHSH 2ZHWH 2RRMA 2ZPSA 1F0SA 3GCNA 1O5FH 1ZTJA 3S69A 2HALA 1C5QA 1HAYB 1BJUA 1KEFA 1A3BH 2BMGB 1P10A 1IQGA 1EJAA 2ZGHA 3RLYH 5FBIA 1WI2A 3TK5A 2HPPH 4FUGA 5C94A 2GT8A 1TA2A 1Z7KA 1BHXF 2ANKH 1ZMNA 3R0HA 3GYLB 3SUDA 1C5RA 1YPJH 3M7QA 1QL7A 4INLA 2VWMA 2EV8A 1OX1A 2JOAA 3EQ0H 1DY8A 1WTHD 3SO3A 1XVMA 3SN8A 1X9ZA 1G2LA 2OPGA 3BTTE 2FLBH 3MNXA 1C5LH 2Q6DA 1AE8H 3AXAA 3NFLA 3WKLA 1YCPK 1GHZA 3HKJB 4DOQA 4OGXA 2UUKB 1C2FA 1E1QD 2W5EA 3EA9A 4BANB 1C1UH 4ABBA 4VGCB 2RDLA 5FCRA 2A2XH 4X0WU 5DP9A 4M7GA 1GI4A 1S6LA 2AGIX 2VVCA 1BTPA 2HGAA 1SPJA 3GY2A 5IYTA 1Z8RA 3LC5A 3GISB 1VB7A 4ISLA 1C5UA 1RXPA 4B73A 2DKRA 2GDDA 2SGFE 5EGMA 4NZLA 2ZDAH 2VWOA 1SGEE 3PMJA 4WH6A 1MUEB 3IWMA 2L4TA 1QFKH 1LDTT 2JIZD 3KNXA 4X1NU 3SW2B 1O5CB 1W8BH 2NU0E 1AI8H 2P3UB 1E79D 3I78A 1KIGH 3TJUA 1VCPA 3SUZA 3MI4A 1BCUH 3H7OA 2OSGA 3QLPH 1XM1A 4YXWD 3RXBA 5A2PA 2JDID 3KHFA 1FDPA 1AB9C 1FN8A 4Q7ZA 3PROA 5HMAA 7KMEH 3ZYEA 1RTKA 5F8XA 2KQFA 4PQWA 4RN6A 2L6OA 5EPNA 3TIUA 1X7AC 2J2UA 2FI3E 1UK2A 1ZJKA 1YCPM 4AOQA 2PLXA 3MU1A 1ZHRA 1FUJA 3TITA 1GI2A 2J38A 2J98A 1KTTB 3ATKA 3HGNA 3KEEA 4MPUA 1NC6A 3QUMP 3AAUA 4ZXYH 2ULLA 2A1DB 5DK1A 1PYTC 1J16A 2GV7A 1NS3A 1A7SA 2ZHQH 1FX0B 1GI0A 1GBLA 1GMCF 1P2OA 1J17T 2XC0A 1C5ZB 1HJAB 5I25A 3LGTA 1T4VH 2IPHA 1C2DA 1SGCA 2R0LA 4JOGA 2ZDVH 3SV9A 2ZDLA 4QT8C 5JB9S 2FI4E 1CQQA 1WUNH 1HDTH 3PTBA 1Y59T 1P06A 1QJ7B 2O8TA 1RTLA 3OYPA 4THNH 2SGQE 2GCTB 1G3EA 9ESTA 2SGAA 1AU8A 4GAWA 2Y82A 3SUFA 1MAXA 4CRDA 2EY4C 2G5MB 2FIRH 1CT4E 4ZAEA 2BD8A 4MPXA 5EYZA 4NIXA 5HEYA 1H1BA 1SBWA 2M0VA 1GQ4A 3ZZCA 5B42A 2VVUA 4IBLH 1AFQB 1M5ZA 1TRNA 1UVPA 1IQEA 5T6GA 1FI8A 3HPKA 1UEWA 2J34A 3EA8A 3SYJA 2BDBA 1UCYE 2WV5A 4UFDH 1QB9A 2Y7XA 4X2YA 2AMDA 3MU0A 3RM2H 1DWEH 1O3KA 3M5LA 2FM2A 1MU6B 3ELAH 2KM0A 1P02A 2XBWA 2KOHA 3SNEA 3UTUH 1EFRD 1XUGA 5FBEA 3GCTG 4Q6SA 1ANCA 1WBGB 1GCDA 3CP7A 1RS0A 1FV9A 1YBOA 1GJ6A 2QF0A 2P95A 3A82A 1K1IA 1J9CH 2V6NA 3K65B 2JINA 2TGDA 1O2SA 3AK5A 2L74A 2UUYA 1IQFA 1EXFA 1TNKA 5T6DA 1O2KA 1N7EA 2M0TA 3MO6A 4IN2A 1O2MA 2QV1A 3DSOA 3KQDA 2E7KA 1RD3B 3OTJE 1IQJA 4XHVA 3M5OA 4YOGA 3EE7A 1DY9A 1FY5A 4JORA 2Z3DA 1O39A 1K1OA 1FQ3A 3GDSA 2ZTXA 2I04A 1XVOA 2ZPLA 3GSLA 3ODDA 1CO7E 2I1NA 4H6SB 1X5QA 1N6EA 4Y7AA 1P09A 1NM6A 3FY5A 3U1JB 2ODQA 3SHAH 4CH2B 1NTEA 4Y6DA 3CNRA 1EKBB 1SGQE 3NRLA 4JL7A 3FAOA 1H9LB 5EJZA 3OX7U 1O3EA 2ANYA 1TONA 2ZO3H 1EQ9A 1F5RA 2P59A 3DFLA 5HFFA 1XXFA 4BAOB 1RIWC 2BZAA 1MKXK 2AFQB 1YCPH 2XOKD 1AB9B 2KCYA 2V3HH 1P2MA 1OBZA 1NRRH 1C1NA 2DUCA 4YLUA 1K2I1 1QBNA 2XBVA 5EODA 2F5YA 1B8QA 4FU9A 4XOJA 5CE1A 2ASUB 1ZLRA 3UAIC 2M10A 2FN5A 2F0AA 5E2PA 5I46H 2AMPA 2GT7A 4K5ZA 4AGJA 1W13U 6CHAB 2ZFPH 1YGCH 1CT0E 5A09A 4MPAA 3M3TA 2KCPA 1TBRH 4X2VA 1EJNA 1HV7A 7GCHF 4GCHF 2ZFTA 4UE7H 2PTNA 1SB1H 2CGAA 1UM7A 3M7TA 2YMSB 1TX8A 3RXGA 1TMTH 3MU4A 2LC7A 4JMYA 2WL7A 3ZV8A 4AYVB 5EXMA 2KL1A 2ZCKP 4CH8B 2XCNA 1HIAA 1VGCC 3VFEA 2AGEX 2SFAA 3F9GA 3PLBA 1EB1H 4WJG2 2REYA 2PW8H 1RTFB 2WPMS 3A7WA 1XKBC 2QN5T 1YLDA 5F8TA 4UU5A 3ZVDA 3QZQA 1WH1A 1E36B 1MZAA 2KAIA 1GBKA 2PUXB 4NMTA 1TOMH 2VIPA 2CSSA 4BTIB 3Q3YA 3VB7A 3MQKC 4E35A 1O3FA 5C2ZA 1ACBE 3I18A 4FUBA 3NFKA 1QAVB 4OM9A 1JBUH 3NZIA 1O37A 2STAE 3PDVA 2BLOA 3SV6A 5HDYA 2ZDKA 1FCFA 2EAQA 3M7UA 3FP8E 1BIOA 1C5WB 2KJDA 1HXEH 1VITH 2IWOA 2OQ5A 3K6ZA 1GHAF 1O2VA 4KP0A 4Q7YA 3PO1B 1Y5UT 2IN2A 3BG4C 1JRTA 2ZNKH 4I32A 3LJOA 3RXHA 4AFQA 4HI3A 1WTGH 4IC6A 3VQGA 1NBMD 2HWLB 1L4ZA 5H3JA 1CHOF 4DVAU 3CENA 5A0AE 1FAKH 1SLUB 5C1YA 3BF6H 3GY4A 4K6YA 1RJXB 1S0QA 1WOFA 2Y7ZA 1O3IA 1AE5A 3BTQE 1HAZB 5DP7A 4R8TB 2OQUA 1TNJA 1O2ZA 1S84A 1UITA 1GI7B 2PFEA 3P8GA 3ID4A 1S6HA 2BD3A 4XE4A 5GCHF 4ABEA 4HG6A 1LQDB 2F9BH 3A83A 1K1PA 5FHTA 1BBRE 2YOLA 1C5PA 2Z94A 4NSVA 1OWEA 3QE1A 4A5TS 3KL6A 2P8OC 2FNEA 4E3BA 4FUDA 1KDQA 3WWBA 2FS9A 5IK2D 4CHAB 3GY5A 4P00A 4DT4A 2PKUA 1CBWC 2HLDD 5HFEA 5JBCS 1AN1E 1AQ7A 3BTEE 2W3KA 2GJGA 3MO9A 1RIWB 1FPCH 1D3PB 1GHBF 1GJCB 1GWAA 3M5MA 1V2RT 2FOEA 4B2BA 3P8OA 3MYWA 3ATLA 1MH0A 1N1LA 5JBAS 5EZ0A 5IL9A 2K20A 3F68H 1TAWA 2ODPA 5F53A 2QXHA 2ZI2H 1P57B 1SQOA 2QY0B 1ZPZA 4IGDA 6ESTA 1DUEA 1NFXA 1QURH 1KTSB 1QIXB 2DLSA 4LOYH 2CS5A 4MNXA 3LIWA 1ZTKA 4CRBA 3PV5A 4FU7A 1O2TA 5A8XA 1YLCA 1UEQA 2BDGA 5EQQA 3NK8A 4ZHAA 4GVDA 1OP2A 2EJYA 3B23B 2ZA5A 2WYJA 2QGRA 3FN8A 4CRGA 3OSYA 1K0HA 2VINA 2Y81A 1O33A 3SBKA 2BXTH 4HZHA 1GMDF 1Z8IB 1DT2A 1IQLA 1WF7A 2HVXA 3A87A 3Q00A 2LC6A 4KTUA 1FJSA 4CREA 3BV9B 2JH5D 4NMPA 3HK6B 3UWJH 5FPSA 4B76A 2OK5A 1THSH 1MKXH 2AINA 1BTUA 2W6ID 1UCYK 3RXEA 5JBBS 1HCGA 1GI3A 1FIZA 1EZQA 2FPZA 3DCLA 4K78A 4Q6HA 1CSOE 2FTMA 4Q80A 3H09A 1GM1A 1C5MD 1YC0A 2BX4A 4K3JA 3RXTA 1BTWA 3C1KA 2QF3A 3I29A 3RC4A 2GZVA 1XUFA 1LHCH 1V3XA 5DKMA 1NF3C 4X8VH 4CR9A 5HETA 4Y7BA 4K72A 1BMMH 1FY8E 1VCQA 2Z9LA 5A0BA 1HAHH 1MFGA 1P1EA 4EDJA 1Q3XA 1O3NA 2LP6A 1FIWA 4I86A 4M9FA 3ZVCA 1THRH 1B7XB 2A31A 2A32A 1QY6A 2GKVE 3SU4A 1DOJA 1YBWA 2SGPE 1YPMH 4FU8A 4E7RG 5HXFA 5L30H 2JXOA 3ZVEA 1DDJA 1GHYH 1P9UA 4WH8A 4Q2QA 2HLCA 3QTOH 1UVTH 2V3OH 1DUAA 2CN0H 1XX9A 4YOIA 3S7HB 4Q63A 1O2GH 1ETSH 1H8IH 3LGIA 1ELFA 3OFND 4A92A 1O35A 1U38A 1C4Y2 1I16A 4DIIH 1LVBA 3ZRTA 4X6NA 5T6FA 1FAXA 2P93A 2AEIH 3F9HA 4CRAA 1ORFA 2LA8A 1S82A 4U01A 5E0JA 1AVGH 2KPLA 1PYTD 5GIBA 2ESTE 1BOQA 4JCNA 4RT0A 4F48B 2DM8A 4Y79A 3N7EA 2KG2A 5DTHA 4Q2PA 1JMOH 1V2TT 3VGCC 1MTVA 3RXAA 1IQIA 5HIYA 1UK4A 3A88A 1QLCA 2P8OB 1NBME 4Y10E 1WHDA 2OINA 4MDSA 4FVDA 3GCHB 8GCHG 1FLEE 1BMNH 1OWKA 1P2JA 5G4BA 1P9SA 1MTUA 1UTOA 1U39A 2ZU5A 4OS4A 3ZZ4A 5JB8S 3ZZ6A 1MFLA 2ZFRH 2G4TA 5DG6A 3RU4T 2ZU1A 1EAWA 1PDRA 1KLTA 1IQNA 4TPYA 4ISIH 1IU0A 3TH3H 1WXRA 4TYDA 1C5YB 1EP6A 1LPKB 5HFBA 1WDIA 3F9EA 3A86A 1TMUH 2R3YA 2ZECA 1ZSKA 3QDZB 3QK1A 2GV6A 4TWWA 5A8YA 2H1UA 1C4V2 1NTPA 3F2FA 1VITF 2DB5A 2TIOA 3EAJA 1OXGA 4DY7B 2CMYA 1T8MA 3AW0A 3V7TA 3DSGA 3HKIB 3SV2H 1Z71A 1KXCA 2HVYB 2A5KA 1BRUP 5FCKA 4FLNA 3E91A 1BRCE 1SLVB 3F1SB 2G2LA 1TBQH 5GXPA 1PJPA 1CU1A 4AB8A 3RC6A 1H8HD 1TRYA 4ASHA 1A2CH 1TRMA 4Y11E 2ZCHP 1TLDA 1HRTH 3U28C 1WQVH 3GOVB 2AS9A 1KMHB 3QZRA 4JZFH 3S9CA 3ATWA 4TY7A 4NXRA 1GBBA 3LOXA 2ZHFH 1SOZA 6LPRA 2PDZA 1N99A 1TGTA 4P0CA 1XKAC 3O5NA 1ZRBA 3KZEA 2V0BA 3RXLA 3D65E 1OWJA 2ALPA 2W7SA 2GCHF 5HM2A 1F92A 1VR1H 1SQAA 2YT7A 3T26A 2BY6X 4NWLA 2UUFB 3A7VA 4TPIZ 4I7YH 2HPQH 3TJNA 5DP8A 1TGNA 2Z3EA 3QN7A 2QT5A 4HTCH 2VRFA 2GVFA 3PDZA 4Z8JA 3GDUA 4ISOA 1T8LA 5IDKA 1SQTA 2SGEE 4WMDA 3R69A 3SJ8A 1D3QB 1ARCA 1SGFA 1Y7NA 2IWPA 3RLEA 4YYXA 5EJ1A 4AYYB 3SU2A 3MNBA 2WPHS 5EQSA 3ZZ9A 5E21A 4Q3HA 1BZXE 1LQEA 1UJUA 1PPEE 2MHOA 3ID3A 5ABWA 1HXFH 6GCHF 2ZU3A 1NRNH 1C5TA 2WPLS 2VIQA 1XUJA 2BYAX 4D7FA 2EEIA 2I6QA 3KN2A 1UCYH 3KYFA 1Q7XA 1OWIA 1MU8B 2CF9H 4Z0KA 4NMSA 3MH5A 1C2JA 1OYQA 3DJAA 3SQEE 1Z8JB 1KLJH 1UTKA 1SQRA 4KKDA 1GDNA 5E0HA 2QKTA 1GJ4H 2B7DH 1G37A 1W11U 1NESE 1O30A 4UONA 1HNEE 4O06A 3SOSA 1EOLA 4OGYA 2IPQX 5TCAA 1K9OE 3VXEH 1GBFA 2AH4X 3ODFA 2FXRA 4REYA 2KOMA 1O34A 3CBXA 4F49A 1LPGB 3F2GA 3QGJA 1W7GH 3RXPA 3BG8A 2TGTA 4UFGH 5L2ZH 2ZPQA 4GHNA 2BY8X 5DPAA 2KFWA 1C9TA 2ZU4A 4ABJA 1K21H 3N7DA 1GJDB 1Z86A 1ABIH 3W94A 3K50A 2WINI 4B74A 2ZHDA 2K1QA 4JK5A 2BY7X 1UF1A 2F43B 3H5CB 3BTWE 2RCEA 1N8OB 1AUJA 3BIVH 3TSWA 3M5NA 4NA7A 2VIOA 3D49H 3GY8A 3T29A 4ABDA 1UHBA 2Z9KA 1G9OA 5CHAC 4D9RA 2ILNA 2Y5FA 3PV2A 3ZZDA 2A5AA 1UJDA 1J15A 4NA8A 2QC2A 3FP7E 1ZPBA 3MWIU 1GDQA 1QNJA 2KCOA 3KGPA 3NKKA 1BDAA 2Z9GA 4ZHMU 1PPBH 1FXYA 3QGNB 4AZ2B 3E0NB 1SKYE 1SGTA 2RA3A 2ZU2A 5FX6A 2O8WA 1GBMA 1E38B 2ZTYA 3M61U 1GJ7B 3P92A 3OE7D 2OCVB 5ESBA 2DE8A 3PMBB 5E11A 1AWHB 1PPHE 1QZ8A 2FOMB 4MTBA 4X1SU 3JZ2B 3S7KB 3T62A 3PWBA 1QRZA 3STIA 1ARBA 1P3CA 2QG1A 2EHRA 2BD2A 1NFUA 1ZGVA 3TSZA 1QJ6B 1FPHH 3MTYA 3TJOA 1NU7B 1GVLA 1BFEA 1JOUB 2K1ZA 2RFKC 4Y8YA 1WU1A 2XWBI 1DX5M 1A61H 3ZYDA 2NWNA 3F0PA 2I6VA 5C5NA 2KAWA 4NCYA 3W95A 4ZH8A 1TNHA 1ZSLA 2JJ1D 3DA9B 4AN7A 1J8AA 1D4PB 1WIFA 1W12U 1ANEA 1P0SH 2BDHA 4ABHA 2XYAA 1C2MA 1O3AA 1F2SE 1RRKA 1AO5A 3EA7A 3KHVA 1EASA 1C2EA 2AGGX 1FZZA 1V2ST 3TU7H 2Z6BD 3TMHA 3A7TA 1WHAA 4WYUA 2F9PA 5I7ZA 2F9VA 2EGKA 2EXGA 1FY3A 3ATMA 3KIDU 4DJZB 3SOEA 2ZWLH 5EPYA 2BDIA 1UJVA 1OSSA 1A0LA 2FI5E 2FDAA 2VU8E 3DJ1A 2ZPMA 3LC3A 1V62A 1EZUC 5C1UA 3A8BA 3SGQE 3VB3A 3BTGE 1Y3VA 5FX5A 4GHTA 1O3MA 3SFJA 2H9HA 1LVOA 1IQHA 3NCLA 5LGOA 4TT3D 3WY8A 3ID2A 4MNWA 2C90B 1BHXB 1SGNE 1DSUA 3FP6E 3P8NA 4B6EA 4ESTE 2KJPA 3RXSA 4FUIA 1C2IA 4K8YA 4YOJA 4NNMA 1CGIE 1Q3PA 4N6XA 2EEKA 4DT7B 3CS0A 3DSPA 2P16A 5EXNA 3O8RA 1GI9B 1Y3WA 2M3MA 3F9FA 1GG6C 4ISNA 2PR3A 2YNAA 4KGAA 2AIPA 1P2QA 2DE9A 3VEQB 1HAVA 1QRXA 2FMJA 1ZOMA 3EGHC 5T3HA 1MAYA 4GHQA 1BMAA 2EGNA 4IMQA 3RXUA 1CGJE 1V6DA 3MNSA 3GGEA 5AHGH 1JRSA 1ZPCA 1GHAG 1UVOA 3TNTA 5HYOA 4ABAA 2GZ7A 4X1QU 1AHTH 3K6YA 2BHGA 1OYTH 3RC5A 1T2MA 1W3CA 2ZGJA 2PWXA 2F9OA 1T8OA 1V5LA 3QJNA 1D9IA 2RG3A 5PTPA 1O2LA 1UEPA 3SNAA 2AYWA 5SGAE 2H2BA 2R2MB 3SZNA 2X7ZA 2BM2A 5GNDA 3MH4A 2Q9VA 2WV9A 1TPOA 2VGCC 4AFZA 5HM9A 4ZROA 1LVYA 3LKWA 1SMFE 2QXGA 2UWOA 2OGPA 1Y5AT 1L2EA 1IU2A 2J98B 3SNBA 3AW1A 3GYMA 5J4QA 3P95A 4X6PA 3BN9A 1OKXA 2QKVA 2TPIZ 2A7HA 4O3UA 3OAAD 1C2GA 1V2KT 1ANDA 5C67A 1YPLH 4FUCA
chains in the Genus database with same CATH topology
3S9AA 1ZTLA 2W4FA 2ZFSA 3GY7A 3PWCA 3PYHA 4Y0ZE 4AGKA 5LH8A 4D8NA 1F7ZA 1F5LA 1O3DA 2BXUH 2EEJA 2BY5X 1HLTH 2OUAA 2ZEBA 3RLWH 1BA8B 3SU1A 2A4GA 4H11A 1GHVH 2O8MA 1T8NA 1OWHA 1G3BA 3RXFA 2R9PA 1LHGH 1HUTH 2LOBA 2NU4E 5E1YA 3ZZAA 2Z3CA 1N6FA 7ESTE 1CE5A 2QYIA 1P2IA 4DCDA 4Y76A 3U69H 4HFPB 4YZUA 1OP0A 1NRPH 4NIYA 1TMBH 1QQUA 5GPIB 1NPMA 1TGBA 1Y3UA 3R0FA 3UNQA 2KOJA 2GTBA 1L6OA 1HB0B 3K82A 3SV8A 3URCA 2GGVB 9LPRA 1ESTA 2BD9A 1XXDA 1Y5BT 2BVXH 1UVUH 2G52A 2FOGA 4A1TA 2KBSA 1LVMA 1LO6A 1K22H 1B0FA 4WVPE 2YNBA 3LONA 2EDVA 4MVNA 4FXGH 1C5NH 3NWUA 1MBMA 1UTPA 3SUGA 1HJ9A 1DLEA 2PNTA 5ILBA 3ZVAA 4X8SH 2XC4A 5D13A 1YPHC 2G51A 1HYLA 1F0UA 3TPIZ 1YF4A 3GCTF 2ZDNA 1FMGA 1JXPA 4RKJB 4OAJA 2FOHA 2BLVA 1XUKA 2QAAA 1X8SA 2QBWA 1ELDE 3SGBE 1D5GA 4NMRA 2FEQH 3M3SA 1C1OA 2XW9A 3JZ1B 1AD8H 3LGWA 5FAHA 1EB2A 3TGIE 1F0RA 4ISHH 3DT0H 3SU3A 1Z8GA 2A4OA 1AZZA 3UPEA 2OBOA 3Q3KA 1ZHMA 2Q6FA 2W7RA 1YPGH 3VXFH 2H5CA 1G30B 4WMFA 2JILA 3KDGA 4B71A 3GDVA 3BTME 4YESB 3TH2H 1EPTC 3A7YA 3L6PA 2XRCA 3DJ3A 3U8OH 1C1PA 1MZDA 3RP2A 1GBDA 4UFFH 4BAQB 1SFQB 1DLKB 5GDSH 5FB8C 1QHRB 1RZXA 2JETC 4UU6A 3GY6A 1N6YA 2OQSA 1EPTA 4INKA 1H4WA 2NU3E 1P8VC 2PKAA 2UUJB 1DPOA 2BY9X 8KME2 4FUFA 1C1VH 2HOBA 4I8JA 5F03A 8LPRA 2EDPA 1O3OA 1YYY1 1ZMLA 4WYTA 3S9BA 2J9NA 5DP5A 3RMMH 4NNLA 3BPUA 4KFWA 1W0ZU 4G69A 2D26C 5C1XA 2TRMA 2TGAA 3SJIA 2DMZA 5JDUB 4OS6A 4NA9H 2OZFA 1ELTA 3BTDE 1BT7A 4RKOB 3KQEA 1Z1JA 1YM0A 5EW1H 1BB0B 2VJ1A 1W9EA 1Y3YA 2B8OH 2C8YB 3ZZ3A 1TE0A 3RDZA 1TIOA 1HAOH 1TGCA 1AKSA 1SC8U 1RGQA 1ESAA 2QXJA 1FONA 1UJ1A 1HIAB 4B2CA 1MTNC 3SNCA 5A2MH 1BRBE 1VCWA 3V12A 4NXPA 4E05H 1GJAB 5FPTA 2ODYB 2ZTZA 1SVPA 2C3SA 3RXCA 1LCYA 1HAPH 2KAIB 3NCVA 3R68A 1NFYA 3RXVA 1VGCB 1N6XA 1E0FD 2Q3GA 1GHWH 2RA0A 2BD4A 2NU1E 3VB4A 4A1XA 3STJA 1C2HA 4AORA 5AFZH 4HOPA 1MC7A 2THFB 3P17H 4I8HA 1Z87A 2AERH 3L33A 5HEBA 4X8TH 3SU6A 4YTAA 2GEFA 1IQMA 1U6QA 1DS2E 1ANBA 4A6LA 3UNRA 1WQSA 3UQOA 4JYUH 4FUJA 1LHEH 1PPGE 4JOKA 3TJVA 4UEHH 4R2ZA 4Y0YE 1IAUA 1O38A 2J92A 1O5AB 1GHXH 3VQFA 2PSXA 1Q2WA 3BSQA 1DANH 1NZQH 2PTCE 3LGUA 2ZGCA 1OBYA 5LPFA 3TK6A 2BOHB <