4JOGA

Cftr associated ligand (cal) pdz domain bound to peptide v-ical36 (ansrvptsii)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jogA00
1V62A 5GLJA 3RLEA 2FNEA 2IWOA 2OQSA 4E34A 1UEQA 1MFGA 2G5MB 1I16A 1W9OA 1V6BA 2QBWA 1VB7A 1U39A 1V5LA 3KZDA 5HFFA 1V1TA 4GVDA 2RCZA 4JOHA 2G2LA 1U37A 1BE9A 1R6JA 1WHAA 2AWWA 3QIKA 1UFXA 5HETA 5F67A 3I4WA 2Z9IA 4NNMA 1V5QA 2YT8A 3WKMA 4N6XA 1UEPA 3TSVA 3GCNA 3JXTA 1X5QA 2VWRA 3EGGC 1N7FA 2L97A 3DORA 3AXAA 1UJVA 2KQFA 4NNLA 3ID2A 5HJ1A 2JREA 4JL7A 1SOZA 5F3XA 2PKUA 1XZ9A 2VRFA 5EZ0A 4OAJA 1B8QA 1I92A 2LC7A 4RI0A 1N7TA 3I1EA 1FC9A 5DTHA 3ID4A 1MC7A 2OCSA 1NTEA 1TQ3A 2DLSA 4HOPA 4H11A 2FCFA 5EYZA 4NMSA 2EGNA 1QAUA 4K75A 2EDVA 1OBZA 1N6EA 2RRMA 1WI4A 1X6DA 1TP5A 1WI2A 5E1YA 3MH4A 1L6OA 1UJUA 4NMQA 1IHJA 4WYTA 1WF7A 2OS6A 3PV4A 3B76A 4OEOA 2EGOA 3SHUA 3SHWA 2L4TA 3O46A 1TE0A 1WH1A 2LOBA 5E11A 2UZCA 4JORA 1SOTA 4R2ZA 1T2MA 2KAWA 3CBXA 5HDYA 2KJKA 2JIKA 1PDRA 2DAZA 2JXOA 2F5YA 1K32A 4NMOA 3K82A 3I18A 4Q2QA 5E21A 5HF1A 1IU2A 2AWUA 2ZPMA 4K78A 5E22A 5GNDA 2EDZA 3NFKA 4P0CA 1TP3A 1U3BA 2V1WA 2KPKA 3QO6A 5D13A 2EEJA 1IU0A 4Q2NA 1RGRA 2EJYA 2KJDA 2QKTA 4YYXA 2KJPA 3PV5A 4Q2PA 2M0ZA 3RL7A 3SOEA 2REYA 1YBOA 2I04A 2VSPA 2HE4A 2KRGA 3KHFA 2KOMA 2H3MA 3LNXA 3ID3A 3CYYA 4GHNA 1QLCA 1D5GA 1NF3C 4JOGA 2IWPA 1WFGA 3EGHC 2M10A 2I1NA 2L4SA 2PDZA 4KFVA 3GCOA 3OU0A 5HFBA 1N99A 2EEHA 3PS4A 5HFEA 1X5NA 3CBZA 2KL1A 5B6LA 1RZXA 3OTPA 2X7ZA 1Y7NA 4AMHA 4K72A 4O06A 2EDPA 2I4SA 3TSWA 3GGEA 2HE2A 2PKTA 2YUBA 3R69A 2FE5A 4REYA 3ZRTA 2JWEA 1N6FA 1Z87A 4K6YA 3HPKA 1MFLA 1M5ZA 2KYLA 5HEBA 4E35A 3ID1A 2OSGA 4NMRA 2DB5A 3VQFA 2O2TA 3GDSA 4LMMA 2CSJA 2EV8A 2KA9A 3MH6A 5HFDA 2DLUA 2PZDA 1Q3PA 2F0AA 4WYUA 1WHDA 3QGLA 4HOPB 4Q3HA 2I0LA 3PDZA 1KY9A 4NXRA 2D90A 2OPGA 4NMTA 5G1EA 5HF4A 1FC7A 3WKLA 5HEYA 2H2CA 3O5NA 1W9EA 2DMZA 4P2AB 2KOJA 3NGHA 1GM1A 4EDJA 2R3YA 3SFJA 3DJ3A 1BFEA 4JOEA 1WJLA 2H2BA 1WFVA 2I6VA 3PV2A 2I0IA 2W4FA 2PNTA 1LCYA 3GDVA 3SUZA 3HVQC 3R68A 3DIWA 2PA1A 1GQ5A 2JILA 2DJTA 4YDPA 5H3JA 2QG1A 5E6PB 1QAVA 4Q6SA 4E3BA 4JOJA 5G1DA 3GJ9A 3K50A 4Q2OA 2QKVA 1OBXA 2MHOA 2GZVA 5I7ZA 4KFWA 3L4FD 2JOAA 1UEWA 1N6DA 3HPMA 1WG6A 4JOFA 1VA8A 2KG2A 1UITA 2Q9VA 1P1DA 2QKUA 2Q3GA 4NMPA 1KEFA 2YTWA 3QJMA 2KOHA 2AINA 4GVCA 1ZOKA 3KZEA 2HGAA 4OEPA 1Q7XA 2KPLA 3DJAA 2KV8A 2OMJA 5A2PA 2YUYA 4JOPA 2EAQA 2EXGA 4IC6A 3STJA 1P1EA 4PQWA 1X8SA 1ZUBA 3RL8A 2OZFA 2ENOA 2LA8A 1OBYA 2M0UA 2W7RA 3VQGA 2KBSA 2ZPLA 3MH7A 4K76A 4MPAA 3CS0A 1X45A 2P3WA 2VZ5A 2FN5A 2AWXA 2JINA 1GQ4A 4NXPA 4NXQA 2D8IA 5JXBA 4L8NA 2E7KA 5FHTA 2LUIA 4NMVA 4Z33A 3GSLA 5FB8C 5HEDA 2DC2A 1UHPA 3FY5A 1KWAA 3DJ1A 3QDOA 1WIFA 4G69A 2EEIA 1FCFA 2VPHA 3CC0A 1Z86A 2QT5A 2DKRA 3E17A 3QE1A 1OZIA 3LNYA 2OGPA 1RY4A 3CBYA 2M3MA 2IWNA 4JOKA 3TMHA 3R0HA 3BPUA 3QJNA 2H3LA 4F8KA 2M0VA 4XHVA 5HFCA 2Z17A 2CS5A 2LC6A 2R4HA 1VCWA 2YT7A 1UEZA 1RGWA 1W9QA 2IWQA 3CH8A 1X5RA 3TSZA 2EGKA 2K20A 2BYGA 3GDUA 3PDVA 4Q6HA 2D92A 1QAVB 1Q3OA 1UM1A 1Y8TA 2V90A 2DM8A 4FGMA 1VAEA 3NFLA 2K1ZA 2VSVA 1UF1A 2EHRA 1U38A 4UU6A 1N7EA 1UM7A 2CSSA 1WF8A 2MX6A 2M0TA 4UU5A 2WL7A 2EEGA 3K1RA 1FC6A 1VJ6A 1UJDA 4Z8JA 1G9OA
chains in the Genus database with same CATH superfamily
1V62A 5GLJA 3RLEA 2FNEA 2IWOA 2OQSA 4E34A 1UEQA 1MFGA 2G5MB 1I16A 1W9OA 1V6BA 2QBWA 1VB7A 1U39A 1V5LA 3KZDA 5HFFA 1V1TA 4GVDA 2RCZA 4JOHA 2G2LA 1U37A 1BE9A 1R6JA 1WHAA 2AWWA 3QIKA 1UFXA 5HETA 5F67A 3I4WA 2Z9IA 4NNMA 1V5QA 2YT8A 3WKMA 4N6XA 1UEPA 3TSVA 3GCNA 3JXTA 1X5QA 2VWRA 3EGGC 1N7FA 2L97A 3DORA 3AXAA 1UJVA 2KQFA 4NNLA 3ID2A 5HJ1A 2JREA 4JL7A 1SOZA 3KDKA 5F3XA 2PKUA 1XZ9A 2VRFA 5EZ0A 4OAJA 1B8QA 1I92A 2LC7A 4RI0A 1N7TA 3I1EA 1FC9A 5DTHA 3ID4A 1MC7A 2OCSA 1NTEA 1TQ3A 2DLSA 4HOPA 4H11A 2FCFA 5EYZA 4NMSA 2EGNA 1QAUA 4K75A 2EDVA 1OBZA 1N6EA 2RRMA 1WI4A 1X6DA 1TP5A 1WI2A 5E1YA 3MH4A 1L6OA 1UJUA 4NMQA 1IHJA 4WYTA 1WF7A 2OS6A 3PV4A 3B76A 4OEOA 2EGOA 3SHUA 3SHWA 2L4TA 4FLNA 3O46A 1TE0A 1WH1A 2LOBA 5E11A 2UZCA 4JORA 1X9ZA 1SOTA 4R2ZA 1T2MA 2KAWA 3CBXA 5HDYA 2KJKA 2JIKA 1PDRA 2DAZA 2JXOA 2F5YA 1K32A 4NMOA 3NCVA 3K82A 3I18A 4Q2QA 5E21A 5HF1A 1IU2A 2AWUA 2ZPMA 4K78A 5E22A 5GNDA 2EDZA 3NFKA 4P0CA 1TP3A 1U3BA 2V1WA 2KPKA 3QO6A 5D13A 2EEJA 1IU0A 4Q2NA 1RGRA 2EJYA 2KJDA 2QKTA 4YYXA 2KJPA 3PV5A 4Q2PA 2M0ZA 3RL7A 3SOEA 2REYA 1YBOA 2I04A 2VSPA 2HE4A 2KRGA 3KHFA 2KOMA 2H3MA 3LNXA 3ID3A 3CYYA 4GHNA 1QLCA 1D5GA 1NF3C 4JOGA 2IWPA 1WFGA 3EGHC 2M10A 2I1NA 2L4SA 2PDZA 4KFVA 3GCOA 3OU0A 5HFBA 1N99A 2EEHA 3PS4A 5HFEA 1X5NA 3CBZA 2KL1A 5B6LA 1RZXA 3OTPA 2X7ZA 1Y7NA 4AMHA 4K72A 4O06A 2EDPA 2I4SA 3TSWA 3GGEA 2HE2A 2PKTA 2YUBA 3R69A 2FE5A 4REYA 2JSNA 3ZRTA 2JWEA 1N6FA 1Z87A 4K6YA 3HPKA 1MFLA 1M5ZA 2KYLA 5HEBA 4E35A 3ID1A 2OSGA 4NMRA 2DB5A 3VQFA 2O2TA 3GDSA 4LMMA 2CSJA 2EV8A 2KA9A 3MH6A 5HFDA 2DLUA 2PZDA 1Q3PA 2F0AA 4WYUA 1WHDA 3QGLA 4HOPB 4Q3HA 2I0LA 3PDZA 1KY9A 4NXRA 2D90A 2OPGA 4NMTA 5G1EA 5HF4A 1FC7A 3WKLA 5HEYA 2H2CA 3O5NA 1W9EA 2DMZA 4P2AB 2KOJA 3NGHA 1GM1A 4EDJA 2R3YA 3SFJA 3DJ3A 1BFEA 4JOEA 1WJLA 2H2BA 1WFVA 2I6VA 3PV2A 2I0IA 2W4FA 2PNTA 5IL9A 1LCYA 3GDVA 3SUZA 3HVQC 3R68A 3DIWA 5ILBA 2PA1A 1GQ5A 2JILA 2DJTA 4YDPA 5H3JA 2QG1A 3GABA 5E6PB 1QAVA 4Q6SA 4E3BA 4JOJA 5G1DA 3GJ9A 3K50A 4Q2OA 2QKVA 1OBXA 2MHOA 2GZVA 5I7ZA 4KFWA 3L4FD 2JOAA 1UEWA 1N6DA 3HPMA 1WG6A 4JOFA 1VA8A 2KG2A 1UITA 2Q9VA 1P1DA 2GEFA 2QKUA 2Q3GA 4NMPA 1KEFA 2YTWA 3QJMA 2KOHA 2AINA 4GVCA 1ZOKA 3KZEA 2HGAA 4OEPA 1Q7XA 2KPLA 3DJAA 2KV8A 2OMJA 5A2PA 2YUYA 4JOPA 2EAQA 2EXGA 4IC6A 3STJA 1P1EA 4PQWA 1X8SA 1ZUBA 3RL8A 2OZFA 2ENOA 2LA8A 5B42A 1OBYA 2M0UA 3KDGA 2W7RA 3VQGA 2KBSA 2ZPLA 3MH7A 4K76A 4MPAA 3CS0A 1X45A 2P3WA 2VZ5A 2FN5A 2AWXA 2JINA 1GQ4A 4NXPA 4NXQA 2D8IA 5JXBA 4L8NA 2E7KA 5FHTA 2LUIA 4NMVA 4Z33A 3GSLA 5FB8C 5HEDA 2DC2A 1UHPA 3FY5A 1KWAA 3DJ1A 3QDOA 1WIFA 4G69A 2EEIA 1FCFA 2VPHA 3CC0A 1Z86A 2QT5A 2DKRA 3E17A 4JJ3A 3QE1A 1OZIA 3LNYA 2OGPA 1RY4A 3CBYA 2M3MA 2IWNA 4JOKA 3TMHA 3R0HA 3BPUA 3QJNA 4JJ0A 2H3LA 4F8KA 2M0VA 4XHVA 5HFCA 2Z17A 2CS5A 2LC6A 2R4HA 1VCWA 2YT7A 1UEZA 1RGWA 1W9QA 2IWQA 3CH8A 1X5RA 3TSZA 2EGKA 2K20A 2BYGA 3GDUA 3PDVA 4Q6HA 2D92A 1QAVB 1Q3OA 1UM1A 1Y8TA 2V90A 2DM8A 4FGMA 1VAEA 3NFLA 2K1ZA 2VSVA 1UF1A 2EHRA 1U38A 4UU6A 1N7EA 1UM7A 2CSSA 1WF8A 2MX6A 2M0TA 4UU5A 2WL7A 2EEGA 3K1RA 1FC6A 1VJ6A 1UJDA 4Z8JA 1G9OA
chains in the Genus database with same CATH topology
1V62A 5GLJA 3RLEA 2FNEA 2IWOA 2OQSA 4E34A 1UEQA 1MFGA 2G5MB 1I16A 1W9OA 1V6BA 2QBWA 1VB7A 1U39A 1V5LA 3KZDA 5HFFA 1V1TA 4GVDA 2RCZA 4JOHA 2G2LA 1U37A 1BE9A 1R6JA 1WHAA 2AWWA 3QIKA 1UFXA 5HETA 5F67A 3I4WA 2Z9IA 4NNMA 1V5QA 2YT8A 3WKMA 4N6XA 1UEPA 3TSVA 3GCNA 3JXTA 1X5QA 2VWRA 3EGGC 1N7FA 2L97A 3DORA 3AXAA 1UJVA 2KQFA 4NNLA 3ID2A 5HJ1A 2JREA 4JL7A 1SOZA 3KDKA 5F3XA 2PKUA 1XZ9A 2VRFA 5EZ0A 4OAJA 1B8QA 1I92A 2LC7A 4RI0A 1N7TA 3I1EA 1FC9A 5DTHA 3ID4A 1MC7A 2OCSA 1NTEA 1TQ3A 2DLSA 4HOPA 4H11A 2FCFA 5EYZA 4NMSA 2EGNA 1QAUA 4K75A 2EDVA 1OBZA 1N6EA 2RRMA 1WI4A 1X6DA 1TP5A 1WI2A 5E1YA 3MH4A 1L6OA 1UJUA 4NMQA 1IHJA 4WYTA 1WF7A 2OS6A 3PV4A 3B76A 4OEOA 2EGOA 3SHUA 3SHWA 2L4TA 4FLNA 3O46A 1TE0A 1WH1A 2LOBA 5E11A 2UZCA 4JORA 1X9ZA 1SOTA 4R2ZA 1T2MA 2KAWA 3CBXA 5HDYA 2KJKA 2JIKA 1PDRA 2DAZA 2JXOA 2F5YA 1K32A 4NMOA 3NCVA 3K82A 3I18A 4Q2QA 5E21A 5HF1A 1IU2A 2AWUA 2ZPMA 4K78A 5E22A 5GNDA 2EDZA 3NFKA 4P0CA 1TP3A 1U3BA 2V1WA 2KPKA 3QO6A 5D13A 2EEJA 1IU0A 4Q2NA 1RGRA 2EJYA 2KJDA 2QKTA 4YYXA 2KJPA 3PV5A 4Q2PA 2M0ZA 3RL7A 3SOEA 2REYA 1YBOA 2I04A 2VSPA 2HE4A 2KRGA 3KHFA 2KOMA 2H3MA 3LNXA 3ID3A 3CYYA 4GHNA 1QLCA 1D5GA 1NF3C 4JOGA 2IWPA 1WFGA 3EGHC 2M10A 2I1NA 2L4SA 2PDZA 4KFVA 3GCOA 3OU0A 5HFBA 1N99A 2EEHA 3PS4A 5HFEA 1X5NA 3CBZA 2KL1A 5B6LA 1RZXA 3OTPA 2X7ZA 1Y7NA 4AMHA 4K72A 4O06A 2EDPA 2I4SA 3TSWA 3GGEA 2HE2A 2PKTA 2YUBA 3R69A 2FE5A 4REYA 2JSNA 3ZRTA 2JWEA 1N6FA 1Z87A 4K6YA 3HPKA 1MFLA 1M5ZA 2KYLA 5HEBA 4E35A 3ID1A 2OSGA 4NMRA 2DB5A 3VQFA 2O2TA 3GDSA 4LMMA 2CSJA 2EV8A 2KA9A 3MH6A 5HFDA 2DLUA 2PZDA 1Q3PA 2F0AA 4WYUA 1WHDA 3QGLA 4HOPB 4Q3HA 2I0LA 3PDZA 1KY9A 4NXRA 2D90A 2OPGA 4NMTA 5G1EA 5HF4A 1FC7A 3WKLA 5HEYA 2H2CA 3O5NA 1W9EA 2DMZA 4P2AB 2KOJA 3NGHA 1GM1A 4EDJA 2R3YA 3SFJA 3DJ3A 1BFEA 4JOEA 1WJLA 2H2BA 1WFVA 2I6VA 3PV2A 2I0IA 2W4FA 2PNTA 5IL9A 1LCYA 3GDVA 3SUZA 3HVQC 3R68A 3DIWA 5ILBA 2PA1A 1GQ5A 2JILA 2DJTA 4YDPA 5H3JA 2QG1A 3GABA 5E6PB 1QAVA 4Q6SA 4E3BA 4JOJA 5G1DA 3GJ9A 3K50A 4Q2OA 2QKVA 1OBXA 2MHOA 2GZVA 5I7ZA 4KFWA 3L4FD 2JOAA 1UEWA 1N6DA 3HPMA 1WG6A 4JOFA 1VA8A 2KG2A 1UITA 2Q9VA 1P1DA 2GEFA 2QKUA 2Q3GA 4NMPA 1KEFA 2YTWA 3QJMA 2KOHA 2AINA 4GVCA 1ZOKA 3KZEA 2HGAA 4OEPA 1Q7XA 2KPLA 3DJAA 2KV8A 2OMJA 5A2PA 2YUYA 4JOPA 2EAQA 2EXGA 4IC6A 3STJA 1P1EA 4PQWA 1X8SA 1ZUBA 3RL8A 2OZFA 2ENOA 2LA8A 5B42A 1OBYA 2M0UA 3KDGA 2W7RA 3VQGA 2KBSA 2ZPLA 3MH7A 4K76A 4MPAA 3CS0A 1X45A 2P3WA 2VZ5A 2FN5A 2AWXA 2JINA 1GQ4A 4NXPA 4NXQA 2D8IA 5JXBA 4L8NA 2E7KA 5FHTA 2LUIA 4NMVA 4Z33A 3GSLA 5FB8C 5HEDA 2DC2A 1UHPA 3FY5A 1KWAA 3DJ1A 3QDOA 1WIFA 4G69A 2EEIA 1FCFA 2VPHA 3CC0A 1Z86A 2QT5A 2DKRA 3E17A 4JJ3A 3QE1A 1OZIA 3LNYA 2OGPA 1RY4A 3CBYA 2M3MA 2IWNA 4JOKA 3TMHA 3R0HA 3BPUA 3QJNA 4JJ0A 2H3LA 4F8KA 2M0VA 4XHVA 5HFCA 2Z17A 2CS5A 2LC6A 2R4HA 1VCWA 2YT7A 1UEZA 1RGWA 1W9QA 2IWQA 3CH8A 1X5RA 3TSZA 2EGKA 2K20A 2BYGA 3GDUA 3PDVA 4Q6HA 2D92A 1QAVB 1Q3OA 1UM1A 1Y8TA 2V90A 2DM8A 4FGMA 1VAEA 3NFLA 2K1ZA 2VSVA 1UF1A 2EHRA 1U38A 4UU6A 1N7EA 1UM7A 2CSSA 1WF8A 2MX6A 2M0TA 4UU5A 2WL7A 2EEGA 3K1RA 1FC6A 1VJ6A 1UJDA 4Z8JA 1G9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V62 A;  5GLJ A;  3RLE A;  2FNE A;  2IWO A;  2OQS A;  4E34 A;  1UEQ A;  1MFG A;  2G5M B;  1I16 A;  1W9O A;  1V6B A;  2QBW A;  1VB7 A;  1U39 A;  1V5L A;  3KZD A;  5HFF A;  1V1T A;  4GVD A;  2RCZ A;  4JOH A;  2G2L A;  1U37 A;  1BE9 A;  1R6J A;  1WHA A;  2AWW A;  3QIK A;  1UFX A;  5HET A;  5F67 A;  3I4W A;  2Z9I A;  4NNM A;  1V5Q A;  2YT8 A;  3WKM A;  4N6X A;  1UEP A;  3TSV A;  3GCN A;  3JXT A;  1X5Q A;  2VWR A;  3EGG C;  1N7F A;  2L97 A;  3DOR A;  3AXA A;  1UJV A;  2KQF A;  4NNL A;  3ID2 A;  5HJ1 A;  2JRE A;  4JL7 A;  1SOZ A;  5F3X A;  2PKU A;  1XZ9 A;  2VRF A;  5EZ0 A;  4OAJ A;  1B8Q A;  1I92 A;  2LC7 A;  4RI0 A;  1N7T A;  3I1E A;  1FC9 A;  5DTH A;  3ID4 A;  1MC7 A;  2OCS A;  1NTE A;  1TQ3 A;  2DLS A;  4HOP A;  4H11 A;  2FCF A;  5EYZ A;  4NMS A;  2EGN A;  1QAU A;  4K75 A;  2EDV A;  1OBZ A;  1N6E A;  2RRM A;  1WI4 A;  1X6D A;  1TP5 A;  1WI2 A;  5E1Y A;  3MH4 A;  1L6O A;  1UJU A;  4NMQ A;  1IHJ A;  4WYT A;  1WF7 A;  2OS6 A;  3PV4 A;  3B76 A;  4OEO A;  2EGO A;  3SHU A;  3SHW A;  2L4T A;  3O46 A;  1TE0 A;  1WH1 A;  2LOB A;  5E11 A;  2UZC A;  4JOR A;  1SOT A;  4R2Z A;  1T2M A;  2KAW A;  3CBX A;  5HDY A;  2KJK A;  2JIK A;  1PDR A;  2DAZ A;  2JXO A;  2F5Y A;  1K32 A;  4NMO A;  3K82 A;  3I18 A;  4Q2Q A;  5E21 A;  5HF1 A;  1IU2 A;  2AWU A;  2ZPM A;  4K78 A;  5E22 A;  5GND A;  2EDZ A;  3NFK A;  4P0C A;  1TP3 A;  1U3B A;  2V1W A;  2KPK A;  3QO6 A;  5D13 A;  2EEJ A;  1IU0 A;  4Q2N A;  1RGR A;  2EJY A;  2KJD A;  2QKT A;  4YYX A;  2KJP A;  3PV5 A;  4Q2P A;  2M0Z A;  3RL7 A;  3SOE A;  2REY A;  1YBO A;  2I04 A;  2VSP A;  2HE4 A;  2KRG A;  3KHF A;  2KOM A;  2H3M A;  3LNX A;  3ID3 A;  3CYY A;  4GHN A;  1QLC A;  1D5G A;  1NF3 C;  4JOG A;  2IWP A;  1WFG A;  3EGH C;  2M10 A;  2I1N A;  2L4S A;  2PDZ A;  4KFV A;  3GCO A;  3OU0 A;  5HFB A;  1N99 A;  2EEH A;  3PS4 A;  5HFE A;  1X5N A;  3CBZ A;  2KL1 A;  5B6L A;  1RZX A;  3OTP A;  2X7Z A;  1Y7N A;  4AMH A;  4K72 A;  4O06 A;  2EDP A;  2I4S A;  3TSW A;  3GGE A;  2HE2 A;  2PKT A;  2YUB A;  3R69 A;  2FE5 A;  4REY A;  3ZRT A;  2JWE A;  1N6F A;  1Z87 A;  4K6Y A;  3HPK A;  1MFL A;  1M5Z A;  2KYL A;  5HEB A;  4E35 A;  3ID1 A;  2OSG A;  4NMR A;  2DB5 A;  3VQF A;  2O2T A;  3GDS A;  4LMM A;  2CSJ A;  2EV8 A;  2KA9 A;  3MH6 A;  5HFD A;  2DLU A;  2PZD A;  1Q3P A;  2F0A A;  4WYU A;  1WHD A;  3QGL A;  4HOP B;  4Q3H A;  2I0L A;  3PDZ A;  1KY9 A;  4NXR A;  2D90 A;  2OPG A;  4NMT A;  5G1E A;  5HF4 A;  1FC7 A;  3WKL A;  5HEY A;  2H2C A;  3O5N A;  1W9E A;  2DMZ A;  4P2A B;  2KOJ A;  3NGH A;  1GM1 A;  4EDJ A;  2R3Y A;  3SFJ A;  3DJ3 A;  1BFE A;  4JOE A;  1WJL A;  2H2B A;  1WFV A;  2I6V A;  3PV2 A;  2I0I A;  2W4F A;  2PNT A;  1LCY A;  3GDV A;  3SUZ A;  3HVQ C;  3R68 A;  3DIW A;  2PA1 A;  1GQ5 A;  2JIL A;  2DJT A;  4YDP A;  5H3J A;  2QG1 A;  5E6P B;  1QAV A;  4Q6S A;  4E3B A;  4JOJ A;  5G1D A;  3GJ9 A;  3K50 A;  4Q2O A;  2QKV A;  1OBX A;  2MHO A;  2GZV A;  5I7Z A;  4KFW A;  3L4F D;  2JOA A;  1UEW A;  1N6D A;  3HPM A;  1WG6 A;  4JOF A;  1VA8 A;  2KG2 A;  1UIT A;  2Q9V A;  1P1D A;  2QKU A;  2Q3G A;  4NMP A;  1KEF A;  2YTW A;  3QJM A;  2KOH A;  2AIN A;  4GVC A;  1ZOK A;  3KZE A;  2HGA A;  4OEP A;  1Q7X A;  2KPL A;  3DJA A;  2KV8 A;  2OMJ A;  5A2P A;  2YUY A;  4JOP A;  2EAQ A;  2EXG A;  4IC6 A;  3STJ A;  1P1E A;  4PQW A;  1X8S A;  1ZUB A;  3RL8 A;  2OZF A;  2ENO A;  2LA8 A;  1OBY A;  2M0U A;  2W7R A;  3VQG A;  2KBS A;  2ZPL A;  3MH7 A;  4K76 A;  4MPA A;  3CS0 A;  1X45 A;  2P3W A;  2VZ5 A;  2FN5 A;  2AWX A;  2JIN A;  1GQ4 A;  4NXP A;  4NXQ A;  2D8I A;  5JXB A;  4L8N A;  2E7K A;  5FHT A;  2LUI A;  4NMV A;  4Z33 A;  3GSL A;  5FB8 C;  5HED A;  2DC2 A;  1UHP A;  3FY5 A;  1KWA A;  3DJ1 A;  3QDO A;  1WIF A;  4G69 A;  2EEI A;  1FCF A;  2VPH A;  3CC0 A;  1Z86 A;  2QT5 A;  2DKR A;  3E17 A;  3QE1 A;  1OZI A;  3LNY A;  2OGP A;  1RY4 A;  3CBY A;  2M3M A;  2IWN A;  4JOK A;  3TMH A;  3R0H A;  3BPU A;  3QJN A;  2H3L A;  4F8K A;  2M0V A;  4XHV A;  5HFC A;  2Z17 A;  2CS5 A;  2LC6 A;  2R4H A;  1VCW A;  2YT7 A;  1UEZ A;  1RGW A;  1W9Q A;  2IWQ A;  3CH8 A;  1X5R A;  3TSZ A;  2EGK A;  2K20 A;  2BYG A;  3GDU A;  3PDV A;  4Q6H A;  2D92 A;  1QAV B;  1Q3O A;  1UM1 A;  1Y8T A;  2V90 A;  2DM8 A;  4FGM A;  1VAE A;  3NFL A;  2K1Z A;  2VSV A;  1UF1 A;  2EHR A;  1U38 A;  4UU6 A;  1N7E A;  1UM7 A;  2CSS A;  1WF8 A;  2MX6 A;  2M0T A;  4UU5 A;  2WL7 A;  2EEG A;  3K1R A;  1FC6 A;  1VJ6 A;  1UJD A;  4Z8J A;  1G9O A; 
#chains in the Genus database with same CATH topology
 1V62 A;  5GLJ A;  3RLE A;  2FNE A;  2IWO A;  2OQS A;  4E34 A;  1UEQ A;  1MFG A;  2G5M B;  1I16 A;  1W9O A;  1V6B A;  2QBW A;  1VB7 A;  1U39 A;  1V5L A;  3KZD A;  5HFF A;  1V1T A;  4GVD A;  2RCZ A;  4JOH A;  2G2L A;  1U37 A;  1BE9 A;  1R6J A;  1WHA A;  2AWW A;  3QIK A;  1UFX A;  5HET A;  5F67 A;  3I4W A;  2Z9I A;  4NNM A;  1V5Q A;  2YT8 A;  3WKM A;  4N6X A;  1UEP A;  3TSV A;  3GCN A;  3JXT A;  1X5Q A;  2VWR A;  3EGG C;  1N7F A;  2L97 A;  3DOR A;  3AXA A;  1UJV A;  2KQF A;  4NNL A;  3ID2 A;  5HJ1 A;  2JRE A;  4JL7 A;  1SOZ A;  3KDK A;  5F3X A;  2PKU A;  1XZ9 A;  2VRF A;  5EZ0 A;  4OAJ A;  1B8Q A;  1I92 A;  2LC7 A;  4RI0 A;  1N7T A;  3I1E A;  1FC9 A;  5DTH A;  3ID4 A;  1MC7 A;  2OCS A;  1NTE A;  1TQ3 A;  2DLS A;  4HOP A;  4H11 A;  2FCF A;  5EYZ A;  4NMS A;  2EGN A;  1QAU A;  4K75 A;  2EDV A;  1OBZ A;  1N6E A;  2RRM A;  1WI4 A;  1X6D A;  1TP5 A;  1WI2 A;  5E1Y A;  3MH4 A;  1L6O A;  1UJU A;  4NMQ A;  1IHJ A;  4WYT A;  1WF7 A;  2OS6 A;  3PV4 A;  3B76 A;  4OEO A;  2EGO A;  3SHU A;  3SHW A;  2L4T A;  4FLN A;  3O46 A;  1TE0 A;  1WH1 A;  2LOB A;  5E11 A;  2UZC A;  4JOR A;  1X9Z A;  1SOT A;  4R2Z A;  1T2M A;  2KAW A;  3CBX A;  5HDY A;  2KJK A;  2JIK A;  1PDR A;  2DAZ A;  2JXO A;  2F5Y A;  1K32 A;  4NMO A;  3NCV A;  3K82 A;  3I18 A;  4Q2Q A;  5E21 A;  5HF1 A;  1IU2 A;  2AWU A;  2ZPM A;  4K78 A;  5E22 A;  5GND A;  2EDZ A;  3NFK A;  4P0C A;  1TP3 A;  1U3B A;  2V1W A;  2KPK A;  3QO6 A;  5D13 A;  2EEJ A;  1IU0 A;  4Q2N A;  1RGR A;  2EJY A;  2KJD A;  2QKT A;  4YYX A;  2KJP A;  3PV5 A;  4Q2P A;  2M0Z A;  3RL7 A;  3SOE A;  2REY A;  1YBO A;  2I04 A;  2VSP A;  2HE4 A;  2KRG A;  3KHF A;  2KOM A;  2H3M A;  3LNX A;  3ID3 A;  3CYY A;  4GHN A;  1QLC A;  1D5G A;  1NF3 C;  4JOG A;  2IWP A;  1WFG A;  3EGH C;  2M10 A;  2I1N A;  2L4S A;  2PDZ A;  4KFV A;  3GCO A;  3OU0 A;  5HFB A;  1N99 A;  2EEH A;  3PS4 A;  5HFE A;  1X5N A;  3CBZ A;  2KL1 A;  5B6L A;  1RZX A;  3OTP A;  2X7Z A;  1Y7N A;  4AMH A;  4K72 A;  4O06 A;  2EDP A;  2I4S A;  3TSW A;  3GGE A;  2HE2 A;  2PKT A;  2YUB A;  3R69 A;  2FE5 A;  4REY A;  2JSN A;  3ZRT A;  2JWE A;  1N6F A;  1Z87 A;  4K6Y A;  3HPK A;  1MFL A;  1M5Z A;  2KYL A;  5HEB A;  4E35 A;  3ID1 A;  2OSG A;  4NMR A;  2DB5 A;  3VQF A;  2O2T A;  3GDS A;  4LMM A;  2CSJ A;  2EV8 A;  2KA9 A;  3MH6 A;  5HFD A;  2DLU A;  2PZD A;  1Q3P A;  2F0A A;  4WYU A;  1WHD A;  3QGL A;  4HOP B;  4Q3H A;  2I0L A;  3PDZ A;  1KY9 A;  4NXR A;  2D90 A;  2OPG A;  4NMT A;  5G1E A;  5HF4 A;  1FC7 A;  3WKL A;  5HEY A;  2H2C A;  3O5N A;  1W9E A;  2DMZ A;  4P2A B;  2KOJ A;  3NGH A;  1GM1 A;  4EDJ A;  2R3Y A;  3SFJ A;  3DJ3 A;  1BFE A;  4JOE A;  1WJL A;  2H2B A;  1WFV A;  2I6V A;  3PV2 A;  2I0I A;  2W4F A;  2PNT A;  5IL9 A;  1LCY A;  3GDV A;  3SUZ A;  3HVQ C;  3R68 A;  3DIW A;  5ILB A;  2PA1 A;  1GQ5 A;  2JIL A;  2DJT A;  4YDP A;  5H3J A;  2QG1 A;  3GAB A;  5E6P B;  1QAV A;  4Q6S A;  4E3B A;  4JOJ A;  5G1D A;  3GJ9 A;  3K50 A;  4Q2O A;  2QKV A;  1OBX A;  2MHO A;  2GZV A;  5I7Z A;  4KFW A;  3L4F D;  2JOA A;  1UEW A;  1N6D A;  3HPM A;  1WG6 A;  4JOF A;  1VA8 A;  2KG2 A;  1UIT A;  2Q9V A;  1P1D A;  2GEF A;  2QKU A;  2Q3G A;  4NMP A;  1KEF A;  2YTW A;  3QJM A;  2KOH A;  2AIN A;  4GVC A;  1ZOK A;  3KZE A;  2HGA A;  4OEP A;  1Q7X A;  2KPL A;  3DJA A;  2KV8 A;  2OMJ A;  5A2P A;  2YUY A;  4JOP A;  2EAQ A;  2EXG A;  4IC6 A;  3STJ A;  1P1E A;  4PQW A;  1X8S A;  1ZUB A;  3RL8 A;  2OZF A;  2ENO A;  2LA8 A;  5B42 A;  1OBY A;  2M0U A;  3KDG A;  2W7R A;  3VQG A;  2KBS A;  2ZPL A;  3MH7 A;  4K76 A;  4MPA A;  3CS0 A;  1X45 A;  2P3W A;  2VZ5 A;  2FN5 A;  2AWX A;  2JIN A;  1GQ4 A;  4NXP A;  4NXQ A;  2D8I A;  5JXB A;  4L8N A;  2E7K A;  5FHT A;  2LUI A;  4NMV A;  4Z33 A;  3GSL A;  5FB8 C;  5HED A;  2DC2 A;  1UHP A;  3FY5 A;  1KWA A;  3DJ1 A;  3QDO A;  1WIF A;  4G69 A;  2EEI A;  1FCF A;  2VPH A;  3CC0 A;  1Z86 A;  2QT5 A;  2DKR A;  3E17 A;  4JJ3 A;  3QE1 A;  1OZI A;  3LNY A;  2OGP A;  1RY4 A;  3CBY A;  2M3M A;  2IWN A;  4JOK A;  3TMH A;  3R0H A;  3BPU A;  3QJN A;  4JJ0 A;  2H3L A;  4F8K A;  2M0V A;  4XHV A;  5HFC A;  2Z17 A;  2CS5 A;  2LC6 A;  2R4H A;  1VCW A;  2YT7 A;  1UEZ A;  1RGW A;  1W9Q A;  2IWQ A;  3CH8 A;  1X5R A;  3TSZ A;  2EGK A;  2K20 A;  2BYG A;  3GDU A;  3PDV A;  4Q6H A;  2D92 A;  1QAV B;  1Q3O A;  1UM1 A;  1Y8T A;  2V90 A;  2DM8 A;  4FGM A;  1VAE A;  3NFL A;  2K1Z A;  2VSV A;  1UF1 A;  2EHR A;  1U38 A;  4UU6 A;  1N7E A;  1UM7 A;  2CSS A;  1WF8 A;  2MX6 A;  2M0T A;  4UU5 A;  2WL7 A;  2EEG A;  3K1R A;  1FC6 A;  1VJ6 A;  1UJD A;  4Z8J A;  1G9O A; 
#chains in the Genus database with same CATH homology
 1V62 A;  5GLJ A;  3RLE A;  2FNE A;  2IWO A;  2OQS A;  4E34 A;  1UEQ A;  1MFG A;  2G5M B;  1I16 A;  1W9O A;  1V6B A;  2QBW A;  1VB7 A;  1U39 A;  1V5L A;  3KZD A;  5HFF A;  1V1T A;  4GVD A;  2RCZ A;  4JOH A;  2G2L A;  1U37 A;  1BE9 A;  1R6J A;  1WHA A;  2AWW A;  3QIK A;  1UFX A;  5HET A;  5F67 A;  3I4W A;  2Z9I A;  4NNM A;  1V5Q A;  2YT8 A;  3WKM A;  4N6X A;  1UEP A;  3TSV A;  3GCN A;  3JXT A;  1X5Q A;  2VWR A;  3EGG C;  1N7F A;  2L97 A;  3DOR A;  3AXA A;  1UJV A;  2KQF A;  4NNL A;  3ID2 A;  5HJ1 A;  2JRE A;  4JL7 A;  1SOZ A;  3KDK A;  5F3X A;  2PKU A;  1XZ9 A;  2VRF A;  5EZ0 A;  4OAJ A;  1B8Q A;  1I92 A;  2LC7 A;  4RI0 A;  1N7T A;  3I1E A;  1FC9 A;  5DTH A;  3ID4 A;  1MC7 A;  2OCS A;  1NTE A;  1TQ3 A;  2DLS A;  4HOP A;  4H11 A;  2FCF A;  5EYZ A;  4NMS A;  2EGN A;  1QAU A;  4K75 A;  2EDV A;  1OBZ A;  1N6E A;  2RRM A;  1WI4 A;  1X6D A;  1TP5 A;  1WI2 A;  5E1Y A;  3MH4 A;  1L6O A;  1UJU A;  4NMQ A;  1IHJ A;  4WYT A;  1WF7 A;  2OS6 A;  3PV4 A;  3B76 A;  4OEO A;  2EGO A;  3SHU A;  3SHW A;  2L4T A;  4FLN A;  3O46 A;  1TE0 A;  1WH1 A;  2LOB A;  5E11 A;  2UZC A;  4JOR A;  1X9Z A;  1SOT A;  4R2Z A;  1T2M A;  2KAW A;  3CBX A;  5HDY A;  2KJK A;  2JIK A;  1PDR A;  2DAZ A;  2JXO A;  2F5Y A;  1K32 A;  4NMO A;  3NCV A;  3K82 A;  3I18 A;  4Q2Q A;  5E21 A;  5HF1 A;  1IU2 A;  2AWU A;  2ZPM A;  4K78 A;  5E22 A;  5GND A;  2EDZ A;  3NFK A;  4P0C A;  1TP3 A;  1U3B A;  2V1W A;  2KPK A;  3QO6 A;  5D13 A;  2EEJ A;  1IU0 A;  4Q2N A;  1RGR A;  2EJY A;  2KJD A;  2QKT A;  4YYX A;  2KJP A;  3PV5 A;  4Q2P A;  2M0Z A;  3RL7 A;  3SOE A;  2REY A;  1YBO A;  2I04 A;  2VSP A;  2HE4 A;  2KRG A;  3KHF A;  2KOM A;  2H3M A;  3LNX A;  3ID3 A;  3CYY A;  4GHN A;  1QLC A;  1D5G A;  1NF3 C;  4JOG A;  2IWP A;  1WFG A;  3EGH C;  2M10 A;  2I1N A;  2L4S A;  2PDZ A;  4KFV A;  3GCO A;  3OU0 A;  5HFB A;  1N99 A;  2EEH A;  3PS4 A;  5HFE A;  1X5N A;  3CBZ A;  2KL1 A;  5B6L A;  1RZX A;  3OTP A;  2X7Z A;  1Y7N A;  4AMH A;  4K72 A;  4O06 A;  2EDP A;  2I4S A;  3TSW A;  3GGE A;  2HE2 A;  2PKT A;  2YUB A;  3R69 A;  2FE5 A;  4REY A;  2JSN A;  3ZRT A;  2JWE A;  1N6F A;  1Z87 A;  4K6Y A;  3HPK A;  1MFL A;  1M5Z A;  2KYL A;  5HEB A;  4E35 A;  3ID1 A;  2OSG A;  4NMR A;  2DB5 A;  3VQF A;  2O2T A;  3GDS A;  4LMM A;  2CSJ A;  2EV8 A;  2KA9 A;  3MH6 A;  5HFD A;  2DLU A;  2PZD A;  1Q3P A;  2F0A A;  4WYU A;  1WHD A;  3QGL A;  4HOP B;  4Q3H A;  2I0L A;  3PDZ A;  1KY9 A;  4NXR A;  2D90 A;  2OPG A;  4NMT A;  5G1E A;  5HF4 A;  1FC7 A;  3WKL A;  5HEY A;  2H2C A;  3O5N A;  1W9E A;  2DMZ A;  4P2A B;  2KOJ A;  3NGH A;  1GM1 A;  4EDJ A;  2R3Y A;  3SFJ A;  3DJ3 A;  1BFE A;  4JOE A;  1WJL A;  2H2B A;  1WFV A;  2I6V A;  3PV2 A;  2I0I A;  2W4F A;  2PNT A;  5IL9 A;  1LCY A;  3GDV A;  3SUZ A;  3HVQ C;  3R68 A;  3DIW A;  5ILB A;  2PA1 A;  1GQ5 A;  2JIL A;  2DJT A;  4YDP A;  5H3J A;  2QG1 A;  3GAB A;  5E6P B;  1QAV A;  4Q6S A;  4E3B A;  4JOJ A;  5G1D A;  3GJ9 A;  3K50 A;  4Q2O A;  2QKV A;  1OBX A;  2MHO A;  2GZV A;  5I7Z A;  4KFW A;  3L4F D;  2JOA A;  1UEW A;  1N6D A;  3HPM A;  1WG6 A;  4JOF A;  1VA8 A;  2KG2 A;  1UIT A;  2Q9V A;  1P1D A;  2GEF A;  2QKU A;  2Q3G A;  4NMP A;  1KEF A;  2YTW A;  3QJM A;  2KOH A;  2AIN A;  4GVC A;  1ZOK A;  3KZE A;  2HGA A;  4OEP A;  1Q7X A;  2KPL A;  3DJA A;  2KV8 A;  2OMJ A;  5A2P A;  2YUY A;  4JOP A;  2EAQ A;  2EXG A;  4IC6 A;  3STJ A;  1P1E A;  4PQW A;  1X8S A;  1ZUB A;  3RL8 A;  2OZF A;  2ENO A;  2LA8 A;  5B42 A;  1OBY A;  2M0U A;  3KDG A;  2W7R A;  3VQG A;  2KBS A;  2ZPL A;  3MH7 A;  4K76 A;  4MPA A;  3CS0 A;  1X45 A;  2P3W A;  2VZ5 A;  2FN5 A;  2AWX A;  2JIN A;  1GQ4 A;  4NXP A;  4NXQ A;  2D8I A;  5JXB A;  4L8N A;  2E7K A;  5FHT A;  2LUI A;  4NMV A;  4Z33 A;  3GSL A;  5FB8 C;  5HED A;  2DC2 A;  1UHP A;  3FY5 A;  1KWA A;  3DJ1 A;  3QDO A;  1WIF A;  4G69 A;  2EEI A;  1FCF A;  2VPH A;  3CC0 A;  1Z86 A;  2QT5 A;  2DKR A;  3E17 A;  4JJ3 A;  3QE1 A;  1OZI A;  3LNY A;  2OGP A;  1RY4 A;  3CBY A;  2M3M A;  2IWN A;  4JOK A;  3TMH A;  3R0H A;  3BPU A;  3QJN A;  4JJ0 A;  2H3L A;  4F8K A;  2M0V A;  4XHV A;  5HFC A;  2Z17 A;  2CS5 A;  2LC6 A;  2R4H A;  1VCW A;  2YT7 A;  1UEZ A;  1RGW A;  1W9Q A;  2IWQ A;  3CH8 A;  1X5R A;  3TSZ A;  2EGK A;  2K20 A;  2BYG A;  3GDU A;  3PDV A;  4Q6H A;  2D92 A;  1QAV B;  1Q3O A;  1UM1 A;  1Y8T A;  2V90 A;  2DM8 A;  4FGM A;  1VAE A;  3NFL A;  2K1Z A;  2VSV A;  1UF1 A;  2EHR A;  1U38 A;  4UU6 A;  1N7E A;  1UM7 A;  2CSS A;  1WF8 A;  2MX6 A;  2M0T A;  4UU5 A;  2WL7 A;  2EEG A;  3K1R A;  1FC6 A;  1VJ6 A;  1UJD A;  4Z8J A;  1G9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...