4YYXA

Crystal structure of the zo-1 pdz1 domain in complex with the 7-mer claudin2 c-terminal tail
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
MIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGYSLTGYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1 fused with Claudin-2 C-terminal
publication title Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4yyxA00
1UJDA 2FE5A 1IU2A 1MC7A 2EAQA 1GQ5A 2JILA 1U3BA 2EV8A 2DC2A 1N6DA 1UITA 3HPMA 1TQ3A 2LA8A 1VCWA 1WF7A 4KFWA 4Q3HA 4NMPA 3MH4A 1OBZA 3CBZA 3NGHA 2W4FA 1VA8A 4Q2PA 2DMZA 1R6JA 2KA9A 1RGWA 4NMTA 5E21A 2PZDA 4OAJA 2IWPA 1V5QA 2JOAA 4HOPA 1QAVB 2RCZA 4NMRA 1WIFA 3PV4A 2V90A 2YTWA 3R0HA 2H3MA 4YYXA 3I4WA 1Z86A 2VSVA 1WHDA 2K1ZA 4IC6A 3GDSA 4R2ZA 5I7ZA 2EDPA 5HEBA 5EYZA 3K82A 1X5NA 2CSSA 1WF8A 1VJ6A 3PV5A 4K6YA 2OQSA 1RY4A 1G9OA 5HJ1A 2EXGA 4Q2QA 2AWWA 4HOPB 4MPAA 2G2LA 4Q2OA 2VZ5A 2VSPA 3DJ3A 2L4TA 5F67A 4JOJA 3QJNA 3HPKA 2KPKA 1QLCA 2YUBA 5F3XA 4YDPA 5GNDA 5FHTA 3LNYA 1P1EA 2L97A 3SHUA 1RGRA 2EGNA 2OGPA 2DB5A 3NFKA 1X5QA 2M10A 2F0AA 5G1DA 1V6BA 2D90A 1UEQA 5DTHA 1D5GA 3QJMA 4JORA 2PNTA 5HDYA 3ID4A 5HEYA 3QDOA 3TSZA 1NTEA 2CS5A 2IWQA 5HFBA 2YT7A 3LNXA 3O46A 4AMHA 1FCFA 3FY5A 2VWRA 3QO6A 3GCNA 4UU5A 5B6LA 1VB7A 2I1NA 1W9EA 3RLEA 1I16A 4K72A 1X6DA 2LC6A 3NFLA 4O06A 2EGOA 5HFCA 1RZXA 2Q3GA 1WHAA 2KV8A 4K78A 1XZ9A 5GLJA 2JREA 3GCOA 1UM7A 3SUZA 3WKLA 5E1YA 2QT5A 2FCFA 1UJVA 2X7ZA 1Y8TA 2EEIA 1I92A 3WKMA 1UFXA 3PS4A 5HFFA 1UEPA 2I04A 3AXAA 2QBWA 2EDVA 4OEOA 4NMQA 2HGAA 2F5YA 2LC7A 5HETA 1K32A 3PV2A 1UEZA 1WFVA 3KZDA 3SFJA 4Q6HA 4REYA 2L4SA 2JXOA 4GVDA 1Q3OA 2OZFA 1VAEA 3KZEA 1BFEA 3BPUA 2WL7A 2EEHA 3DIWA 1QAUA 2VPHA 3HVQC 2FNEA 4KFVA 1Y7NA 3JXTA 2I6VA 4E34A 1MFGA 1U38A 2OS6A 4G69A 4WYTA 2KYLA 1Z87A 2M0VA 2KL1A 1YBOA 4OEPA 2KJDA 5H3JA 2DJTA 1WJLA 2OSGA 5HF1A 3GDVA 4JOPA 2HE4A 3DJ1A 1U39A 2BYGA 2DLSA 5E22A 2AWUA 1W9OA 2KAWA 4XHVA 3CYYA 4NNLA 1SOZA 2LOBA 2KQFA 2I4SA 1FC9A 1WI4A 2GZVA 3ID3A 2OMJA 3ZRTA 2CSJA 4NXRA 2H3LA 5HF4A 1P1DA 3E17A 1OZIA 2PDZA 3GGEA 2D8IA 4PQWA 2KRGA 2M0TA 1GQ4A 1KEFA 1U37A 3L4FD 4GVCA 4E3BA 3EGGC 2R3YA 1X45A 2EEGA 2JWEA 2W7RA 1M5ZA 3PDZA 4P2AB 5HFDA 2E7KA 1IHJA 3EGHC 2I0LA 3K50A 4WYUA 4F8KA 2PA1A 2QKUA 1WI2A 4K76A 1WH1A 2QKTA 4NMSA 2AINA 2MHOA 5FB8C 3VQFA 3ID2A 4JOFA 3MH6A 2DM8A 1N99A 2KOJA 2QKVA 2KJPA 1SOTA 2IWOA 2ZPLA 2Q9VA 2JINA 4LMMA 4Z8JA 3QGLA 2HE2A 2KJKA 1UM1A 2O2TA 5D13A 4NNMA 4JOHA 2KPLA 2DLUA 2PKUA 1X5RA 3MH7A 1BE9A 2FN5A 5HEDA 4N6XA 3STJA 1UEWA 2YT8A 4JL7A 1V62A 4H11A 3SOEA 2D92A 2JIKA 2EEJA 1N7EA 3PDVA 2RRMA 3CBXA 2KOHA 3OU0A 1L6OA 1UF1A 1TE0A 2DAZA 3VQGA 4JOEA 4JOGA 2EGKA 2KOMA 1Q3PA 1PDRA 4Z33A 3CC0A 2V1WA 5G1EA 2DKRA 2Z9IA 3R68A 2EDZA 2OCSA 1OBXA 2K20A 5E6PB 2MX6A 1T2MA 2UZCA 3TSWA 2G5MB 3RL8A 3O5NA 4NMVA 1Q7XA 1V5LA 2YUYA 4JOKA 1B8QA 1WFGA 2ZPMA 1W9QA 1N7FA 1TP5A 2KBSA 2P3WA 2QG1A 2I0IA 2M0UA 1FC7A 3I1EA 4NXQA 3GDUA 4NMOA 3OTPA 2H2BA 3ID1A 4EDJA 3QIKA 4GHNA 4UU6A 3SHWA 2KG2A 1MFLA 1UJUA 1NF3C 1N6EA 4E35A 4P0CA 4K75A 3KHFA 3DORA 3DJAA 1ZOKA 2IWNA 5JXBA 1OBYA 3TMHA 3CBYA 3B76A 2EHRA 2OPGA 4FGMA 3CS0A 3R69A 2VRFA 3GJ9A 4L8NA 3I18A 4Q2NA 1FC6A 3RL7A 2AWXA 2ENOA 5A2PA 1V1TA 4RI0A 3QE1A 1IU0A 3CH8A 1TP3A 2EJYA 1X8SA 1ZUBA 1N6FA 5HFEA 4NXPA 2Z17A 4Q6SA 1KWAA 2R4HA 2LUIA 3TSVA 2PKTA 2REYA 5E11A 1UHPA 5EZ0A 2M0ZA 2M3MA 3K1RA 1WG6A 2H2CA 1N7TA 1QAVA 1KY9A 3GSLA 1LCYA 1GM1A
chains in the Genus database with same CATH superfamily
1UJDA 2FE5A 1IU2A 1MC7A 2EAQA 1GQ5A 2JILA 1U3BA 2EV8A 2DC2A 1N6DA 1UITA 3HPMA 1TQ3A 2LA8A 1VCWA 1WF7A 4KFWA 4Q3HA 4NMPA 3MH4A 1OBZA 3CBZA 3NGHA 2W4FA 1VA8A 4Q2PA 2DMZA 1R6JA 2KA9A 1RGWA 4NMTA 5E21A 2PZDA 4OAJA 2IWPA 1V5QA 2JOAA 4HOPA 1QAVB 2RCZA 4JJ3A 4NMRA 5ILBA 1WIFA 3PV4A 2V90A 2YTWA 3R0HA 2H3MA 4YYXA 3I4WA 1Z86A 2VSVA 1WHDA 2K1ZA 4IC6A 3GDSA 4R2ZA 5I7ZA 2EDPA 5HEBA 5EYZA 3K82A 1X5NA 2CSSA 1WF8A 1VJ6A 3PV5A 4K6YA 2OQSA 1RY4A 1G9OA 5HJ1A 2EXGA 4Q2QA 2AWWA 4HOPB 4MPAA 2G2LA 4Q2OA 2VZ5A 4JJ0A 2VSPA 3DJ3A 2L4TA 5F67A 4JOJA 3QJNA 3HPKA 2KPKA 1QLCA 2YUBA 5F3XA 4YDPA 5GNDA 5FHTA 3LNYA 1X9ZA 1P1EA 2L97A 3SHUA 1RGRA 2EGNA 2OGPA 2DB5A 3NFKA 1X5QA 2M10A 2F0AA 5G1DA 1V6BA 2D90A 1UEQA 5DTHA 1D5GA 3QJMA 4JORA 2PNTA 5HDYA 5B42A 3ID4A 5HEYA 3QDOA 3TSZA 1NTEA 2CS5A 2IWQA 5HFBA 2YT7A 3LNXA 3O46A 4AMHA 1FCFA 3FY5A 2VWRA 3QO6A 3GCNA 4UU5A 5B6LA 1VB7A 2I1NA 1W9EA 3RLEA 1I16A 4K72A 1X6DA 2LC6A 3NFLA 4O06A 2EGOA 5HFCA 1RZXA 2Q3GA 1WHAA 2KV8A 4K78A 1XZ9A 5GLJA 2JREA 3GCOA 1UM7A 3SUZA 3WKLA 5E1YA 2QT5A 2FCFA 1UJVA 2X7ZA 1Y8TA 2EEIA 1I92A 3KDGA 3WKMA 1UFXA 3PS4A 5HFFA 1UEPA 2I04A 3AXAA 2QBWA 2EDVA 4OEOA 4NMQA 2HGAA 2F5YA 2LC7A 3GABA 1K32A 5HETA 3PV2A 1UEZA 1WFVA 3KZDA 3SFJA 4Q6HA 4REYA 2L4SA 2JXOA 4GVDA 1Q3OA 2OZFA 1VAEA 2JSNA 1BFEA 3KZEA 3BPUA 2WL7A 2EEHA 3DIWA 1QAUA 2VPHA 3HVQC 2FNEA 4KFVA 1Y7NA 3JXTA 2I6VA 4E34A 1MFGA 1U38A 2OS6A 4G69A 4FLNA 4WYTA 2KYLA 1Z87A 2M0VA 2KL1A 1YBOA 4OEPA 2KJDA 5H3JA 2DJTA 1WJLA 2OSGA 5HF1A 3GDVA 4JOPA 2HE4A 3DJ1A 1U39A 2BYGA 2DLSA 5E22A 2AWUA 1W9OA 2KAWA 4XHVA 3CYYA 4NNLA 1SOZA 2LOBA 2KQFA 2I4SA 1FC9A 1WI4A 2GZVA 3ID3A 2OMJA 3ZRTA 2CSJA 4NXRA 2H3LA 5HF4A 1P1DA 3E17A 1OZIA 2PDZA 3GGEA 2D8IA 4PQWA 2KRGA 2M0TA 1GQ4A 1KEFA 1U37A 3L4FD 4GVCA 4E3BA 3EGGC 2R3YA 1X45A 2EEGA 2JWEA 2W7RA 1M5ZA 3PDZA 4P2AB 5HFDA 2E7KA 1IHJA 3EGHC 2I0LA 3K50A 4WYUA 4F8KA 2PA1A 2QKUA 1WI2A 4K76A 1WH1A 2QKTA 4NMSA 2AINA 2MHOA 5FB8C 3VQFA 3ID2A 4JOFA 3MH6A 2DM8A 1N99A 2KOJA 2QKVA 2KJPA 1SOTA 2IWOA 2ZPLA 2Q9VA 2JINA 4LMMA 4Z8JA 5IL9A 3QGLA 2HE2A 2KJKA 1UM1A 2O2TA 5D13A 4NNMA 4JOHA 2KPLA 2DLUA 2PKUA 1X5RA 3MH7A 1BE9A 2FN5A 5HEDA 4N6XA 3STJA 1UEWA 2YT8A 4JL7A 1V62A 4H11A 3SOEA 2D92A 2JIKA 2EEJA 1N7EA 3PDVA 2RRMA 3CBXA 2KOHA 3OU0A 1L6OA 1UF1A 1TE0A 2DAZA 3VQGA 4JOEA 4JOGA 2EGKA 2KOMA 1Q3PA 1PDRA 4Z33A 3CC0A 2V1WA 5G1EA 2DKRA 2Z9IA 3R68A 2EDZA 2OCSA 1OBXA 2K20A 5E6PB 2MX6A 1T2MA 2UZCA 3TSWA 2G5MB 3RL8A 3O5NA 4NMVA 1Q7XA 1V5LA 2YUYA 4JOKA 1B8QA 1WFGA 2ZPMA 1W9QA 1N7FA 1TP5A 2KBSA 2P3WA 2QG1A 2I0IA 2M0UA 1FC7A 3I1EA 4NXQA 3GDUA 4NMOA 3OTPA 2H2BA 3ID1A 4EDJA 3QIKA 4GHNA 4UU6A 3SHWA 2KG2A 1MFLA 1UJUA 1NF3C 1N6EA 4E35A 4P0CA 4K75A 3KHFA 3DORA 3DJAA 1ZOKA 2IWNA 5JXBA 1OBYA 3TMHA 3CBYA 3B76A 2EHRA 2OPGA 4FGMA 3CS0A 3R69A 2VRFA 3GJ9A 4L8NA 3I18A 4Q2NA 1FC6A 3RL7A 2AWXA 2ENOA 5A2PA 1V1TA 3KDKA 4RI0A 3QE1A 1IU0A 3CH8A 1TP3A 2EJYA 2GEFA 1X8SA 1ZUBA 1N6FA 5HFEA 4NXPA 2Z17A 4Q6SA 1KWAA 2R4HA 2LUIA 3TSVA 2PKTA 2REYA 5E11A 1UHPA 5EZ0A 2M0ZA 2M3MA 3K1RA 1WG6A 2H2CA 1N7TA 1QAVA 1KY9A 3NCVA 3GSLA 1LCYA 1GM1A
chains in the Genus database with same CATH topology
1UJDA 2FE5A 1IU2A 1MC7A 2EAQA 1GQ5A 2JILA 1U3BA 2EV8A 2DC2A 1N6DA 1UITA 3HPMA 1TQ3A 2LA8A 1VCWA 1WF7A 4KFWA 4Q3HA 4NMPA 3MH4A 1OBZA 3CBZA 3NGHA 2W4FA 1VA8A 4Q2PA 2DMZA 1R6JA 2KA9A 1RGWA 4NMTA 5E21A 2PZDA 4OAJA 2IWPA 1V5QA 2JOAA 4HOPA 1QAVB 2RCZA 4JJ3A 4NMRA 5ILBA 1WIFA 3PV4A 2V90A 2YTWA 3R0HA 2H3MA 4YYXA 3I4WA 1Z86A 2VSVA 1WHDA 2K1ZA 4IC6A 3GDSA 4R2ZA 5I7ZA 2EDPA 5HEBA 5EYZA 3K82A 1X5NA 2CSSA 1WF8A 1VJ6A 3PV5A 4K6YA 2OQSA 1RY4A 1G9OA 5HJ1A 2EXGA 4Q2QA 2AWWA 4HOPB 4MPAA 2G2LA 4Q2OA 2VZ5A 4JJ0A 2VSPA 3DJ3A 2L4TA 5F67A 4JOJA 3QJNA 3HPKA 2KPKA 1QLCA 2YUBA 5F3XA 4YDPA 5GNDA 5FHTA 3LNYA 1X9ZA 1P1EA 2L97A 3SHUA 1RGRA 2EGNA 2OGPA 2DB5A 3NFKA 1X5QA 2M10A 2F0AA 5G1DA 1V6BA 2D90A 1UEQA 5DTHA 1D5GA 3QJMA 4JORA 2PNTA 5HDYA 5B42A 3ID4A 5HEYA 3QDOA 3TSZA 1NTEA 2CS5A 2IWQA 5HFBA 2YT7A 3LNXA 3O46A 4AMHA 1FCFA 3FY5A 2VWRA 3QO6A 3GCNA 4UU5A 5B6LA 1VB7A 2I1NA 1W9EA 3RLEA 1I16A 4K72A 1X6DA 2LC6A 3NFLA 4O06A 2EGOA 5HFCA 1RZXA 2Q3GA 1WHAA 2KV8A 4K78A 1XZ9A 5GLJA 2JREA 3GCOA 1UM7A 3SUZA 3WKLA 5E1YA 2QT5A 2FCFA 1UJVA 2X7ZA 1Y8TA 2EEIA 1I92A 3KDGA 3WKMA 1UFXA 3PS4A 5HFFA 1UEPA 2I04A 3AXAA 2QBWA 2EDVA 4OEOA 4NMQA 2HGAA 2F5YA 2LC7A 3GABA 1K32A 5HETA 3PV2A 1UEZA 1WFVA 3KZDA 3SFJA 4Q6HA 4REYA 2L4SA 2JXOA 4GVDA 1Q3OA 2OZFA 1VAEA 2JSNA 1BFEA 3KZEA 3BPUA 2WL7A 2EEHA 3DIWA 1QAUA 2VPHA 3HVQC 2FNEA 4KFVA 1Y7NA 3JXTA 2I6VA 4E34A 1MFGA 1U38A 2OS6A 4G69A 4FLNA 4WYTA 2KYLA 1Z87A 2M0VA 2KL1A 1YBOA 4OEPA 2KJDA 5H3JA 2DJTA 1WJLA 2OSGA 5HF1A 3GDVA 4JOPA 2HE4A 3DJ1A 1U39A 2BYGA 2DLSA 5E22A 2AWUA 1W9OA 2KAWA 4XHVA 3CYYA 4NNLA 1SOZA 2LOBA 2KQFA 2I4SA 1FC9A 1WI4A 2GZVA 3ID3A 2OMJA 3ZRTA 2CSJA 4NXRA 2H3LA 5HF4A 1P1DA 3E17A 1OZIA 2PDZA 3GGEA 2D8IA 4PQWA 2KRGA 2M0TA 1GQ4A 1KEFA 1U37A 3L4FD 4GVCA 4E3BA 3EGGC 2R3YA 1X45A 2EEGA 2JWEA 2W7RA 1M5ZA 3PDZA 4P2AB 5HFDA 2E7KA 1IHJA 3EGHC 2I0LA 3K50A 4WYUA 4F8KA 2PA1A 2QKUA 1WI2A 4K76A 1WH1A 2QKTA 4NMSA 2AINA 2MHOA 5FB8C 3VQFA 3ID2A 4JOFA 3MH6A 2DM8A 1N99A 2KOJA 2QKVA 2KJPA 1SOTA 2IWOA 2ZPLA 2Q9VA 2JINA 4LMMA 4Z8JA 5IL9A 3QGLA 2HE2A 2KJKA 1UM1A 2O2TA 5D13A 4NNMA 4JOHA 2KPLA 2DLUA 2PKUA 1X5RA 3MH7A 1BE9A 2FN5A 5HEDA 4N6XA 3STJA 1UEWA 2YT8A 4JL7A 1V62A 4H11A 3SOEA 2D92A 2JIKA 2EEJA 1N7EA 3PDVA 2RRMA 3CBXA 2KOHA 3OU0A 1L6OA 1UF1A 1TE0A 2DAZA 3VQGA 4JOEA 4JOGA 2EGKA 2KOMA 1Q3PA 1PDRA 4Z33A 3CC0A 2V1WA 5G1EA 2DKRA 2Z9IA 3R68A 2EDZA 2OCSA 1OBXA 2K20A 5E6PB 2MX6A 1T2MA 2UZCA 3TSWA 2G5MB 3RL8A 3O5NA 4NMVA 1Q7XA 1V5LA 2YUYA 4JOKA 1B8QA 1WFGA 2ZPMA 1W9QA 1N7FA 1TP5A 2KBSA 2P3WA 2QG1A 2I0IA 2M0UA 1FC7A 3I1EA 4NXQA 3GDUA 4NMOA 3OTPA 2H2BA 3ID1A 4EDJA 3QIKA 4GHNA 4UU6A 3SHWA 2KG2A 1MFLA 1UJUA 1NF3C 1N6EA 4E35A 4P0CA 4K75A 3KHFA 3DORA 3DJAA 1ZOKA 2IWNA 5JXBA 1OBYA 3TMHA 3CBYA 3B76A 2EHRA 2OPGA 4FGMA 3CS0A 3R69A 2VRFA 3GJ9A 4L8NA 3I18A 4Q2NA 1FC6A 3RL7A 2AWXA 2ENOA 5A2PA 1V1TA 3KDKA 4RI0A 3QE1A 1IU0A 3CH8A 1TP3A 2EJYA 2GEFA 1X8SA 1ZUBA 1N6FA 5HFEA 4NXPA 2Z17A 4Q6SA 1KWAA 2R4HA 2LUIA 3TSVA 2PKTA 2REYA 5E11A 1UHPA 5EZ0A 2M0ZA 2M3MA 3K1RA 1WG6A 2H2CA 1N7TA 1QAVA 1KY9A 3NCVA 3GSLA 1LCYA 1GM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJD A;  2FE5 A;  1IU2 A;  1MC7 A;  2EAQ A;  1GQ5 A;  2JIL A;  1U3B A;  2EV8 A;  2DC2 A;  1N6D A;  1UIT A;  3HPM A;  1TQ3 A;  2LA8 A;  1VCW A;  1WF7 A;  4KFW A;  4Q3H A;  4NMP A;  3MH4 A;  1OBZ A;  3CBZ A;  3NGH A;  2W4F A;  1VA8 A;  4Q2P A;  2DMZ A;  1R6J A;  2KA9 A;  1RGW A;  4NMT A;  5E21 A;  2PZD A;  4OAJ A;  2IWP A;  1V5Q A;  2JOA A;  4HOP A;  1QAV B;  2RCZ A;  4NMR A;  1WIF A;  3PV4 A;  2V90 A;  2YTW A;  3R0H A;  2H3M A;  4YYX A;  3I4W A;  1Z86 A;  2VSV A;  1WHD A;  2K1Z A;  4IC6 A;  3GDS A;  4R2Z A;  5I7Z A;  2EDP A;  5HEB A;  5EYZ A;  3K82 A;  1X5N A;  2CSS A;  1WF8 A;  1VJ6 A;  3PV5 A;  4K6Y A;  2OQS A;  1RY4 A;  1G9O A;  5HJ1 A;  2EXG A;  4Q2Q A;  2AWW A;  4HOP B;  4MPA A;  2G2L A;  4Q2O A;  2VZ5 A;  2VSP A;  3DJ3 A;  2L4T A;  5F67 A;  4JOJ A;  3QJN A;  3HPK A;  2KPK A;  1QLC A;  2YUB A;  5F3X A;  4YDP A;  5GND A;  5FHT A;  3LNY A;  1P1E A;  2L97 A;  3SHU A;  1RGR A;  2EGN A;  2OGP A;  2DB5 A;  3NFK A;  1X5Q A;  2M10 A;  2F0A A;  5G1D A;  1V6B A;  2D90 A;  1UEQ A;  5DTH A;  1D5G A;  3QJM A;  4JOR A;  2PNT A;  5HDY A;  3ID4 A;  5HEY A;  3QDO A;  3TSZ A;  1NTE A;  2CS5 A;  2IWQ A;  5HFB A;  2YT7 A;  3LNX A;  3O46 A;  4AMH A;  1FCF A;  3FY5 A;  2VWR A;  3QO6 A;  3GCN A;  4UU5 A;  5B6L A;  1VB7 A;  2I1N A;  1W9E A;  3RLE A;  1I16 A;  4K72 A;  1X6D A;  2LC6 A;  3NFL A;  4O06 A;  2EGO A;  5HFC A;  1RZX A;  2Q3G A;  1WHA A;  2KV8 A;  4K78 A;  1XZ9 A;  5GLJ A;  2JRE A;  3GCO A;  1UM7 A;  3SUZ A;  3WKL A;  5E1Y A;  2QT5 A;  2FCF A;  1UJV A;  2X7Z A;  1Y8T A;  2EEI A;  1I92 A;  3WKM A;  1UFX A;  3PS4 A;  5HFF A;  1UEP A;  2I04 A;  3AXA A;  2QBW A;  2EDV A;  4OEO A;  4NMQ A;  2HGA A;  2F5Y A;  2LC7 A;  5HET A;  1K32 A;  3PV2 A;  1UEZ A;  1WFV A;  3KZD A;  3SFJ A;  4Q6H A;  4REY A;  2L4S A;  2JXO A;  4GVD A;  1Q3O A;  2OZF A;  1VAE A;  3KZE A;  1BFE A;  3BPU A;  2WL7 A;  2EEH A;  3DIW A;  1QAU A;  2VPH A;  3HVQ C;  2FNE A;  4KFV A;  1Y7N A;  3JXT A;  2I6V A;  4E34 A;  1MFG A;  1U38 A;  2OS6 A;  4G69 A;  4WYT A;  2KYL A;  1Z87 A;  2M0V A;  2KL1 A;  1YBO A;  4OEP A;  2KJD A;  5H3J A;  2DJT A;  1WJL A;  2OSG A;  5HF1 A;  3GDV A;  4JOP A;  2HE4 A;  3DJ1 A;  1U39 A;  2BYG A;  2DLS A;  5E22 A;  2AWU A;  1W9O A;  2KAW A;  4XHV A;  3CYY A;  4NNL A;  1SOZ A;  2LOB A;  2KQF A;  2I4S A;  1FC9 A;  1WI4 A;  2GZV A;  3ID3 A;  2OMJ A;  3ZRT A;  2CSJ A;  4NXR A;  2H3L A;  5HF4 A;  1P1D A;  3E17 A;  1OZI A;  2PDZ A;  3GGE A;  2D8I A;  4PQW A;  2KRG A;  2M0T A;  1GQ4 A;  1KEF A;  1U37 A;  3L4F D;  4GVC A;  4E3B A;  3EGG C;  2R3Y A;  1X45 A;  2EEG A;  2JWE A;  2W7R A;  1M5Z A;  3PDZ A;  4P2A B;  5HFD A;  2E7K A;  1IHJ A;  3EGH C;  2I0L A;  3K50 A;  4WYU A;  4F8K A;  2PA1 A;  2QKU A;  1WI2 A;  4K76 A;  1WH1 A;  2QKT A;  4NMS A;  2AIN A;  2MHO A;  5FB8 C;  3VQF A;  3ID2 A;  4JOF A;  3MH6 A;  2DM8 A;  1N99 A;  2KOJ A;  2QKV A;  2KJP A;  1SOT A;  2IWO A;  2ZPL A;  2Q9V A;  2JIN A;  4LMM A;  4Z8J A;  3QGL A;  2HE2 A;  2KJK A;  1UM1 A;  2O2T A;  5D13 A;  4NNM A;  4JOH A;  2KPL A;  2DLU A;  2PKU A;  1X5R A;  3MH7 A;  1BE9 A;  2FN5 A;  5HED A;  4N6X A;  3STJ A;  1UEW A;  2YT8 A;  4JL7 A;  1V62 A;  4H11 A;  3SOE A;  2D92 A;  2JIK A;  2EEJ A;  1N7E A;  3PDV A;  2RRM A;  3CBX A;  2KOH A;  3OU0 A;  1L6O A;  1UF1 A;  1TE0 A;  2DAZ A;  3VQG A;  4JOE A;  4JOG A;  2EGK A;  2KOM A;  1Q3P A;  1PDR A;  4Z33 A;  3CC0 A;  2V1W A;  5G1E A;  2DKR A;  2Z9I A;  3R68 A;  2EDZ A;  2OCS A;  1OBX A;  2K20 A;  5E6P B;  2MX6 A;  1T2M A;  2UZC A;  3TSW A;  2G5M B;  3RL8 A;  3O5N A;  4NMV A;  1Q7X A;  1V5L A;  2YUY A;  4JOK A;  1B8Q A;  1WFG A;  2ZPM A;  1W9Q A;  1N7F A;  1TP5 A;  2KBS A;  2P3W A;  2QG1 A;  2I0I A;  2M0U A;  1FC7 A;  3I1E A;  4NXQ A;  3GDU A;  4NMO A;  3OTP A;  2H2B A;  3ID1 A;  4EDJ A;  3QIK A;  4GHN A;  4UU6 A;  3SHW A;  2KG2 A;  1MFL A;  1UJU A;  1NF3 C;  1N6E A;  4E35 A;  4P0C A;  4K75 A;  3KHF A;  3DOR A;  3DJA A;  1ZOK A;  2IWN A;  5JXB A;  1OBY A;  3TMH A;  3CBY A;  3B76 A;  2EHR A;  2OPG A;  4FGM A;  3CS0 A;  3R69 A;  2VRF A;  3GJ9 A;  4L8N A;  3I18 A;  4Q2N A;  1FC6 A;  3RL7 A;  2AWX A;  2ENO A;  5A2P A;  1V1T A;  4RI0 A;  3QE1 A;  1IU0 A;  3CH8 A;  1TP3 A;  2EJY A;  1X8S A;  1ZUB A;  1N6F A;  5HFE A;  4NXP A;  2Z17 A;  4Q6S A;  1KWA A;  2R4H A;  2LUI A;  3TSV A;  2PKT A;  2REY A;  5E11 A;  1UHP A;  5EZ0 A;  2M0Z A;  2M3M A;  3K1R A;  1WG6 A;  2H2C A;  1N7T A;  1QAV A;  1KY9 A;  3GSL A;  1LCY A;  1GM1 A; 
#chains in the Genus database with same CATH topology
 1UJD A;  2FE5 A;  1IU2 A;  1MC7 A;  2EAQ A;  1GQ5 A;  2JIL A;  1U3B A;  2EV8 A;  2DC2 A;  1N6D A;  1UIT A;  3HPM A;  1TQ3 A;  2LA8 A;  1VCW A;  1WF7 A;  4KFW A;  4Q3H A;  4NMP A;  3MH4 A;  1OBZ A;  3CBZ A;  3NGH A;  2W4F A;  1VA8 A;  4Q2P A;  2DMZ A;  1R6J A;  2KA9 A;  1RGW A;  4NMT A;  5E21 A;  2PZD A;  4OAJ A;  2IWP A;  1V5Q A;  2JOA A;  4HOP A;  1QAV B;  2RCZ A;  4JJ3 A;  4NMR A;  5ILB A;  1WIF A;  3PV4 A;  2V90 A;  2YTW A;  3R0H A;  2H3M A;  4YYX A;  3I4W A;  1Z86 A;  2VSV A;  1WHD A;  2K1Z A;  4IC6 A;  3GDS A;  4R2Z A;  5I7Z A;  2EDP A;  5HEB A;  5EYZ A;  3K82 A;  1X5N A;  2CSS A;  1WF8 A;  1VJ6 A;  3PV5 A;  4K6Y A;  2OQS A;  1RY4 A;  1G9O A;  5HJ1 A;  2EXG A;  4Q2Q A;  2AWW A;  4HOP B;  4MPA A;  2G2L A;  4Q2O A;  2VZ5 A;  4JJ0 A;  2VSP A;  3DJ3 A;  2L4T A;  5F67 A;  4JOJ A;  3QJN A;  3HPK A;  2KPK A;  1QLC A;  2YUB A;  5F3X A;  4YDP A;  5GND A;  5FHT A;  3LNY A;  1X9Z A;  1P1E A;  2L97 A;  3SHU A;  1RGR A;  2EGN A;  2OGP A;  2DB5 A;  3NFK A;  1X5Q A;  2M10 A;  2F0A A;  5G1D A;  1V6B A;  2D90 A;  1UEQ A;  5DTH A;  1D5G A;  3QJM A;  4JOR A;  2PNT A;  5HDY A;  5B42 A;  3ID4 A;  5HEY A;  3QDO A;  3TSZ A;  1NTE A;  2CS5 A;  2IWQ A;  5HFB A;  2YT7 A;  3LNX A;  3O46 A;  4AMH A;  1FCF A;  3FY5 A;  2VWR A;  3QO6 A;  3GCN A;  4UU5 A;  5B6L A;  1VB7 A;  2I1N A;  1W9E A;  3RLE A;  1I16 A;  4K72 A;  1X6D A;  2LC6 A;  3NFL A;  4O06 A;  2EGO A;  5HFC A;  1RZX A;  2Q3G A;  1WHA A;  2KV8 A;  4K78 A;  1XZ9 A;  5GLJ A;  2JRE A;  3GCO A;  1UM7 A;  3SUZ A;  3WKL A;  5E1Y A;  2QT5 A;  2FCF A;  1UJV A;  2X7Z A;  1Y8T A;  2EEI A;  1I92 A;  3KDG A;  3WKM A;  1UFX A;  3PS4 A;  5HFF A;  1UEP A;  2I04 A;  3AXA A;  2QBW A;  2EDV A;  4OEO A;  4NMQ A;  2HGA A;  2F5Y A;  2LC7 A;  3GAB A;  1K32 A;  5HET A;  3PV2 A;  1UEZ A;  1WFV A;  3KZD A;  3SFJ A;  4Q6H A;  4REY A;  2L4S A;  2JXO A;  4GVD A;  1Q3O A;  2OZF A;  1VAE A;  2JSN A;  1BFE A;  3KZE A;  3BPU A;  2WL7 A;  2EEH A;  3DIW A;  1QAU A;  2VPH A;  3HVQ C;  2FNE A;  4KFV A;  1Y7N A;  3JXT A;  2I6V A;  4E34 A;  1MFG A;  1U38 A;  2OS6 A;  4G69 A;  4FLN A;  4WYT A;  2KYL A;  1Z87 A;  2M0V A;  2KL1 A;  1YBO A;  4OEP A;  2KJD A;  5H3J A;  2DJT A;  1WJL A;  2OSG A;  5HF1 A;  3GDV A;  4JOP A;  2HE4 A;  3DJ1 A;  1U39 A;  2BYG A;  2DLS A;  5E22 A;  2AWU A;  1W9O A;  2KAW A;  4XHV A;  3CYY A;  4NNL A;  1SOZ A;  2LOB A;  2KQF A;  2I4S A;  1FC9 A;  1WI4 A;  2GZV A;  3ID3 A;  2OMJ A;  3ZRT A;  2CSJ A;  4NXR A;  2H3L A;  5HF4 A;  1P1D A;  3E17 A;  1OZI A;  2PDZ A;  3GGE A;  2D8I A;  4PQW A;  2KRG A;  2M0T A;  1GQ4 A;  1KEF A;  1U37 A;  3L4F D;  4GVC A;  4E3B A;  3EGG C;  2R3Y A;  1X45 A;  2EEG A;  2JWE A;  2W7R A;  1M5Z A;  3PDZ A;  4P2A B;  5HFD A;  2E7K A;  1IHJ A;  3EGH C;  2I0L A;  3K50 A;  4WYU A;  4F8K A;  2PA1 A;  2QKU A;  1WI2 A;  4K76 A;  1WH1 A;  2QKT A;  4NMS A;  2AIN A;  2MHO A;  5FB8 C;  3VQF A;  3ID2 A;  4JOF A;  3MH6 A;  2DM8 A;  1N99 A;  2KOJ A;  2QKV A;  2KJP A;  1SOT A;  2IWO A;  2ZPL A;  2Q9V A;  2JIN A;  4LMM A;  4Z8J A;  5IL9 A;  3QGL A;  2HE2 A;  2KJK A;  1UM1 A;  2O2T A;  5D13 A;  4NNM A;  4JOH A;  2KPL A;  2DLU A;  2PKU A;  1X5R A;  3MH7 A;  1BE9 A;  2FN5 A;  5HED A;  4N6X A;  3STJ A;  1UEW A;  2YT8 A;  4JL7 A;  1V62 A;  4H11 A;  3SOE A;  2D92 A;  2JIK A;  2EEJ A;  1N7E A;  3PDV A;  2RRM A;  3CBX A;  2KOH A;  3OU0 A;  1L6O A;  1UF1 A;  1TE0 A;  2DAZ A;  3VQG A;  4JOE A;  4JOG A;  2EGK A;  2KOM A;  1Q3P A;  1PDR A;  4Z33 A;  3CC0 A;  2V1W A;  5G1E A;  2DKR A;  2Z9I A;  3R68 A;  2EDZ A;  2OCS A;  1OBX A;  2K20 A;  5E6P B;  2MX6 A;  1T2M A;  2UZC A;  3TSW A;  2G5M B;  3RL8 A;  3O5N A;  4NMV A;  1Q7X A;  1V5L A;  2YUY A;  4JOK A;  1B8Q A;  1WFG A;  2ZPM A;  1W9Q A;  1N7F A;  1TP5 A;  2KBS A;  2P3W A;  2QG1 A;  2I0I A;  2M0U A;  1FC7 A;  3I1E A;  4NXQ A;  3GDU A;  4NMO A;  3OTP A;  2H2B A;  3ID1 A;  4EDJ A;  3QIK A;  4GHN A;  4UU6 A;  3SHW A;  2KG2 A;  1MFL A;  1UJU A;  1NF3 C;  1N6E A;  4E35 A;  4P0C A;  4K75 A;  3KHF A;  3DOR A;  3DJA A;  1ZOK A;  2IWN A;  5JXB A;  1OBY A;  3TMH A;  3CBY A;  3B76 A;  2EHR A;  2OPG A;  4FGM A;  3CS0 A;  3R69 A;  2VRF A;  3GJ9 A;  4L8N A;  3I18 A;  4Q2N A;  1FC6 A;  3RL7 A;  2AWX A;  2ENO A;  5A2P A;  1V1T A;  3KDK A;  4RI0 A;  3QE1 A;  1IU0 A;  3CH8 A;  1TP3 A;  2EJY A;  2GEF A;  1X8S A;  1ZUB A;  1N6F A;  5HFE A;  4NXP A;  2Z17 A;  4Q6S A;  1KWA A;  2R4H A;  2LUI A;  3TSV A;  2PKT A;  2REY A;  5E11 A;  1UHP A;  5EZ0 A;  2M0Z A;  2M3M A;  3K1R A;  1WG6 A;  2H2C A;  1N7T A;  1QAV A;  1KY9 A;  3NCV A;  3GSL A;  1LCY A;  1GM1 A; 
#chains in the Genus database with same CATH homology
 1UJD A;  2FE5 A;  1IU2 A;  1MC7 A;  2EAQ A;  1GQ5 A;  2JIL A;  1U3B A;  2EV8 A;  2DC2 A;  1N6D A;  1UIT A;  3HPM A;  1TQ3 A;  2LA8 A;  1VCW A;  1WF7 A;  4KFW A;  4Q3H A;  4NMP A;  3MH4 A;  1OBZ A;  3CBZ A;  3NGH A;  2W4F A;  1VA8 A;  4Q2P A;  2DMZ A;  1R6J A;  2KA9 A;  1RGW A;  4NMT A;  5E21 A;  2PZD A;  4OAJ A;  2IWP A;  1V5Q A;  2JOA A;  4HOP A;  1QAV B;  2RCZ A;  4JJ3 A;  4NMR A;  5ILB A;  1WIF A;  3PV4 A;  2V90 A;  2YTW A;  3R0H A;  2H3M A;  4YYX A;  3I4W A;  1Z86 A;  2VSV A;  1WHD A;  2K1Z A;  4IC6 A;  3GDS A;  4R2Z A;  5I7Z A;  2EDP A;  5HEB A;  5EYZ A;  3K82 A;  1X5N A;  2CSS A;  1WF8 A;  1VJ6 A;  3PV5 A;  4K6Y A;  2OQS A;  1RY4 A;  1G9O A;  5HJ1 A;  2EXG A;  4Q2Q A;  2AWW A;  4HOP B;  4MPA A;  2G2L A;  4Q2O A;  2VZ5 A;  4JJ0 A;  2VSP A;  3DJ3 A;  2L4T A;  5F67 A;  4JOJ A;  3QJN A;  3HPK A;  2KPK A;  1QLC A;  2YUB A;  5F3X A;  4YDP A;  5GND A;  5FHT A;  3LNY A;  1X9Z A;  1P1E A;  2L97 A;  3SHU A;  1RGR A;  2EGN A;  2OGP A;  2DB5 A;  3NFK A;  1X5Q A;  2M10 A;  2F0A A;  5G1D A;  1V6B A;  2D90 A;  1UEQ A;  5DTH A;  1D5G A;  3QJM A;  4JOR A;  2PNT A;  5HDY A;  5B42 A;  3ID4 A;  5HEY A;  3QDO A;  3TSZ A;  1NTE A;  2CS5 A;  2IWQ A;  5HFB A;  2YT7 A;  3LNX A;  3O46 A;  4AMH A;  1FCF A;  3FY5 A;  2VWR A;  3QO6 A;  3GCN A;  4UU5 A;  5B6L A;  1VB7 A;  2I1N A;  1W9E A;  3RLE A;  1I16 A;  4K72 A;  1X6D A;  2LC6 A;  3NFL A;  4O06 A;  2EGO A;  5HFC A;  1RZX A;  2Q3G A;  1WHA A;  2KV8 A;  4K78 A;  1XZ9 A;  5GLJ A;  2JRE A;  3GCO A;  1UM7 A;  3SUZ A;  3WKL A;  5E1Y A;  2QT5 A;  2FCF A;  1UJV A;  2X7Z A;  1Y8T A;  2EEI A;  1I92 A;  3KDG A;  3WKM A;  1UFX A;  3PS4 A;  5HFF A;  1UEP A;  2I04 A;  3AXA A;  2QBW A;  2EDV A;  4OEO A;  4NMQ A;  2HGA A;  2F5Y A;  2LC7 A;  3GAB A;  1K32 A;  5HET A;  3PV2 A;  1UEZ A;  1WFV A;  3KZD A;  3SFJ A;  4Q6H A;  4REY A;  2L4S A;  2JXO A;  4GVD A;  1Q3O A;  2OZF A;  1VAE A;  2JSN A;  1BFE A;  3KZE A;  3BPU A;  2WL7 A;  2EEH A;  3DIW A;  1QAU A;  2VPH A;  3HVQ C;  2FNE A;  4KFV A;  1Y7N A;  3JXT A;  2I6V A;  4E34 A;  1MFG A;  1U38 A;  2OS6 A;  4G69 A;  4FLN A;  4WYT A;  2KYL A;  1Z87 A;  2M0V A;  2KL1 A;  1YBO A;  4OEP A;  2KJD A;  5H3J A;  2DJT A;  1WJL A;  2OSG A;  5HF1 A;  3GDV A;  4JOP A;  2HE4 A;  3DJ1 A;  1U39 A;  2BYG A;  2DLS A;  5E22 A;  2AWU A;  1W9O A;  2KAW A;  4XHV A;  3CYY A;  4NNL A;  1SOZ A;  2LOB A;  2KQF A;  2I4S A;  1FC9 A;  1WI4 A;  2GZV A;  3ID3 A;  2OMJ A;  3ZRT A;  2CSJ A;  4NXR A;  2H3L A;  5HF4 A;  1P1D A;  3E17 A;  1OZI A;  2PDZ A;  3GGE A;  2D8I A;  4PQW A;  2KRG A;  2M0T A;  1GQ4 A;  1KEF A;  1U37 A;  3L4F D;  4GVC A;  4E3B A;  3EGG C;  2R3Y A;  1X45 A;  2EEG A;  2JWE A;  2W7R A;  1M5Z A;  3PDZ A;  4P2A B;  5HFD A;  2E7K A;  1IHJ A;  3EGH C;  2I0L A;  3K50 A;  4WYU A;  4F8K A;  2PA1 A;  2QKU A;  1WI2 A;  4K76 A;  1WH1 A;  2QKT A;  4NMS A;  2AIN A;  2MHO A;  5FB8 C;  3VQF A;  3ID2 A;  4JOF A;  3MH6 A;  2DM8 A;  1N99 A;  2KOJ A;  2QKV A;  2KJP A;  1SOT A;  2IWO A;  2ZPL A;  2Q9V A;  2JIN A;  4LMM A;  4Z8J A;  5IL9 A;  3QGL A;  2HE2 A;  2KJK A;  1UM1 A;  2O2T A;  5D13 A;  4NNM A;  4JOH A;  2KPL A;  2DLU A;  2PKU A;  1X5R A;  3MH7 A;  1BE9 A;  2FN5 A;  5HED A;  4N6X A;  3STJ A;  1UEW A;  2YT8 A;  4JL7 A;  1V62 A;  4H11 A;  3SOE A;  2D92 A;  2JIK A;  2EEJ A;  1N7E A;  3PDV A;  2RRM A;  3CBX A;  2KOH A;  3OU0 A;  1L6O A;  1UF1 A;  1TE0 A;  2DAZ A;  3VQG A;  4JOE A;  4JOG A;  2EGK A;  2KOM A;  1Q3P A;  1PDR A;  4Z33 A;  3CC0 A;  2V1W A;  5G1E A;  2DKR A;  2Z9I A;  3R68 A;  2EDZ A;  2OCS A;  1OBX A;  2K20 A;  5E6P B;  2MX6 A;  1T2M A;  2UZC A;  3TSW A;  2G5M B;  3RL8 A;  3O5N A;  4NMV A;  1Q7X A;  1V5L A;  2YUY A;  4JOK A;  1B8Q A;  1WFG A;  2ZPM A;  1W9Q A;  1N7F A;  1TP5 A;  2KBS A;  2P3W A;  2QG1 A;  2I0I A;  2M0U A;  1FC7 A;  3I1E A;  4NXQ A;  3GDU A;  4NMO A;  3OTP A;  2H2B A;  3ID1 A;  4EDJ A;  3QIK A;  4GHN A;  4UU6 A;  3SHW A;  2KG2 A;  1MFL A;  1UJU A;  1NF3 C;  1N6E A;  4E35 A;  4P0C A;  4K75 A;  3KHF A;  3DOR A;  3DJA A;  1ZOK A;  2IWN A;  5JXB A;  1OBY A;  3TMH A;  3CBY A;  3B76 A;  2EHR A;  2OPG A;  4FGM A;  3CS0 A;  3R69 A;  2VRF A;  3GJ9 A;  4L8N A;  3I18 A;  4Q2N A;  1FC6 A;  3RL7 A;  2AWX A;  2ENO A;  5A2P A;  1V1T A;  3KDK A;  4RI0 A;  3QE1 A;  1IU0 A;  3CH8 A;  1TP3 A;  2EJY A;  2GEF A;  1X8S A;  1ZUB A;  1N6F A;  5HFE A;  4NXP A;  2Z17 A;  4Q6S A;  1KWA A;  2R4H A;  2LUI A;  3TSV A;  2PKT A;  2REY A;  5E11 A;  1UHP A;  5EZ0 A;  2M0Z A;  2M3M A;  3K1R A;  1WG6 A;  2H2C A;  1N7T A;  1QAV A;  1KY9 A;  3NCV A;  3GSL A;  1LCY A;  1GM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...