4O06A

1.15a resolution structure of the proteasome assembly chaperone nas2 pdz domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
102
Chain Sequence
b'GPLTRRASVGQYTIPFAFISEVVPGSPSDKADIKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVLLLREGQILKTSLTPSRNWNGRGLLGCRIQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p27
publication title 1.15 angstrom resolution structure of the proteasome-assembly chaperone Nas2 PDZ domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 23
structure length 102
sequence length 106
ec nomenclature
pdb deposition date 2013-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4o06A00
3OTPA 2YUYA 5JXBA 2EAQA 2EGOA 2DLUA 3TSZA 4XHVA 1P1DA 5GLJA 1X5RA 2EHRA 5HF1A 2OGPA 2GZVA 2M0UA 1SOZA 1VJ6A 2K1ZA 2DM8A 2Q3GA 4YYXA 3JXTA 1M5ZA 1FCFA 2AWWA 1UM1A 2DMZA 1GQ5A 3STJA 2RCZA 2PKTA 2D90A 1Q3OA 2L97A 4E35A 1IU2A 3ID4A 3PDZA 4PQWA 3I4WA 4Q2QA 3QIKA 4NMOA 1RGWA 2FE5A 1ZOKA 1WHAA 1X8SA 3BPUA 4GVDA 5EZ0A 3GSLA 1UJVA 2YTWA 1Q7XA 1Y7NA 2KL1A 5H3JA 3GDSA 3GCOA 3VQFA 3LNYA 4LMMA 1UJDA 2I1NA 4NXRA 4JOEA 5D13A 2D8IA 4NXQA 1MFGA 3TMHA 1N6EA 5HFEA 3E17A 3AXAA 4JORA 2KJDA 2CSJA 2KA9A 5EYZA 1P1EA 4KFWA 1VA8A 2MHOA 2LUIA 2EDZA 1IHJA 3MH7A 1N6DA 2VWRA 5HFDA 3R69A 2KV8A 1X6DA 2H2CA 2I0LA 4K72A 2LC6A 1UFXA 2LC7A 3K82A 3EGGC 3CC0A 2KJKA 3RLEA 1G9OA 1OBYA 2KPKA 1W9EA 3GJ9A 4E3BA 2QT5A 4EDJA 4Q6SA 5HFCA 1WI4A 2JINA 1TP3A 1UITA 2PZDA 3B76A 5E1YA 2QKVA 2EGNA 2JWEA 1U39A 1RZXA 4HOPA 5FHTA 2EGKA 1UEQA 1KWAA 2VSPA 1U37A 2EEJA 2JOAA 1UEPA 4MPAA 2IWNA 1Z87A 1FC7A 3CBYA 2K20A 2YT7A 2LOBA 4UU6A 2LA8A 2X7ZA 4JOJA 2I04A 1X5NA 4P2AB 5G1EA 2L4SA 3GDUA 1T2MA 1UEZA 4HOPB 3KHFA 3ZRTA 2M10A 3I18A 1WHDA 4NNMA 4AMHA 2H2BA 3PV5A 1Z86A 2E7KA 3CYYA 2D92A 3OU0A 3CBXA 1IU0A 1LCYA 2OZFA 1D5GA 2DJTA 1N7EA 1V6BA 1MC7A 4NMVA 4IC6A 4NMTA 2ZPLA 2F5YA 1X5QA 1K32A 3FY5A 1V5LA 1UJUA 3O5NA 2MX6A 3WKMA 3PDVA 4OEPA 2KG2A 2JIKA 2M3MA 5I7ZA 3QO6A 1FC9A 3SOEA 5B6LA 2KAWA 2PDZA 4GVCA 2V90A 3ID1A 1WFVA 2Q9VA 1OZIA 2JILA 1NTEA 2PNTA 1Q3PA 3R0HA 4OEOA 5HEDA 3TSWA 4K75A 2JXOA 2DB5A 3I1EA 5F3XA 2G2LA 2KBSA 1KY9A 5HFBA 1OBZA 2QKUA 3DORA 1UM7A 3R68A 1U38A 1N6FA 2QKTA 2QBWA 1RGRA 2R4HA 2IWOA 1N7FA 3ID3A 1X45A 2VSVA 2HE2A 1I92A 3HPMA 2AWUA 2EEIA 1MFLA 1WH1A 1WF8A 3O46A 4L8NA 1TP5A 4NMSA 4NMPA 5HDYA 4GHNA 2DC2A 2R3YA 1L6OA 1WI2A 1I16A 5E6PB 2OS6A 3TSVA 3GCNA 4NMQA 2AWXA 1KEFA 1FC6A 3MH4A 1PDRA 3KZEA 2KOHA 2VZ5A 5E21A 1WF7A 1VAEA 4K78A 4FGMA 2UZCA 2HE4A 1V5QA 5HETA 1R6JA 3DIWA 2P3WA 2OPGA 2EV8A 4E34A 2O2TA 1VB7A 2WL7A 4G69A 2EDVA 2CSSA 4R2ZA 3DJ3A 3CBZA 2PKUA 1WG6A 3QDOA 2KQFA 3HVQC 4WYTA 5HEYA 5A2PA 2FN5A 1BFEA 1WFGA 5HJ1A 3RL8A 5E11A 4NMRA 4Q2OA 3SHWA 2IWQA 1UHPA 3CS0A 5G1DA 2IWPA 5F67A 1W9QA 3DJAA 2JREA 4KFVA 5HFFA 1QAVB 1ZUBA 2CS5A 2FNEA 1GM1A 2EXGA 2BYGA 1OBXA 4JOKA 2EDPA 2H3MA 3K1RA 4Q6HA 2DLSA 2VPHA 1TE0A 2AINA 2DKRA 1QLCA 2EJYA 2Z17A 1QAUA 3DJ1A 4REYA 2ZPMA 3GDVA 2KOJA 4WYUA 4Q3HA 4RI0A 4OAJA 5HEBA 4JOFA 1WJLA 4Q2NA 4H11A 3VQGA 2RRMA 4YDPA 1GQ4A 5FB8C 1BE9A 1TQ3A 3GGEA 3QGLA 3PV2A 3L4FD 1V62A 4Z33A 4F8KA 2OCSA 1B8QA 2REYA 2I4SA 2I0IA 3PS4A 3PV4A 2KOMA 3NFLA 1WIFA 2FCFA 4NNLA 1RY4A 2KJPA 4JOPA 2KRGA 2F0AA 2OSGA 5E22A 1N7TA 3ID2A 3SHUA 1UEWA 2W4FA 2M0VA 2KPLA 2VRFA 1UF1A 1N99A 3WKLA 3KZDA 3MH6A 2DAZA 2HGAA 4Z8JA 4O06A 2Z9IA 4N6XA 3NGHA 2ENOA 1Y8TA 2G5MB 3K50A 4JOHA 1XZ9A 4Q2PA 2OQSA 3HPKA 2EEHA 2QG1A 5GNDA 3CH8A 3QJNA 1VCWA 2M0ZA 3EGHC 2EEGA 4K6YA 1U3BA 2KYLA 4P0CA 3QE1A 1NF3C 2YUBA 2PA1A 1V1TA 2H3LA 2L4TA 4K76A 1SOTA 2M0TA 1QAVA 3QJMA 1YBOA 5HF4A 5DTHA 3NFKA 2YT8A 4JL7A 3RL7A 4JOGA 3SUZA 2I6VA 3LNXA 4UU5A 1W9OA 2V1WA 4NXPA 2W7RA 2OMJA 3SFJA
chains in the Genus database with same CATH superfamily
3OTPA 2YUYA 5JXBA 2EAQA 2EGOA 2DLUA 3TSZA 4XHVA 1P1DA 5GLJA 1X5RA 2EHRA 5HF1A 2OGPA 2GZVA 2M0UA 1SOZA 1VJ6A 2K1ZA 2DM8A 2Q3GA 4YYXA 3JXTA 1M5ZA 1FCFA 2AWWA 1UM1A 2DMZA 1GQ5A 3STJA 2RCZA 2PKTA 2D90A 1Q3OA 2L97A 4E35A 1IU2A 3ID4A 3PDZA 4PQWA 3I4WA 4Q2QA 3QIKA 4NMOA 1RGWA 2FE5A 1ZOKA 1WHAA 1X8SA 3BPUA 4GVDA 5EZ0A 3GSLA 1UJVA 2YTWA 1Q7XA 1Y7NA 2KL1A 5H3JA 3GDSA 3GCOA 3VQFA 3LNYA 4LMMA 1UJDA 2I1NA 4NXRA 4JOEA 5D13A 2D8IA 4NXQA 1MFGA 3TMHA 1N6EA 5HFEA 3E17A 5ILBA 3AXAA 4JORA 2KJDA 2CSJA 2KA9A 5EYZA 1P1EA 4KFWA 1VA8A 2MHOA 2LUIA 3KDGA 2EDZA 1IHJA 3MH7A 1N6DA 2VWRA 5HFDA 3R69A 2KV8A 1X6DA 2H2CA 2I0LA 4K72A 2LC6A 1UFXA 2LC7A 3K82A 3EGGC 3CC0A 2KJKA 3RLEA 1G9OA 1OBYA 2KPKA 1W9EA 3GJ9A 4E3BA 2QT5A 4EDJA 4Q6SA 5HFCA 1WI4A 2JINA 1TP3A 1UITA 2PZDA 3B76A 5E1YA 2QKVA 2EGNA 2JWEA 1U39A 1RZXA 4HOPA 5FHTA 2EGKA 1UEQA 1KWAA 2VSPA 1U37A 2EEJA 2JOAA 1UEPA 4MPAA 2IWNA 1Z87A 1FC7A 3CBYA 2K20A 2YT7A 2LOBA 4UU6A 2LA8A 2X7ZA 4JOJA 2I04A 1X5NA 4P2AB 5G1EA 2L4SA 3GDUA 1T2MA 1UEZA 4HOPB 3KHFA 3ZRTA 2M10A 3I18A 1WHDA 4NNMA 4AMHA 2H2BA 3PV5A 1Z86A 2E7KA 3CYYA 2D92A 3OU0A 3CBXA 1IU0A 1LCYA 2OZFA 1D5GA 2DJTA 1N7EA 1V6BA 1MC7A 4NMVA 4IC6A 4NMTA 2ZPLA 2F5YA 1X5QA 1K32A 3FY5A 1V5LA 1UJUA 3O5NA 2MX6A 4JJ0A 4JJ3A 3WKMA 3PDVA 4OEPA 2KG2A 2JIKA 2M3MA 5I7ZA 4FLNA 3QO6A 1FC9A 3SOEA 5B6LA 2KAWA 2PDZA 4GVCA 2V90A 3ID1A 1WFVA 2Q9VA 1OZIA 2JILA 1NTEA 2PNTA 1Q3PA 3R0HA 4OEOA 5HEDA 3TSWA 4K75A 2JXOA 2DB5A 3I1EA 5F3XA 2G2LA 2KBSA 1KY9A 5HFBA 1OBZA 2QKUA 3DORA 1UM7A 3R68A 1U38A 1N6FA 2QKTA 2QBWA 1RGRA 2R4HA 2IWOA 1N7FA 3ID3A 1X45A 2VSVA 2HE2A 1I92A 3HPMA 2AWUA 2EEIA 1MFLA 1WH1A 1WF8A 3O46A 4L8NA 1TP5A 4NMSA 4NMPA 5HDYA 4GHNA 2DC2A 2R3YA 1L6OA 1WI2A 2GEFA 1I16A 5E6PB 2OS6A 3TSVA 3GCNA 4NMQA 2AWXA 1KEFA 1FC6A 3MH4A 1PDRA 3KZEA 2KOHA 2VZ5A 5E21A 1WF7A 1VAEA 4K78A 4FGMA 2UZCA 2HE4A 1V5QA 5HETA 1R6JA 3DIWA 2P3WA 2OPGA 2EV8A 4E34A 2O2TA 5IL9A 1VB7A 2WL7A 4G69A 2EDVA 2CSSA 4R2ZA 3DJ3A 3CBZA 2PKUA 1WG6A 3QDOA 1X9ZA 2KQFA 3HVQC 4WYTA 5HEYA 5B42A 5A2PA 2FN5A 1BFEA 1WFGA 5HJ1A 3RL8A 5E11A 4NMRA 4Q2OA 3SHWA 2IWQA 1UHPA 3CS0A 5G1DA 2IWPA 5F67A 1W9QA 3DJAA 2JREA 4KFVA 5HFFA 1QAVB 1ZUBA 2CS5A 2FNEA 1GM1A 2EXGA 2BYGA 1OBXA 4JOKA 2EDPA 2H3MA 3K1RA 4Q6HA 2DLSA 2VPHA 1TE0A 2AINA 2DKRA 1QLCA 2EJYA 2Z17A 1QAUA 3DJ1A 4REYA 2ZPMA 3GDVA 2KOJA 4WYUA 4Q3HA 4RI0A 4OAJA 5HEBA 4JOFA 1WJLA 4Q2NA 4H11A 3VQGA 2RRMA 4YDPA 1GQ4A 5FB8C 1BE9A 1TQ3A 3GGEA 3QGLA 3PV2A 3L4FD 1V62A 4Z33A 4F8KA 2OCSA 1B8QA 3KDKA 2REYA 2I4SA 2I0IA 3NCVA 3PS4A 3PV4A 2KOMA 3NFLA 1WIFA 2FCFA 4NNLA 1RY4A 2KJPA 4JOPA 2KRGA 2F0AA 2OSGA 5E22A 1N7TA 3ID2A 3SHUA 1UEWA 2W4FA 2M0VA 3GABA 2KPLA 2VRFA 1UF1A 1N99A 3WKLA 3KZDA 3MH6A 2DAZA 2HGAA 4Z8JA 4O06A 2Z9IA 4N6XA 3NGHA 2ENOA 1Y8TA 2G5MB 3K50A 4JOHA 1XZ9A 4Q2PA 2OQSA 3HPKA 2EEHA 2QG1A 5GNDA 3CH8A 3QJNA 1VCWA 2M0ZA 3EGHC 2EEGA 4K6YA 1U3BA 2KYLA 4P0CA 3QE1A 1NF3C 2YUBA 2PA1A 1V1TA 2H3LA 2L4TA 4K76A 1SOTA 2M0TA 1QAVA 2JSNA 3QJMA 1YBOA 5HF4A 5DTHA 3NFKA 2YT8A 4JL7A 3RL7A 4JOGA 3SUZA 2I6VA 3LNXA 4UU5A 1W9OA 2V1WA 4NXPA 2W7RA 2OMJA 3SFJA
chains in the Genus database with same CATH topology
3OTPA 2YUYA 5JXBA 2EAQA 2EGOA 2DLUA 3TSZA 4XHVA 1P1DA 5GLJA 1X5RA 2EHRA 5HF1A 2OGPA 2GZVA 2M0UA 1SOZA 1VJ6A 2K1ZA 2DM8A 2Q3GA 4YYXA 3JXTA 1M5ZA 1FCFA 2AWWA 1UM1A 2DMZA 1GQ5A 3STJA 2RCZA 2PKTA 2D90A 1Q3OA 2L97A 4E35A 1IU2A 3ID4A 3PDZA 4PQWA 3I4WA 4Q2QA 3QIKA 4NMOA 1RGWA 2FE5A 1ZOKA 1WHAA 1X8SA 3BPUA 4GVDA 5EZ0A 3GSLA 1UJVA 2YTWA 1Q7XA 1Y7NA 2KL1A 5H3JA 3GDSA 3GCOA 3VQFA 3LNYA 4LMMA 1UJDA 2I1NA 4NXRA 4JOEA 5D13A 2D8IA 4NXQA 1MFGA 3TMHA 1N6EA 5HFEA 3E17A 5ILBA 3AXAA 4JORA 2KJDA 2CSJA 2KA9A 5EYZA 1P1EA 4KFWA 1VA8A 2MHOA 2LUIA 3KDGA 2EDZA 1IHJA 3MH7A 1N6DA 2VWRA 5HFDA 3R69A 2KV8A 1X6DA 2H2CA 2I0LA 4K72A 2LC6A 1UFXA 2LC7A 3K82A 3EGGC 3CC0A 2KJKA 3RLEA 1G9OA 1OBYA 2KPKA 1W9EA 3GJ9A 4E3BA 2QT5A 4EDJA 4Q6SA 5HFCA 1WI4A 2JINA 1TP3A 1UITA 2PZDA 3B76A 5E1YA 2QKVA 2EGNA 2JWEA 1U39A 1RZXA 4HOPA 5FHTA 2EGKA 1UEQA 1KWAA 2VSPA 1U37A 2EEJA 2JOAA 1UEPA 4MPAA 2IWNA 1Z87A 1FC7A 3CBYA 2K20A 2YT7A 2LOBA 4UU6A 2LA8A 2X7ZA 4JOJA 2I04A 1X5NA 4P2AB 5G1EA 2L4SA 3GDUA 1T2MA 1UEZA 4HOPB 3KHFA 3ZRTA 2M10A 3I18A 1WHDA 4NNMA 4AMHA 2H2BA 3PV5A 1Z86A 2E7KA 3CYYA 2D92A 3OU0A 3CBXA 1IU0A 1LCYA 2OZFA 1D5GA 2DJTA 1N7EA 1V6BA 1MC7A 4NMVA 4IC6A 4NMTA 2ZPLA 2F5YA 1X5QA 1K32A 3FY5A 1V5LA 1UJUA 3O5NA 2MX6A 4JJ0A 4JJ3A 3WKMA 3PDVA 4OEPA 2KG2A 2JIKA 2M3MA 5I7ZA 4FLNA 3QO6A 1FC9A 3SOEA 5B6LA 2KAWA 2PDZA 4GVCA 2V90A 3ID1A 1WFVA 2Q9VA 1OZIA 2JILA 1NTEA 2PNTA 1Q3PA 3R0HA 4OEOA 5HEDA 3TSWA 4K75A 2JXOA 2DB5A 3I1EA 5F3XA 2G2LA 2KBSA 1KY9A 5HFBA 1OBZA 2QKUA 3DORA 1UM7A 3R68A 1U38A 1N6FA 2QKTA 2QBWA 1RGRA 2R4HA 2IWOA 1N7FA 3ID3A 1X45A 2VSVA 2HE2A 1I92A 3HPMA 2AWUA 2EEIA 1MFLA 1WH1A 1WF8A 3O46A 4L8NA 1TP5A 4NMSA 4NMPA 5HDYA 4GHNA 2DC2A 2R3YA 1L6OA 1WI2A 2GEFA 1I16A 5E6PB 2OS6A 3TSVA 3GCNA 4NMQA 2AWXA 1KEFA 1FC6A 3MH4A 1PDRA 3KZEA 2KOHA 2VZ5A 5E21A 1WF7A 1VAEA 4K78A 4FGMA 2UZCA 2HE4A 1V5QA 5HETA 1R6JA 3DIWA 2P3WA 2OPGA 2EV8A 4E34A 2O2TA 5IL9A 1VB7A 2WL7A 4G69A 2EDVA 2CSSA 4R2ZA 3DJ3A 3CBZA 2PKUA 1WG6A 3QDOA 1X9ZA 2KQFA 3HVQC 4WYTA 5HEYA 5B42A 5A2PA 2FN5A 1BFEA 1WFGA 5HJ1A 3RL8A 5E11A 4NMRA 4Q2OA 3SHWA 2IWQA 1UHPA 3CS0A 5G1DA 2IWPA 5F67A 1W9QA 3DJAA 2JREA 4KFVA 5HFFA 1QAVB 1ZUBA 2CS5A 2FNEA 1GM1A 2EXGA 2BYGA 1OBXA 4JOKA 2EDPA 2H3MA 3K1RA 4Q6HA 2DLSA 2VPHA 1TE0A 2AINA 2DKRA 1QLCA 2EJYA 2Z17A 1QAUA 3DJ1A 4REYA 2ZPMA 3GDVA 2KOJA 4WYUA 4Q3HA 4RI0A 4OAJA 5HEBA 4JOFA 1WJLA 4Q2NA 4H11A 3VQGA 2RRMA 4YDPA 1GQ4A 5FB8C 1BE9A 1TQ3A 3GGEA 3QGLA 3PV2A 3L4FD 1V62A 4Z33A 4F8KA 2OCSA 1B8QA 3KDKA 2REYA 2I4SA 2I0IA 3NCVA 3PS4A 3PV4A 2KOMA 3NFLA 1WIFA 2FCFA 4NNLA 1RY4A 2KJPA 4JOPA 2KRGA 2F0AA 2OSGA 5E22A 1N7TA 3ID2A 3SHUA 1UEWA 2W4FA 2M0VA 3GABA 2KPLA 2VRFA 1UF1A 1N99A 3WKLA 3KZDA 3MH6A 2DAZA 2HGAA 4Z8JA 4O06A 2Z9IA 4N6XA 3NGHA 2ENOA 1Y8TA 2G5MB 3K50A 4JOHA 1XZ9A 4Q2PA 2OQSA 3HPKA 2EEHA 2QG1A 5GNDA 3CH8A 3QJNA 1VCWA 2M0ZA 3EGHC 2EEGA 4K6YA 1U3BA 2KYLA 4P0CA 3QE1A 1NF3C 2YUBA 2PA1A 1V1TA 2H3LA 2L4TA 4K76A 1SOTA 2M0TA 1QAVA 2JSNA 3QJMA 1YBOA 5HF4A 5DTHA 3NFKA 2YT8A 4JL7A 3RL7A 4JOGA 3SUZA 2I6VA 3LNXA 4UU5A 1W9OA 2V1WA 4NXPA 2W7RA 2OMJA 3SFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTP A;  2YUY A;  5JXB A;  2EAQ A;  2EGO A;  2DLU A;  3TSZ A;  4XHV A;  1P1D A;  5GLJ A;  1X5R A;  2EHR A;  5HF1 A;  2OGP A;  2GZV A;  2M0U A;  1SOZ A;  1VJ6 A;  2K1Z A;  2DM8 A;  2Q3G A;  4YYX A;  3JXT A;  1M5Z A;  1FCF A;  2AWW A;  1UM1 A;  2DMZ A;  1GQ5 A;  3STJ A;  2RCZ A;  2PKT A;  2D90 A;  1Q3O A;  2L97 A;  4E35 A;  1IU2 A;  3ID4 A;  3PDZ A;  4PQW A;  3I4W A;  4Q2Q A;  3QIK A;  4NMO A;  1RGW A;  2FE5 A;  1ZOK A;  1WHA A;  1X8S A;  3BPU A;  4GVD A;  5EZ0 A;  3GSL A;  1UJV A;  2YTW A;  1Q7X A;  1Y7N A;  2KL1 A;  5H3J A;  3GDS A;  3GCO A;  3VQF A;  3LNY A;  4LMM A;  1UJD A;  2I1N A;  4NXR A;  4JOE A;  5D13 A;  2D8I A;  4NXQ A;  1MFG A;  3TMH A;  1N6E A;  5HFE A;  3E17 A;  3AXA A;  4JOR A;  2KJD A;  2CSJ A;  2KA9 A;  5EYZ A;  1P1E A;  4KFW A;  1VA8 A;  2MHO A;  2LUI A;  2EDZ A;  1IHJ A;  3MH7 A;  1N6D A;  2VWR A;  5HFD A;  3R69 A;  2KV8 A;  1X6D A;  2H2C A;  2I0L A;  4K72 A;  2LC6 A;  1UFX A;  2LC7 A;  3K82 A;  3EGG C;  3CC0 A;  2KJK A;  3RLE A;  1G9O A;  1OBY A;  2KPK A;  1W9E A;  3GJ9 A;  4E3B A;  2QT5 A;  4EDJ A;  4Q6S A;  5HFC A;  1WI4 A;  2JIN A;  1TP3 A;  1UIT A;  2PZD A;  3B76 A;  5E1Y A;  2QKV A;  2EGN A;  2JWE A;  1U39 A;  1RZX A;  4HOP A;  5FHT A;  2EGK A;  1UEQ A;  1KWA A;  2VSP A;  1U37 A;  2EEJ A;  2JOA A;  1UEP A;  4MPA A;  2IWN A;  1Z87 A;  1FC7 A;  3CBY A;  2K20 A;  2YT7 A;  2LOB A;  4UU6 A;  2LA8 A;  2X7Z A;  4JOJ A;  2I04 A;  1X5N A;  4P2A B;  5G1E A;  2L4S A;  3GDU A;  1T2M A;  1UEZ A;  4HOP B;  3KHF A;  3ZRT A;  2M10 A;  3I18 A;  1WHD A;  4NNM A;  4AMH A;  2H2B A;  3PV5 A;  1Z86 A;  2E7K A;  3CYY A;  2D92 A;  3OU0 A;  3CBX A;  1IU0 A;  1LCY A;  2OZF A;  1D5G A;  2DJT A;  1N7E A;  1V6B A;  1MC7 A;  4NMV A;  4IC6 A;  4NMT A;  2ZPL A;  2F5Y A;  1X5Q A;  1K32 A;  3FY5 A;  1V5L A;  1UJU A;  3O5N A;  2MX6 A;  3WKM A;  3PDV A;  4OEP A;  2KG2 A;  2JIK A;  2M3M A;  5I7Z A;  3QO6 A;  1FC9 A;  3SOE A;  5B6L A;  2KAW A;  2PDZ A;  4GVC A;  2V90 A;  3ID1 A;  1WFV A;  2Q9V A;  1OZI A;  2JIL A;  1NTE A;  2PNT A;  1Q3P A;  3R0H A;  4OEO A;  5HED A;  3TSW A;  4K75 A;  2JXO A;  2DB5 A;  3I1E A;  5F3X A;  2G2L A;  2KBS A;  1KY9 A;  5HFB A;  1OBZ A;  2QKU A;  3DOR A;  1UM7 A;  3R68 A;  1U38 A;  1N6F A;  2QKT A;  2QBW A;  1RGR A;  2R4H A;  2IWO A;  1N7F A;  3ID3 A;  1X45 A;  2VSV A;  2HE2 A;  1I92 A;  3HPM A;  2AWU A;  2EEI A;  1MFL A;  1WH1 A;  1WF8 A;  3O46 A;  4L8N A;  1TP5 A;  4NMS A;  4NMP A;  5HDY A;  4GHN A;  2DC2 A;  2R3Y A;  1L6O A;  1WI2 A;  1I16 A;  5E6P B;  2OS6 A;  3TSV A;  3GCN A;  4NMQ A;  2AWX A;  1KEF A;  1FC6 A;  3MH4 A;  1PDR A;  3KZE A;  2KOH A;  2VZ5 A;  5E21 A;  1WF7 A;  1VAE A;  4K78 A;  4FGM A;  2UZC A;  2HE4 A;  1V5Q A;  5HET A;  1R6J A;  3DIW A;  2P3W A;  2OPG A;  2EV8 A;  4E34 A;  2O2T A;  1VB7 A;  2WL7 A;  4G69 A;  2EDV A;  2CSS A;  4R2Z A;  3DJ3 A;  3CBZ A;  2PKU A;  1WG6 A;  3QDO A;  2KQF A;  3HVQ C;  4WYT A;  5HEY A;  5A2P A;  2FN5 A;  1BFE A;  1WFG A;  5HJ1 A;  3RL8 A;  5E11 A;  4NMR A;  4Q2O A;  3SHW A;  2IWQ A;  1UHP A;  3CS0 A;  5G1D A;  2IWP A;  5F67 A;  1W9Q A;  3DJA A;  2JRE A;  4KFV A;  5HFF A;  1QAV B;  1ZUB A;  2CS5 A;  2FNE A;  1GM1 A;  2EXG A;  2BYG A;  1OBX A;  4JOK A;  2EDP A;  2H3M A;  3K1R A;  4Q6H A;  2DLS A;  2VPH A;  1TE0 A;  2AIN A;  2DKR A;  1QLC A;  2EJY A;  2Z17 A;  1QAU A;  3DJ1 A;  4REY A;  2ZPM A;  3GDV A;  2KOJ A;  4WYU A;  4Q3H A;  4RI0 A;  4OAJ A;  5HEB A;  4JOF A;  1WJL A;  4Q2N A;  4H11 A;  3VQG A;  2RRM A;  4YDP A;  1GQ4 A;  5FB8 C;  1BE9 A;  1TQ3 A;  3GGE A;  3QGL A;  3PV2 A;  3L4F D;  1V62 A;  4Z33 A;  4F8K A;  2OCS A;  1B8Q A;  2REY A;  2I4S A;  2I0I A;  3PS4 A;  3PV4 A;  2KOM A;  3NFL A;  1WIF A;  2FCF A;  4NNL A;  1RY4 A;  2KJP A;  4JOP A;  2KRG A;  2F0A A;  2OSG A;  5E22 A;  1N7T A;  3ID2 A;  3SHU A;  1UEW A;  2W4F A;  2M0V A;  2KPL A;  2VRF A;  1UF1 A;  1N99 A;  3WKL A;  3KZD A;  3MH6 A;  2DAZ A;  2HGA A;  4Z8J A;  4O06 A;  2Z9I A;  4N6X A;  3NGH A;  2ENO A;  1Y8T A;  2G5M B;  3K50 A;  4JOH A;  1XZ9 A;  4Q2P A;  2OQS A;  3HPK A;  2EEH A;  2QG1 A;  5GND A;  3CH8 A;  3QJN A;  1VCW A;  2M0Z A;  3EGH C;  2EEG A;  4K6Y A;  1U3B A;  2KYL A;  4P0C A;  3QE1 A;  1NF3 C;  2YUB A;  2PA1 A;  1V1T A;  2H3L A;  2L4T A;  4K76 A;  1SOT A;  2M0T A;  1QAV A;  3QJM A;  1YBO A;  5HF4 A;  5DTH A;  3NFK A;  2YT8 A;  4JL7 A;  3RL7 A;  4JOG A;  3SUZ A;  2I6V A;  3LNX A;  4UU5 A;  1W9O A;  2V1W A;  4NXP A;  2W7R A;  2OMJ A;  3SFJ A; 
#chains in the Genus database with same CATH topology
 3OTP A;  2YUY A;  5JXB A;  2EAQ A;  2EGO A;  2DLU A;  3TSZ A;  4XHV A;  1P1D A;  5GLJ A;  1X5R A;  2EHR A;  5HF1 A;  2OGP A;  2GZV A;  2M0U A;  1SOZ A;  1VJ6 A;  2K1Z A;  2DM8 A;  2Q3G A;  4YYX A;  3JXT A;  1M5Z A;  1FCF A;  2AWW A;  1UM1 A;  2DMZ A;  1GQ5 A;  3STJ A;  2RCZ A;  2PKT A;  2D90 A;  1Q3O A;  2L97 A;  4E35 A;  1IU2 A;  3ID4 A;  3PDZ A;  4PQW A;  3I4W A;  4Q2Q A;  3QIK A;  4NMO A;  1RGW A;  2FE5 A;  1ZOK A;  1WHA A;  1X8S A;  3BPU A;  4GVD A;  5EZ0 A;  3GSL A;  1UJV A;  2YTW A;  1Q7X A;  1Y7N A;  2KL1 A;  5H3J A;  3GDS A;  3GCO A;  3VQF A;  3LNY A;  4LMM A;  1UJD A;  2I1N A;  4NXR A;  4JOE A;  5D13 A;  2D8I A;  4NXQ A;  1MFG A;  3TMH A;  1N6E A;  5HFE A;  3E17 A;  5ILB A;  3AXA A;  4JOR A;  2KJD A;  2CSJ A;  2KA9 A;  5EYZ A;  1P1E A;  4KFW A;  1VA8 A;  2MHO A;  2LUI A;  3KDG A;  2EDZ A;  1IHJ A;  3MH7 A;  1N6D A;  2VWR A;  5HFD A;  3R69 A;  2KV8 A;  1X6D A;  2H2C A;  2I0L A;  4K72 A;  2LC6 A;  1UFX A;  2LC7 A;  3K82 A;  3EGG C;  3CC0 A;  2KJK A;  3RLE A;  1G9O A;  1OBY A;  2KPK A;  1W9E A;  3GJ9 A;  4E3B A;  2QT5 A;  4EDJ A;  4Q6S A;  5HFC A;  1WI4 A;  2JIN A;  1TP3 A;  1UIT A;  2PZD A;  3B76 A;  5E1Y A;  2QKV A;  2EGN A;  2JWE A;  1U39 A;  1RZX A;  4HOP A;  5FHT A;  2EGK A;  1UEQ A;  1KWA A;  2VSP A;  1U37 A;  2EEJ A;  2JOA A;  1UEP A;  4MPA A;  2IWN A;  1Z87 A;  1FC7 A;  3CBY A;  2K20 A;  2YT7 A;  2LOB A;  4UU6 A;  2LA8 A;  2X7Z A;  4JOJ A;  2I04 A;  1X5N A;  4P2A B;  5G1E A;  2L4S A;  3GDU A;  1T2M A;  1UEZ A;  4HOP B;  3KHF A;  3ZRT A;  2M10 A;  3I18 A;  1WHD A;  4NNM A;  4AMH A;  2H2B A;  3PV5 A;  1Z86 A;  2E7K A;  3CYY A;  2D92 A;  3OU0 A;  3CBX A;  1IU0 A;  1LCY A;  2OZF A;  1D5G A;  2DJT A;  1N7E A;  1V6B A;  1MC7 A;  4NMV A;  4IC6 A;  4NMT A;  2ZPL A;  2F5Y A;  1X5Q A;  1K32 A;  3FY5 A;  1V5L A;  1UJU A;  3O5N A;  2MX6 A;  4JJ0 A;  4JJ3 A;  3WKM A;  3PDV A;  4OEP A;  2KG2 A;  2JIK A;  2M3M A;  5I7Z A;  4FLN A;  3QO6 A;  1FC9 A;  3SOE A;  5B6L A;  2KAW A;  2PDZ A;  4GVC A;  2V90 A;  3ID1 A;  1WFV A;  2Q9V A;  1OZI A;  2JIL A;  1NTE A;  2PNT A;  1Q3P A;  3R0H A;  4OEO A;  5HED A;  3TSW A;  4K75 A;  2JXO A;  2DB5 A;  3I1E A;  5F3X A;  2G2L A;  2KBS A;  1KY9 A;  5HFB A;  1OBZ A;  2QKU A;  3DOR A;  1UM7 A;  3R68 A;  1U38 A;  1N6F A;  2QKT A;  2QBW A;  1RGR A;  2R4H A;  2IWO A;  1N7F A;  3ID3 A;  1X45 A;  2VSV A;  2HE2 A;  1I92 A;  3HPM A;  2AWU A;  2EEI A;  1MFL A;  1WH1 A;  1WF8 A;  3O46 A;  4L8N A;  1TP5 A;  4NMS A;  4NMP A;  5HDY A;  4GHN A;  2DC2 A;  2R3Y A;  1L6O A;  1WI2 A;  2GEF A;  1I16 A;  5E6P B;  2OS6 A;  3TSV A;  3GCN A;  4NMQ A;  2AWX A;  1KEF A;  1FC6 A;  3MH4 A;  1PDR A;  3KZE A;  2KOH A;  2VZ5 A;  5E21 A;  1WF7 A;  1VAE A;  4K78 A;  4FGM A;  2UZC A;  2HE4 A;  1V5Q A;  5HET A;  1R6J A;  3DIW A;  2P3W A;  2OPG A;  2EV8 A;  4E34 A;  2O2T A;  5IL9 A;  1VB7 A;  2WL7 A;  4G69 A;  2EDV A;  2CSS A;  4R2Z A;  3DJ3 A;  3CBZ A;  2PKU A;  1WG6 A;  3QDO A;  1X9Z A;  2KQF A;  3HVQ C;  4WYT A;  5HEY A;  5B42 A;  5A2P A;  2FN5 A;  1BFE A;  1WFG A;  5HJ1 A;  3RL8 A;  5E11 A;  4NMR A;  4Q2O A;  3SHW A;  2IWQ A;  1UHP A;  3CS0 A;  5G1D A;  2IWP A;  5F67 A;  1W9Q A;  3DJA A;  2JRE A;  4KFV A;  5HFF A;  1QAV B;  1ZUB A;  2CS5 A;  2FNE A;  1GM1 A;  2EXG A;  2BYG A;  1OBX A;  4JOK A;  2EDP A;  2H3M A;  3K1R A;  4Q6H A;  2DLS A;  2VPH A;  1TE0 A;  2AIN A;  2DKR A;  1QLC A;  2EJY A;  2Z17 A;  1QAU A;  3DJ1 A;  4REY A;  2ZPM A;  3GDV A;  2KOJ A;  4WYU A;  4Q3H A;  4RI0 A;  4OAJ A;  5HEB A;  4JOF A;  1WJL A;  4Q2N A;  4H11 A;  3VQG A;  2RRM A;  4YDP A;  1GQ4 A;  5FB8 C;  1BE9 A;  1TQ3 A;  3GGE A;  3QGL A;  3PV2 A;  3L4F D;  1V62 A;  4Z33 A;  4F8K A;  2OCS A;  1B8Q A;  3KDK A;  2REY A;  2I4S A;  2I0I A;  3NCV A;  3PS4 A;  3PV4 A;  2KOM A;  3NFL A;  1WIF A;  2FCF A;  4NNL A;  1RY4 A;  2KJP A;  4JOP A;  2KRG A;  2F0A A;  2OSG A;  5E22 A;  1N7T A;  3ID2 A;  3SHU A;  1UEW A;  2W4F A;  2M0V A;  3GAB A;  2KPL A;  2VRF A;  1UF1 A;  1N99 A;  3WKL A;  3KZD A;  3MH6 A;  2DAZ A;  2HGA A;  4Z8J A;  4O06 A;  2Z9I A;  4N6X A;  3NGH A;  2ENO A;  1Y8T A;  2G5M B;  3K50 A;  4JOH A;  1XZ9 A;  4Q2P A;  2OQS A;  3HPK A;  2EEH A;  2QG1 A;  5GND A;  3CH8 A;  3QJN A;  1VCW A;  2M0Z A;  3EGH C;  2EEG A;  4K6Y A;  1U3B A;  2KYL A;  4P0C A;  3QE1 A;  1NF3 C;  2YUB A;  2PA1 A;  1V1T A;  2H3L A;  2L4T A;  4K76 A;  1SOT A;  2M0T A;  1QAV A;  2JSN A;  3QJM A;  1YBO A;  5HF4 A;  5DTH A;  3NFK A;  2YT8 A;  4JL7 A;  3RL7 A;  4JOG A;  3SUZ A;  2I6V A;  3LNX A;  4UU5 A;  1W9O A;  2V1W A;  4NXP A;  2W7R A;  2OMJ A;  3SFJ A; 
#chains in the Genus database with same CATH homology
 3OTP A;  2YUY A;  5JXB A;  2EAQ A;  2EGO A;  2DLU A;  3TSZ A;  4XHV A;  1P1D A;  5GLJ A;  1X5R A;  2EHR A;  5HF1 A;  2OGP A;  2GZV A;  2M0U A;  1SOZ A;  1VJ6 A;  2K1Z A;  2DM8 A;  2Q3G A;  4YYX A;  3JXT A;  1M5Z A;  1FCF A;  2AWW A;  1UM1 A;  2DMZ A;  1GQ5 A;  3STJ A;  2RCZ A;  2PKT A;  2D90 A;  1Q3O A;  2L97 A;  4E35 A;  1IU2 A;  3ID4 A;  3PDZ A;  4PQW A;  3I4W A;  4Q2Q A;  3QIK A;  4NMO A;  1RGW A;  2FE5 A;  1ZOK A;  1WHA A;  1X8S A;  3BPU A;  4GVD A;  5EZ0 A;  3GSL A;  1UJV A;  2YTW A;  1Q7X A;  1Y7N A;  2KL1 A;  5H3J A;  3GDS A;  3GCO A;  3VQF A;  3LNY A;  4LMM A;  1UJD A;  2I1N A;  4NXR A;  4JOE A;  5D13 A;  2D8I A;  4NXQ A;  1MFG A;  3TMH A;  1N6E A;  5HFE A;  3E17 A;  5ILB A;  3AXA A;  4JOR A;  2KJD A;  2CSJ A;  2KA9 A;  5EYZ A;  1P1E A;  4KFW A;  1VA8 A;  2MHO A;  2LUI A;  3KDG A;  2EDZ A;  1IHJ A;  3MH7 A;  1N6D A;  2VWR A;  5HFD A;  3R69 A;  2KV8 A;  1X6D A;  2H2C A;  2I0L A;  4K72 A;  2LC6 A;  1UFX A;  2LC7 A;  3K82 A;  3EGG C;  3CC0 A;  2KJK A;  3RLE A;  1G9O A;  1OBY A;  2KPK A;  1W9E A;  3GJ9 A;  4E3B A;  2QT5 A;  4EDJ A;  4Q6S A;  5HFC A;  1WI4 A;  2JIN A;  1TP3 A;  1UIT A;  2PZD A;  3B76 A;  5E1Y A;  2QKV A;  2EGN A;  2JWE A;  1U39 A;  1RZX A;  4HOP A;  5FHT A;  2EGK A;  1UEQ A;  1KWA A;  2VSP A;  1U37 A;  2EEJ A;  2JOA A;  1UEP A;  4MPA A;  2IWN A;  1Z87 A;  1FC7 A;  3CBY A;  2K20 A;  2YT7 A;  2LOB A;  4UU6 A;  2LA8 A;  2X7Z A;  4JOJ A;  2I04 A;  1X5N A;  4P2A B;  5G1E A;  2L4S A;  3GDU A;  1T2M A;  1UEZ A;  4HOP B;  3KHF A;  3ZRT A;  2M10 A;  3I18 A;  1WHD A;  4NNM A;  4AMH A;  2H2B A;  3PV5 A;  1Z86 A;  2E7K A;  3CYY A;  2D92 A;  3OU0 A;  3CBX A;  1IU0 A;  1LCY A;  2OZF A;  1D5G A;  2DJT A;  1N7E A;  1V6B A;  1MC7 A;  4NMV A;  4IC6 A;  4NMT A;  2ZPL A;  2F5Y A;  1X5Q A;  1K32 A;  3FY5 A;  1V5L A;  1UJU A;  3O5N A;  2MX6 A;  4JJ0 A;  4JJ3 A;  3WKM A;  3PDV A;  4OEP A;  2KG2 A;  2JIK A;  2M3M A;  5I7Z A;  4FLN A;  3QO6 A;  1FC9 A;  3SOE A;  5B6L A;  2KAW A;  2PDZ A;  4GVC A;  2V90 A;  3ID1 A;  1WFV A;  2Q9V A;  1OZI A;  2JIL A;  1NTE A;  2PNT A;  1Q3P A;  3R0H A;  4OEO A;  5HED A;  3TSW A;  4K75 A;  2JXO A;  2DB5 A;  3I1E A;  5F3X A;  2G2L A;  2KBS A;  1KY9 A;  5HFB A;  1OBZ A;  2QKU A;  3DOR A;  1UM7 A;  3R68 A;  1U38 A;  1N6F A;  2QKT A;  2QBW A;  1RGR A;  2R4H A;  2IWO A;  1N7F A;  3ID3 A;  1X45 A;  2VSV A;  2HE2 A;  1I92 A;  3HPM A;  2AWU A;  2EEI A;  1MFL A;  1WH1 A;  1WF8 A;  3O46 A;  4L8N A;  1TP5 A;  4NMS A;  4NMP A;  5HDY A;  4GHN A;  2DC2 A;  2R3Y A;  1L6O A;  1WI2 A;  2GEF A;  1I16 A;  5E6P B;  2OS6 A;  3TSV A;  3GCN A;  4NMQ A;  2AWX A;  1KEF A;  1FC6 A;  3MH4 A;  1PDR A;  3KZE A;  2KOH A;  2VZ5 A;  5E21 A;  1WF7 A;  1VAE A;  4K78 A;  4FGM A;  2UZC A;  2HE4 A;  1V5Q A;  5HET A;  1R6J A;  3DIW A;  2P3W A;  2OPG A;  2EV8 A;  4E34 A;  2O2T A;  5IL9 A;  1VB7 A;  2WL7 A;  4G69 A;  2EDV A;  2CSS A;  4R2Z A;  3DJ3 A;  3CBZ A;  2PKU A;  1WG6 A;  3QDO A;  1X9Z A;  2KQF A;  3HVQ C;  4WYT A;  5HEY A;  5B42 A;  5A2P A;  2FN5 A;  1BFE A;  1WFG A;  5HJ1 A;  3RL8 A;  5E11 A;  4NMR A;  4Q2O A;  3SHW A;  2IWQ A;  1UHP A;  3CS0 A;  5G1D A;  2IWP A;  5F67 A;  1W9Q A;  3DJA A;  2JRE A;  4KFV A;  5HFF A;  1QAV B;  1ZUB A;  2CS5 A;  2FNE A;  1GM1 A;  2EXG A;  2BYG A;  1OBX A;  4JOK A;  2EDP A;  2H3M A;  3K1R A;  4Q6H A;  2DLS A;  2VPH A;  1TE0 A;  2AIN A;  2DKR A;  1QLC A;  2EJY A;  2Z17 A;  1QAU A;  3DJ1 A;  4REY A;  2ZPM A;  3GDV A;  2KOJ A;  4WYU A;  4Q3H A;  4RI0 A;  4OAJ A;  5HEB A;  4JOF A;  1WJL A;  4Q2N A;  4H11 A;  3VQG A;  2RRM A;  4YDP A;  1GQ4 A;  5FB8 C;  1BE9 A;  1TQ3 A;  3GGE A;  3QGL A;  3PV2 A;  3L4F D;  1V62 A;  4Z33 A;  4F8K A;  2OCS A;  1B8Q A;  3KDK A;  2REY A;  2I4S A;  2I0I A;  3NCV A;  3PS4 A;  3PV4 A;  2KOM A;  3NFL A;  1WIF A;  2FCF A;  4NNL A;  1RY4 A;  2KJP A;  4JOP A;  2KRG A;  2F0A A;  2OSG A;  5E22 A;  1N7T A;  3ID2 A;  3SHU A;  1UEW A;  2W4F A;  2M0V A;  3GAB A;  2KPL A;  2VRF A;  1UF1 A;  1N99 A;  3WKL A;  3KZD A;  3MH6 A;  2DAZ A;  2HGA A;  4Z8J A;  4O06 A;  2Z9I A;  4N6X A;  3NGH A;  2ENO A;  1Y8T A;  2G5M B;  3K50 A;  4JOH A;  1XZ9 A;  4Q2P A;  2OQS A;  3HPK A;  2EEH A;  2QG1 A;  5GND A;  3CH8 A;  3QJN A;  1VCW A;  2M0Z A;  3EGH C;  2EEG A;  4K6Y A;  1U3B A;  2KYL A;  4P0C A;  3QE1 A;  1NF3 C;  2YUB A;  2PA1 A;  1V1T A;  2H3L A;  2L4T A;  4K76 A;  1SOT A;  2M0T A;  1QAV A;  2JSN A;  3QJM A;  1YBO A;  5HF4 A;  5DTH A;  3NFK A;  2YT8 A;  4JL7 A;  3RL7 A;  4JOG A;  3SUZ A;  2I6V A;  3LNX A;  4UU5 A;  1W9O A;  2V1W A;  4NXP A;  2W7R A;  2OMJ A;  3SFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...