2ZPLA

Crystal structure analysis of pdz domain a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
VRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQMVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of sigma E protease
publication title Crystal structure analysis of PDZ-domain A
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 22
structure length 92
sequence length 92
chains with identical sequence B, C
ec nomenclature ec 3.4.24.-:
pdb deposition date 2008-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2zplA00
2DMZA 5F67A 5E1YA 2QKVA 2CS5A 2D8IA 1Y7NA 2CSSA 2R4HA 2ZPLA 3GCNA 3ID3A 3GGEA 5EZ0A 2OPGA 4K78A 4JORA 2VSVA 4E35A 2Z9IA 4NMVA 3DIWA 2IWPA 2EGOA 2RRMA 4E34A 2KOHA 4GHNA 1P1DA 3R0HA 4FGMA 2DKRA 1UITA 2H2BA 4K6YA 4NMSA 1V5LA 4YYXA 5HEBA 2FCFA 2JINA 3SHWA 2KG2A 2E7KA 1W9QA 2FE5A 2H2CA 4G69A 2FN5A 2M0ZA 1FC9A 4KFWA 5I7ZA 1B8QA 4JL7A 2EEJA 4JOJA 3SUZA 3RL7A 1MFGA 3TSVA 1FC7A 3HVQC 1FC6A 1BFEA 4NMPA 5A2PA 5HF1A 2OQSA 4JOEA 2DJTA 4Q6HA 4AMHA 1WI4A 1RGRA 1WF7A 3FY5A 1NF3C 2YT7A 2I0IA 2PDZA 2VRFA 1I16A 1X5QA 2V1WA 2OMJA 3MH4A 3QGLA 1N6FA 1TE0A 2W7RA 5FHTA 3WKMA 2Q9VA 3R68A 4HOPA 2VPHA 1QAUA 2D90A 2QG1A 4YDPA 2KL1A 1N7TA 1NTEA 2JXOA 2AWXA 3GDUA 1I92A 3CBZA 5JXBA 3K82A 1SOZA 4Q2PA 1KWAA 5H3JA 2M10A 4K75A 1GM1A 4NNMA 2O2TA 2EGKA 4GVCA 1Q7XA 1IU2A 1U3BA 1QAVA 4XHVA 2I0LA 3VQGA 4JOFA 4EDJA 1GQ4A 2LA8A 2KPKA 1OBXA 3I18A 3GDSA 2YUBA 1UM1A 2KJKA 4WYTA 4OAJA 3CH8A 2H3LA 3DORA 3PV2A 3O5NA 1WF8A 3ID2A 2DLSA 1RZXA 3I4WA 2EGNA 3QO6A 5DTHA 1Z87A 3NFLA 4JOHA 3CBYA 2M3MA 2YT8A 1IHJA 3E17A 2DB5A 2JWEA 2EDVA 1WFVA 4OEPA 1TP5A 1WG6A 2F5YA 3QJMA 1M5ZA 1UJVA 5HFFA 2I1NA 3BPUA 1Q3OA 1X45A 3K1RA 4Z8JA 1OBZA 5HDYA 4LMMA 3PS4A 4Q6SA 1TP3A 2I04A 4REYA 2KYLA 3GCOA 1N99A 1V62A 1GQ5A 1VA8A 2HE4A 1W9OA 3AXAA 4NNLA 2IWNA 1OBYA 3DJAA 2KJDA 5HEDA 1KEFA 3WKLA 1X5NA 5E22A 2EDPA 2PNTA 1U39A 3STJA 2OS6A 1N6DA 5HFEA 2CSJA 3QJNA 4Q2NA 2KPLA 2G2LA 2JIKA 3K50A 4K76A 1IU0A 2JOAA 2YTWA 2EAQA 2P3WA 5E6PB 2KOJA 3OU0A 3JXTA 3RL8A 2LC7A 4NXPA 2KAWA 1Z86A 2ZPMA 1V6BA 3TSZA 4RI0A 2LUIA 1VCWA 3CS0A 3SHUA 3QE1A 4NXRA 4Q3HA 4MPAA 4PQWA 3GDVA 1L6OA 2KRGA 5D13A 2MHOA 1UHPA 4KFVA 1N7FA 2ENOA 1WIFA 3L4FD 5GLJA 5HETA 1MC7A 3KZEA 2EXGA 2AWUA 1X6DA 2KJPA 2F0AA 2L4TA 2R3YA 2L97A 2VWRA 1G9OA 3CC0A 1LCYA 3EGGC 2JREA 2BYGA 3ZRTA 1UJUA 1VB7A 1OZIA 1X5RA 2HE2A 3PV5A 5F3XA 2KOMA 4IC6A 4N6XA 5G1EA 5HEYA 1U38A 2LC6A 1SOTA 3SFJA 1UEWA 2Z17A 3O46A 5B6LA 2UZCA 3OTPA 3KZDA 5FB8C 1TQ3A 1N7EA 2QBWA 4NMOA 2M0VA 2RCZA 4F8KA 1UM7A 4L8NA 3HPMA 3TMHA 1K32A 3R69A 1WJLA 4H11A 1UF1A 1UJDA 3MH6A 3PDVA 1R6JA 1U37A 4R2ZA 5EYZA 2L4SA 2KV8A 4O06A 2LOBA 2OSGA 2QKUA 2AINA 4JOGA 4Q2OA 3DJ3A 2YUYA 2EDZA 2EEIA 4JOPA 2DLUA 4NXQA 2EHRA 1YBOA 1RGWA 2PKTA 2PA1A 3RLEA 4GVDA 3TSWA 1V1TA 2KQFA 2AWWA 3DJ1A 1W9EA 1VAEA 3QIKA 1FCFA 1WHDA 1RY4A 2DAZA 2IWQA 4HOPB 3GJ9A 4Z33A 1VJ6A 1MFLA 2KBSA 2WL7A 1QLCA 2REYA 3CBXA 1ZOKA 2EJYA 2I6VA 1WH1A 2H3MA 2QT5A 3LNYA 5E11A 2D92A 3CYYA 4JOKA 4NMTA 3PDZA 2DM8A 2EEHA 3LNXA 3PV4A 1X8SA 2K20A 2K1ZA 1N6EA 3ID4A 5HFDA 1Q3PA 3EGHC 2OGPA 5HFCA 5HJ1A 2QKTA 1QAVB 2FNEA 4E3BA 1UEZA 4K72A 2HGAA 2G5MB 3GSLA 1UFXA 2DC2A 2M0TA 3NGHA 5GNDA 3VQFA 1PDRA 3HPKA 4NMQA 2VSPA 1T2MA 1UEPA 2V90A 1ZUBA 4UU6A 5E21A 1P1EA 3QDOA 4NMRA 5G1DA 1Y8TA 2GZVA 5HF4A 3KHFA 4P2AB 1UEQA 3MH7A 2PZDA 1BE9A 2W4FA 3B76A 3ID1A 2IWOA 2M0UA 5HFBA 1WI2A 2EEGA 1XZ9A 3I1EA 1KY9A 1WFGA 2I4SA 2X7ZA 2JILA 4OEOA 2EV8A 1WHAA 3NFKA 4P0CA 2PKUA 2KA9A 3SOEA 2Q3GA 4WYUA 2OZFA 2VZ5A 4UU5A 4Q2QA 2OCSA 1V5QA 1D5GA 2MX6A
chains in the Genus database with same CATH superfamily
2DMZA 5F67A 5E1YA 2QKVA 2CS5A 2D8IA 1Y7NA 2CSSA 2R4HA 3KDGA 2ZPLA 3GCNA 3ID3A 3GGEA 5EZ0A 2OPGA 4K78A 4JORA 2VSVA 4E35A 2Z9IA 4NMVA 3DIWA 2IWPA 2EGOA 2RRMA 4E34A 2KOHA 4GHNA 5B42A 1P1DA 3R0HA 4FGMA 2DKRA 1UITA 2H2BA 4K6YA 4NMSA 1V5LA 4YYXA 5HEBA 2FCFA 2JINA 3SHWA 2KG2A 2E7KA 1W9QA 2FE5A 2H2CA 4G69A 2FN5A 2M0ZA 1FC9A 5ILBA 4KFWA 5I7ZA 4FLNA 1B8QA 4JL7A 2EEJA 4JOJA 3SUZA 3RL7A 1MFGA 3TSVA 1FC7A 3HVQC 1FC6A 1BFEA 4NMPA 5A2PA 5HF1A 2OQSA 4JOEA 2DJTA 4Q6HA 4AMHA 1WI4A 1RGRA 1WF7A 3FY5A 1NF3C 2YT7A 2I0IA 2PDZA 2VRFA 1I16A 1X5QA 2V1WA 2OMJA 3MH4A 3QGLA 1N6FA 1TE0A 2W7RA 5FHTA 3WKMA 2Q9VA 3R68A 4HOPA 2VPHA 1QAUA 4JJ3A 2D90A 2QG1A 4YDPA 2KL1A 1N7TA 1NTEA 2JXOA 2AWXA 3GDUA 1I92A 3CBZA 5JXBA 3K82A 1SOZA 4Q2PA 1KWAA 5H3JA 2M10A 4K75A 1GM1A 4NNMA 2O2TA 3GABA 2EGKA 4GVCA 1Q7XA 1IU2A 1U3BA 1QAVA 4XHVA 2I0LA 3VQGA 4JOFA 4JJ0A 4EDJA 1GQ4A 2LA8A 2KPKA 1OBXA 3I18A 3GDSA 2JSNA 2YUBA 1UM1A 2KJKA 4WYTA 4OAJA 3CH8A 2H3LA 3DORA 3PV2A 3O5NA 1WF8A 3ID2A 2DLSA 1RZXA 3I4WA 2EGNA 3QO6A 5DTHA 1Z87A 3NFLA 4JOHA 3CBYA 2M3MA 2YT8A 1IHJA 3E17A 2DB5A 2JWEA 2EDVA 1WFVA 4OEPA 1TP5A 1WG6A 2F5YA 3QJMA 1M5ZA 1UJVA 5HFFA 2I1NA 3BPUA 1Q3OA 1X45A 3K1RA 4Z8JA 1OBZA 5HDYA 4LMMA 3PS4A 4Q6SA 1TP3A 2I04A 4REYA 2KYLA 3GCOA 1N99A 1V62A 1GQ5A 1VA8A 2HE4A 1W9OA 3AXAA 4NNLA 2IWNA 1OBYA 3DJAA 2KJDA 5HEDA 1KEFA 3WKLA 1X5NA 5E22A 2EDPA 2PNTA 1U39A 3STJA 2OS6A 1N6DA 5HFEA 2CSJA 3QJNA 4Q2NA 2KPLA 2G2LA 2JIKA 3K50A 4K76A 1IU0A 2JOAA 2YTWA 2EAQA 2P3WA 3NCVA 5E6PB 2KOJA 3OU0A 3JXTA 3RL8A 2LC7A 4NXPA 2KAWA 1Z86A 2ZPMA 1V6BA 3TSZA 4RI0A 2LUIA 1VCWA 3CS0A 3SHUA 3QE1A 4NXRA 4Q3HA 4MPAA 4PQWA 3GDVA 1L6OA 2KRGA 5D13A 2MHOA 1UHPA 4KFVA 1N7FA 2ENOA 1WIFA 3L4FD 5GLJA 5HETA 1MC7A 3KZEA 2EXGA 2AWUA 1X6DA 2KJPA 2F0AA 2L4TA 2R3YA 2L97A 2VWRA 1G9OA 3CC0A 1LCYA 3EGGC 2JREA 2BYGA 3ZRTA 1UJUA 1VB7A 1OZIA 1X5RA 2HE2A 3PV5A 5F3XA 2KOMA 4IC6A 4N6XA 5G1EA 5HEYA 1U38A 2LC6A 1SOTA 3SFJA 1UEWA 2Z17A 3O46A 5B6LA 2UZCA 3OTPA 3KZDA 5FB8C 1TQ3A 1N7EA 2QBWA 4NMOA 2M0VA 2RCZA 4F8KA 1UM7A 4L8NA 3HPMA 3TMHA 1K32A 3R69A 1WJLA 4H11A 1UF1A 1UJDA 3MH6A 3PDVA 1R6JA 5IL9A 1U37A 4R2ZA 5EYZA 2L4SA 2KV8A 4O06A 2LOBA 2OSGA 2QKUA 2AINA 4JOGA 4Q2OA 3DJ3A 2YUYA 2GEFA 2EDZA 2EEIA 4JOPA 2DLUA 4NXQA 2EHRA 1YBOA 1RGWA 2PKTA 2PA1A 3RLEA 4GVDA 3TSWA 1V1TA 2KQFA 2AWWA 3DJ1A 1W9EA 1VAEA 3QIKA 1FCFA 1WHDA 1RY4A 1X9ZA 2DAZA 2IWQA 4HOPB 3GJ9A 4Z33A 1VJ6A 1MFLA 2KBSA 2WL7A 1QLCA 2REYA 3CBXA 1ZOKA 2EJYA 2I6VA 1WH1A 2H3MA 3KDKA 2QT5A 3LNYA 5E11A 2D92A 3CYYA 4JOKA 4NMTA 3PDZA 2DM8A 2EEHA 3LNXA 3PV4A 1X8SA 2K20A 2K1ZA 1N6EA 3ID4A 5HFDA 1Q3PA 3EGHC 2OGPA 5HFCA 5HJ1A 2QKTA 1QAVB 2FNEA 4E3BA 1UEZA 4K72A 2HGAA 2G5MB 3GSLA 1UFXA 2DC2A 2M0TA 3NGHA 5GNDA 3VQFA 1PDRA 3HPKA 4NMQA 2VSPA 1T2MA 1UEPA 2V90A 1ZUBA 4UU6A 5E21A 1P1EA 3QDOA 4NMRA 5G1DA 1Y8TA 2GZVA 5HF4A 3KHFA 4P2AB 1UEQA 3MH7A 2PZDA 1BE9A 2W4FA 3B76A 3ID1A 2IWOA 2M0UA 5HFBA 1WI2A 2EEGA 1XZ9A 3I1EA 1KY9A 1WFGA 2I4SA 2X7ZA 2JILA 4OEOA 2EV8A 1WHAA 3NFKA 4P0CA 2PKUA 2KA9A 3SOEA 2Q3GA 4WYUA 2OZFA 2VZ5A 4UU5A 4Q2QA 2OCSA 1V5QA 1D5GA 2MX6A
chains in the Genus database with same CATH topology
2DMZA 5F67A 5E1YA 2QKVA 2CS5A 2D8IA 1Y7NA 2CSSA 2R4HA 3KDGA 2ZPLA 3GCNA 3ID3A 3GGEA 5EZ0A 2OPGA 4K78A 4JORA 2VSVA 4E35A 2Z9IA 4NMVA 3DIWA 2IWPA 2EGOA 2RRMA 4E34A 2KOHA 4GHNA 5B42A 1P1DA 3R0HA 4FGMA 2DKRA 1UITA 2H2BA 4K6YA 4NMSA 1V5LA 4YYXA 5HEBA 2FCFA 2JINA 3SHWA 2KG2A 2E7KA 1W9QA 2FE5A 2H2CA 4G69A 2FN5A 2M0ZA 1FC9A 5ILBA 4KFWA 5I7ZA 4FLNA 1B8QA 4JL7A 2EEJA 4JOJA 3SUZA 3RL7A 1MFGA 3TSVA 1FC7A 3HVQC 1FC6A 1BFEA 4NMPA 5A2PA 5HF1A 2OQSA 4JOEA 2DJTA 4Q6HA 4AMHA 1WI4A 1RGRA 1WF7A 3FY5A 1NF3C 2YT7A 2I0IA 2PDZA 2VRFA 1I16A 1X5QA 2V1WA 2OMJA 3MH4A 3QGLA 1N6FA 1TE0A 2W7RA 5FHTA 3WKMA 2Q9VA 3R68A 4HOPA 2VPHA 1QAUA 4JJ3A 2D90A 2QG1A 4YDPA 2KL1A 1N7TA 1NTEA 2JXOA 2AWXA 3GDUA 1I92A 3CBZA 5JXBA 3K82A 1SOZA 4Q2PA 1KWAA 5H3JA 2M10A 4K75A 1GM1A 4NNMA 2O2TA 3GABA 2EGKA 4GVCA 1Q7XA 1IU2A 1U3BA 1QAVA 4XHVA 2I0LA 3VQGA 4JOFA 4JJ0A 4EDJA 1GQ4A 2LA8A 2KPKA 1OBXA 3I18A 3GDSA 2JSNA 2YUBA 1UM1A 2KJKA 4WYTA 4OAJA 3CH8A 2H3LA 3DORA 3PV2A 3O5NA 1WF8A 3ID2A 2DLSA 1RZXA 3I4WA 2EGNA 3QO6A 5DTHA 1Z87A 3NFLA 4JOHA 3CBYA 2M3MA 2YT8A 1IHJA 3E17A 2DB5A 2JWEA 2EDVA 1WFVA 4OEPA 1TP5A 1WG6A 2F5YA 3QJMA 1M5ZA 1UJVA 5HFFA 2I1NA 3BPUA 1Q3OA 1X45A 3K1RA 4Z8JA 1OBZA 5HDYA 4LMMA 3PS4A 4Q6SA 1TP3A 2I04A 4REYA 2KYLA 3GCOA 1N99A 1V62A 1GQ5A 1VA8A 2HE4A 1W9OA 3AXAA 4NNLA 2IWNA 1OBYA 3DJAA 2KJDA 5HEDA 1KEFA 3WKLA 1X5NA 5E22A 2EDPA 2PNTA 1U39A 3STJA 2OS6A 1N6DA 5HFEA 2CSJA 3QJNA 4Q2NA 2KPLA 2G2LA 2JIKA 3K50A 4K76A 1IU0A 2JOAA 2YTWA 2EAQA 2P3WA 3NCVA 5E6PB 2KOJA 3OU0A 3JXTA 3RL8A 2LC7A 4NXPA 2KAWA 1Z86A 2ZPMA 1V6BA 3TSZA 4RI0A 2LUIA 1VCWA 3CS0A 3SHUA 3QE1A 4NXRA 4Q3HA 4MPAA 4PQWA 3GDVA 1L6OA 2KRGA 5D13A 2MHOA 1UHPA 4KFVA 1N7FA 2ENOA 1WIFA 3L4FD 5GLJA 5HETA 1MC7A 3KZEA 2EXGA 2AWUA 1X6DA 2KJPA 2F0AA 2L4TA 2R3YA 2L97A 2VWRA 1G9OA 3CC0A 1LCYA 3EGGC 2JREA 2BYGA 3ZRTA 1UJUA 1VB7A 1OZIA 1X5RA 2HE2A 3PV5A 5F3XA 2KOMA 4IC6A 4N6XA 5G1EA 5HEYA 1U38A 2LC6A 1SOTA 3SFJA 1UEWA 2Z17A 3O46A 5B6LA 2UZCA 3OTPA 3KZDA 5FB8C 1TQ3A 1N7EA 2QBWA 4NMOA 2M0VA 2RCZA 4F8KA 1UM7A 4L8NA 3HPMA 3TMHA 1K32A 3R69A 1WJLA 4H11A 1UF1A 1UJDA 3MH6A 3PDVA 1R6JA 5IL9A 1U37A 4R2ZA 5EYZA 2L4SA 2KV8A 4O06A 2LOBA 2OSGA 2QKUA 2AINA 4JOGA 4Q2OA 3DJ3A 2YUYA 2GEFA 2EDZA 2EEIA 4JOPA 2DLUA 4NXQA 2EHRA 1YBOA 1RGWA 2PKTA 2PA1A 3RLEA 4GVDA 3TSWA 1V1TA 2KQFA 2AWWA 3DJ1A 1W9EA 1VAEA 3QIKA 1FCFA 1WHDA 1RY4A 1X9ZA 2DAZA 2IWQA 4HOPB 3GJ9A 4Z33A 1VJ6A 1MFLA 2KBSA 2WL7A 1QLCA 2REYA 3CBXA 1ZOKA 2EJYA 2I6VA 1WH1A 2H3MA 3KDKA 2QT5A 3LNYA 5E11A 2D92A 3CYYA 4JOKA 4NMTA 3PDZA 2DM8A 2EEHA 3LNXA 3PV4A 1X8SA 2K20A 2K1ZA 1N6EA 3ID4A 5HFDA 1Q3PA 3EGHC 2OGPA 5HFCA 5HJ1A 2QKTA 1QAVB 2FNEA 4E3BA 1UEZA 4K72A 2HGAA 2G5MB 3GSLA 1UFXA 2DC2A 2M0TA 3NGHA 5GNDA 3VQFA 1PDRA 3HPKA 4NMQA 2VSPA 1T2MA 1UEPA 2V90A 1ZUBA 4UU6A 5E21A 1P1EA 3QDOA 4NMRA 5G1DA 1Y8TA 2GZVA 5HF4A 3KHFA 4P2AB 1UEQA 3MH7A 2PZDA 1BE9A 2W4FA 3B76A 3ID1A 2IWOA 2M0UA 5HFBA 1WI2A 2EEGA 1XZ9A 3I1EA 1KY9A 1WFGA 2I4SA 2X7ZA 2JILA 4OEOA 2EV8A 1WHAA 3NFKA 4P0CA 2PKUA 2KA9A 3SOEA 2Q3GA 4WYUA 2OZFA 2VZ5A 4UU5A 4Q2QA 2OCSA 1V5QA 1D5GA 2MX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMZ A;  5F67 A;  5E1Y A;  2QKV A;  2CS5 A;  2D8I A;  1Y7N A;  2CSS A;  2R4H A;  2ZPL A;  3GCN A;  3ID3 A;  3GGE A;  5EZ0 A;  2OPG A;  4K78 A;  4JOR A;  2VSV A;  4E35 A;  2Z9I A;  4NMV A;  3DIW A;  2IWP A;  2EGO A;  2RRM A;  4E34 A;  2KOH A;  4GHN A;  1P1D A;  3R0H A;  4FGM A;  2DKR A;  1UIT A;  2H2B A;  4K6Y A;  4NMS A;  1V5L A;  4YYX A;  5HEB A;  2FCF A;  2JIN A;  3SHW A;  2KG2 A;  2E7K A;  1W9Q A;  2FE5 A;  2H2C A;  4G69 A;  2FN5 A;  2M0Z A;  1FC9 A;  4KFW A;  5I7Z A;  1B8Q A;  4JL7 A;  2EEJ A;  4JOJ A;  3SUZ A;  3RL7 A;  1MFG A;  3TSV A;  1FC7 A;  3HVQ C;  1FC6 A;  1BFE A;  4NMP A;  5A2P A;  5HF1 A;  2OQS A;  4JOE A;  2DJT A;  4Q6H A;  4AMH A;  1WI4 A;  1RGR A;  1WF7 A;  3FY5 A;  1NF3 C;  2YT7 A;  2I0I A;  2PDZ A;  2VRF A;  1I16 A;  1X5Q A;  2V1W A;  2OMJ A;  3MH4 A;  3QGL A;  1N6F A;  1TE0 A;  2W7R A;  5FHT A;  3WKM A;  2Q9V A;  3R68 A;  4HOP A;  2VPH A;  1QAU A;  2D90 A;  2QG1 A;  4YDP A;  2KL1 A;  1N7T A;  1NTE A;  2JXO A;  2AWX A;  3GDU A;  1I92 A;  3CBZ A;  5JXB A;  3K82 A;  1SOZ A;  4Q2P A;  1KWA A;  5H3J A;  2M10 A;  4K75 A;  1GM1 A;  4NNM A;  2O2T A;  2EGK A;  4GVC A;  1Q7X A;  1IU2 A;  1U3B A;  1QAV A;  4XHV A;  2I0L A;  3VQG A;  4JOF A;  4EDJ A;  1GQ4 A;  2LA8 A;  2KPK A;  1OBX A;  3I18 A;  3GDS A;  2YUB A;  1UM1 A;  2KJK A;  4WYT A;  4OAJ A;  3CH8 A;  2H3L A;  3DOR A;  3PV2 A;  3O5N A;  1WF8 A;  3ID2 A;  2DLS A;  1RZX A;  3I4W A;  2EGN A;  3QO6 A;  5DTH A;  1Z87 A;  3NFL A;  4JOH A;  3CBY A;  2M3M A;  2YT8 A;  1IHJ A;  3E17 A;  2DB5 A;  2JWE A;  2EDV A;  1WFV A;  4OEP A;  1TP5 A;  1WG6 A;  2F5Y A;  3QJM A;  1M5Z A;  1UJV A;  5HFF A;  2I1N A;  3BPU A;  1Q3O A;  1X45 A;  3K1R A;  4Z8J A;  1OBZ A;  5HDY A;  4LMM A;  3PS4 A;  4Q6S A;  1TP3 A;  2I04 A;  4REY A;  2KYL A;  3GCO A;  1N99 A;  1V62 A;  1GQ5 A;  1VA8 A;  2HE4 A;  1W9O A;  3AXA A;  4NNL A;  2IWN A;  1OBY A;  3DJA A;  2KJD A;  5HED A;  1KEF A;  3WKL A;  1X5N A;  5E22 A;  2EDP A;  2PNT A;  1U39 A;  3STJ A;  2OS6 A;  1N6D A;  5HFE A;  2CSJ A;  3QJN A;  4Q2N A;  2KPL A;  2G2L A;  2JIK A;  3K50 A;  4K76 A;  1IU0 A;  2JOA A;  2YTW A;  2EAQ A;  2P3W A;  5E6P B;  2KOJ A;  3OU0 A;  3JXT A;  3RL8 A;  2LC7 A;  4NXP A;  2KAW A;  1Z86 A;  2ZPM A;  1V6B A;  3TSZ A;  4RI0 A;  2LUI A;  1VCW A;  3CS0 A;  3SHU A;  3QE1 A;  4NXR A;  4Q3H A;  4MPA A;  4PQW A;  3GDV A;  1L6O A;  2KRG A;  5D13 A;  2MHO A;  1UHP A;  4KFV A;  1N7F A;  2ENO A;  1WIF A;  3L4F D;  5GLJ A;  5HET A;  1MC7 A;  3KZE A;  2EXG A;  2AWU A;  1X6D A;  2KJP A;  2F0A A;  2L4T A;  2R3Y A;  2L97 A;  2VWR A;  1G9O A;  3CC0 A;  1LCY A;  3EGG C;  2JRE A;  2BYG A;  3ZRT A;  1UJU A;  1VB7 A;  1OZI A;  1X5R A;  2HE2 A;  3PV5 A;  5F3X A;  2KOM A;  4IC6 A;  4N6X A;  5G1E A;  5HEY A;  1U38 A;  2LC6 A;  1SOT A;  3SFJ A;  1UEW A;  2Z17 A;  3O46 A;  5B6L A;  2UZC A;  3OTP A;  3KZD A;  5FB8 C;  1TQ3 A;  1N7E A;  2QBW A;  4NMO A;  2M0V A;  2RCZ A;  4F8K A;  1UM7 A;  4L8N A;  3HPM A;  3TMH A;  1K32 A;  3R69 A;  1WJL A;  4H11 A;  1UF1 A;  1UJD A;  3MH6 A;  3PDV A;  1R6J A;  1U37 A;  4R2Z A;  5EYZ A;  2L4S A;  2KV8 A;  4O06 A;  2LOB A;  2OSG A;  2QKU A;  2AIN A;  4JOG A;  4Q2O A;  3DJ3 A;  2YUY A;  2EDZ A;  2EEI A;  4JOP A;  2DLU A;  4NXQ A;  2EHR A;  1YBO A;  1RGW A;  2PKT A;  2PA1 A;  3RLE A;  4GVD A;  3TSW A;  1V1T A;  2KQF A;  2AWW A;  3DJ1 A;  1W9E A;  1VAE A;  3QIK A;  1FCF A;  1WHD A;  1RY4 A;  2DAZ A;  2IWQ A;  4HOP B;  3GJ9 A;  4Z33 A;  1VJ6 A;  1MFL A;  2KBS A;  2WL7 A;  1QLC A;  2REY A;  3CBX A;  1ZOK A;  2EJY A;  2I6V A;  1WH1 A;  2H3M A;  2QT5 A;  3LNY A;  5E11 A;  2D92 A;  3CYY A;  4JOK A;  4NMT A;  3PDZ A;  2DM8 A;  2EEH A;  3LNX A;  3PV4 A;  1X8S A;  2K20 A;  2K1Z A;  1N6E A;  3ID4 A;  5HFD A;  1Q3P A;  3EGH C;  2OGP A;  5HFC A;  5HJ1 A;  2QKT A;  1QAV B;  2FNE A;  4E3B A;  1UEZ A;  4K72 A;  2HGA A;  2G5M B;  3GSL A;  1UFX A;  2DC2 A;  2M0T A;  3NGH A;  5GND A;  3VQF A;  1PDR A;  3HPK A;  4NMQ A;  2VSP A;  1T2M A;  1UEP A;  2V90 A;  1ZUB A;  4UU6 A;  5E21 A;  1P1E A;  3QDO A;  4NMR A;  5G1D A;  1Y8T A;  2GZV A;  5HF4 A;  3KHF A;  4P2A B;  1UEQ A;  3MH7 A;  2PZD A;  1BE9 A;  2W4F A;  3B76 A;  3ID1 A;  2IWO A;  2M0U A;  5HFB A;  1WI2 A;  2EEG A;  1XZ9 A;  3I1E A;  1KY9 A;  1WFG A;  2I4S A;  2X7Z A;  2JIL A;  4OEO A;  2EV8 A;  1WHA A;  3NFK A;  4P0C A;  2PKU A;  2KA9 A;  3SOE A;  2Q3G A;  4WYU A;  2OZF A;  2VZ5 A;  4UU5 A;  4Q2Q A;  2OCS A;  1V5Q A;  1D5G A;  2MX6 A; 
#chains in the Genus database with same CATH topology
 2DMZ A;  5F67 A;  5E1Y A;  2QKV A;  2CS5 A;  2D8I A;  1Y7N A;  2CSS A;  2R4H A;  3KDG A;  2ZPL A;  3GCN A;  3ID3 A;  3GGE A;  5EZ0 A;  2OPG A;  4K78 A;  4JOR A;  2VSV A;  4E35 A;  2Z9I A;  4NMV A;  3DIW A;  2IWP A;  2EGO A;  2RRM A;  4E34 A;  2KOH A;  4GHN A;  5B42 A;  1P1D A;  3R0H A;  4FGM A;  2DKR A;  1UIT A;  2H2B A;  4K6Y A;  4NMS A;  1V5L A;  4YYX A;  5HEB A;  2FCF A;  2JIN A;  3SHW A;  2KG2 A;  2E7K A;  1W9Q A;  2FE5 A;  2H2C A;  4G69 A;  2FN5 A;  2M0Z A;  1FC9 A;  5ILB A;  4KFW A;  5I7Z A;  4FLN A;  1B8Q A;  4JL7 A;  2EEJ A;  4JOJ A;  3SUZ A;  3RL7 A;  1MFG A;  3TSV A;  1FC7 A;  3HVQ C;  1FC6 A;  1BFE A;  4NMP A;  5A2P A;  5HF1 A;  2OQS A;  4JOE A;  2DJT A;  4Q6H A;  4AMH A;  1WI4 A;  1RGR A;  1WF7 A;  3FY5 A;  1NF3 C;  2YT7 A;  2I0I A;  2PDZ A;  2VRF A;  1I16 A;  1X5Q A;  2V1W A;  2OMJ A;  3MH4 A;  3QGL A;  1N6F A;  1TE0 A;  2W7R A;  5FHT A;  3WKM A;  2Q9V A;  3R68 A;  4HOP A;  2VPH A;  1QAU A;  4JJ3 A;  2D90 A;  2QG1 A;  4YDP A;  2KL1 A;  1N7T A;  1NTE A;  2JXO A;  2AWX A;  3GDU A;  1I92 A;  3CBZ A;  5JXB A;  3K82 A;  1SOZ A;  4Q2P A;  1KWA A;  5H3J A;  2M10 A;  4K75 A;  1GM1 A;  4NNM A;  2O2T A;  3GAB A;  2EGK A;  4GVC A;  1Q7X A;  1IU2 A;  1U3B A;  1QAV A;  4XHV A;  2I0L A;  3VQG A;  4JOF A;  4JJ0 A;  4EDJ A;  1GQ4 A;  2LA8 A;  2KPK A;  1OBX A;  3I18 A;  3GDS A;  2JSN A;  2YUB A;  1UM1 A;  2KJK A;  4WYT A;  4OAJ A;  3CH8 A;  2H3L A;  3DOR A;  3PV2 A;  3O5N A;  1WF8 A;  3ID2 A;  2DLS A;  1RZX A;  3I4W A;  2EGN A;  3QO6 A;  5DTH A;  1Z87 A;  3NFL A;  4JOH A;  3CBY A;  2M3M A;  2YT8 A;  1IHJ A;  3E17 A;  2DB5 A;  2JWE A;  2EDV A;  1WFV A;  4OEP A;  1TP5 A;  1WG6 A;  2F5Y A;  3QJM A;  1M5Z A;  1UJV A;  5HFF A;  2I1N A;  3BPU A;  1Q3O A;  1X45 A;  3K1R A;  4Z8J A;  1OBZ A;  5HDY A;  4LMM A;  3PS4 A;  4Q6S A;  1TP3 A;  2I04 A;  4REY A;  2KYL A;  3GCO A;  1N99 A;  1V62 A;  1GQ5 A;  1VA8 A;  2HE4 A;  1W9O A;  3AXA A;  4NNL A;  2IWN A;  1OBY A;  3DJA A;  2KJD A;  5HED A;  1KEF A;  3WKL A;  1X5N A;  5E22 A;  2EDP A;  2PNT A;  1U39 A;  3STJ A;  2OS6 A;  1N6D A;  5HFE A;  2CSJ A;  3QJN A;  4Q2N A;  2KPL A;  2G2L A;  2JIK A;  3K50 A;  4K76 A;  1IU0 A;  2JOA A;  2YTW A;  2EAQ A;  2P3W A;  3NCV A;  5E6P B;  2KOJ A;  3OU0 A;  3JXT A;  3RL8 A;  2LC7 A;  4NXP A;  2KAW A;  1Z86 A;  2ZPM A;  1V6B A;  3TSZ A;  4RI0 A;  2LUI A;  1VCW A;  3CS0 A;  3SHU A;  3QE1 A;  4NXR A;  4Q3H A;  4MPA A;  4PQW A;  3GDV A;  1L6O A;  2KRG A;  5D13 A;  2MHO A;  1UHP A;  4KFV A;  1N7F A;  2ENO A;  1WIF A;  3L4F D;  5GLJ A;  5HET A;  1MC7 A;  3KZE A;  2EXG A;  2AWU A;  1X6D A;  2KJP A;  2F0A A;  2L4T A;  2R3Y A;  2L97 A;  2VWR A;  1G9O A;  3CC0 A;  1LCY A;  3EGG C;  2JRE A;  2BYG A;  3ZRT A;  1UJU A;  1VB7 A;  1OZI A;  1X5R A;  2HE2 A;  3PV5 A;  5F3X A;  2KOM A;  4IC6 A;  4N6X A;  5G1E A;  5HEY A;  1U38 A;  2LC6 A;  1SOT A;  3SFJ A;  1UEW A;  2Z17 A;  3O46 A;  5B6L A;  2UZC A;  3OTP A;  3KZD A;  5FB8 C;  1TQ3 A;  1N7E A;  2QBW A;  4NMO A;  2M0V A;  2RCZ A;  4F8K A;  1UM7 A;  4L8N A;  3HPM A;  3TMH A;  1K32 A;  3R69 A;  1WJL A;  4H11 A;  1UF1 A;  1UJD A;  3MH6 A;  3PDV A;  1R6J A;  5IL9 A;  1U37 A;  4R2Z A;  5EYZ A;  2L4S A;  2KV8 A;  4O06 A;  2LOB A;  2OSG A;  2QKU A;  2AIN A;  4JOG A;  4Q2O A;  3DJ3 A;  2YUY A;  2GEF A;  2EDZ A;  2EEI A;  4JOP A;  2DLU A;  4NXQ A;  2EHR A;  1YBO A;  1RGW A;  2PKT A;  2PA1 A;  3RLE A;  4GVD A;  3TSW A;  1V1T A;  2KQF A;  2AWW A;  3DJ1 A;  1W9E A;  1VAE A;  3QIK A;  1FCF A;  1WHD A;  1RY4 A;  1X9Z A;  2DAZ A;  2IWQ A;  4HOP B;  3GJ9 A;  4Z33 A;  1VJ6 A;  1MFL A;  2KBS A;  2WL7 A;  1QLC A;  2REY A;  3CBX A;  1ZOK A;  2EJY A;  2I6V A;  1WH1 A;  2H3M A;  3KDK A;  2QT5 A;  3LNY A;  5E11 A;  2D92 A;  3CYY A;  4JOK A;  4NMT A;  3PDZ A;  2DM8 A;  2EEH A;  3LNX A;  3PV4 A;  1X8S A;  2K20 A;  2K1Z A;  1N6E A;  3ID4 A;  5HFD A;  1Q3P A;  3EGH C;  2OGP A;  5HFC A;  5HJ1 A;  2QKT A;  1QAV B;  2FNE A;  4E3B A;  1UEZ A;  4K72 A;  2HGA A;  2G5M B;  3GSL A;  1UFX A;  2DC2 A;  2M0T A;  3NGH A;  5GND A;  3VQF A;  1PDR A;  3HPK A;  4NMQ A;  2VSP A;  1T2M A;  1UEP A;  2V90 A;  1ZUB A;  4UU6 A;  5E21 A;  1P1E A;  3QDO A;  4NMR A;  5G1D A;  1Y8T A;  2GZV A;  5HF4 A;  3KHF A;  4P2A B;  1UEQ A;  3MH7 A;  2PZD A;  1BE9 A;  2W4F A;  3B76 A;  3ID1 A;  2IWO A;  2M0U A;  5HFB A;  1WI2 A;  2EEG A;  1XZ9 A;  3I1E A;  1KY9 A;  1WFG A;  2I4S A;  2X7Z A;  2JIL A;  4OEO A;  2EV8 A;  1WHA A;  3NFK A;  4P0C A;  2PKU A;  2KA9 A;  3SOE A;  2Q3G A;  4WYU A;  2OZF A;  2VZ5 A;  4UU5 A;  4Q2Q A;  2OCS A;  1V5Q A;  1D5G A;  2MX6 A; 
#chains in the Genus database with same CATH homology
 2DMZ A;  5F67 A;  5E1Y A;  2QKV A;  2CS5 A;  2D8I A;  1Y7N A;  2CSS A;  2R4H A;  3KDG A;  2ZPL A;  3GCN A;  3ID3 A;  3GGE A;  5EZ0 A;  2OPG A;  4K78 A;  4JOR A;  2VSV A;  4E35 A;  2Z9I A;  4NMV A;  3DIW A;  2IWP A;  2EGO A;  2RRM A;  4E34 A;  2KOH A;  4GHN A;  5B42 A;  1P1D A;  3R0H A;  4FGM A;  2DKR A;  1UIT A;  2H2B A;  4K6Y A;  4NMS A;  1V5L A;  4YYX A;  5HEB A;  2FCF A;  2JIN A;  3SHW A;  2KG2 A;  2E7K A;  1W9Q A;  2FE5 A;  2H2C A;  4G69 A;  2FN5 A;  2M0Z A;  1FC9 A;  5ILB A;  4KFW A;  5I7Z A;  4FLN A;  1B8Q A;  4JL7 A;  2EEJ A;  4JOJ A;  3SUZ A;  3RL7 A;  1MFG A;  3TSV A;  1FC7 A;  3HVQ C;  1FC6 A;  1BFE A;  4NMP A;  5A2P A;  5HF1 A;  2OQS A;  4JOE A;  2DJT A;  4Q6H A;  4AMH A;  1WI4 A;  1RGR A;  1WF7 A;  3FY5 A;  1NF3 C;  2YT7 A;  2I0I A;  2PDZ A;  2VRF A;  1I16 A;  1X5Q A;  2V1W A;  2OMJ A;  3MH4 A;  3QGL A;  1N6F A;  1TE0 A;  2W7R A;  5FHT A;  3WKM A;  2Q9V A;  3R68 A;  4HOP A;  2VPH A;  1QAU A;  4JJ3 A;  2D90 A;  2QG1 A;  4YDP A;  2KL1 A;  1N7T A;  1NTE A;  2JXO A;  2AWX A;  3GDU A;  1I92 A;  3CBZ A;  5JXB A;  3K82 A;  1SOZ A;  4Q2P A;  1KWA A;  5H3J A;  2M10 A;  4K75 A;  1GM1 A;  4NNM A;  2O2T A;  3GAB A;  2EGK A;  4GVC A;  1Q7X A;  1IU2 A;  1U3B A;  1QAV A;  4XHV A;  2I0L A;  3VQG A;  4JOF A;  4JJ0 A;  4EDJ A;  1GQ4 A;  2LA8 A;  2KPK A;  1OBX A;  3I18 A;  3GDS A;  2JSN A;  2YUB A;  1UM1 A;  2KJK A;  4WYT A;  4OAJ A;  3CH8 A;  2H3L A;  3DOR A;  3PV2 A;  3O5N A;  1WF8 A;  3ID2 A;  2DLS A;  1RZX A;  3I4W A;  2EGN A;  3QO6 A;  5DTH A;  1Z87 A;  3NFL A;  4JOH A;  3CBY A;  2M3M A;  2YT8 A;  1IHJ A;  3E17 A;  2DB5 A;  2JWE A;  2EDV A;  1WFV A;  4OEP A;  1TP5 A;  1WG6 A;  2F5Y A;  3QJM A;  1M5Z A;  1UJV A;  5HFF A;  2I1N A;  3BPU A;  1Q3O A;  1X45 A;  3K1R A;  4Z8J A;  1OBZ A;  5HDY A;  4LMM A;  3PS4 A;  4Q6S A;  1TP3 A;  2I04 A;  4REY A;  2KYL A;  3GCO A;  1N99 A;  1V62 A;  1GQ5 A;  1VA8 A;  2HE4 A;  1W9O A;  3AXA A;  4NNL A;  2IWN A;  1OBY A;  3DJA A;  2KJD A;  5HED A;  1KEF A;  3WKL A;  1X5N A;  5E22 A;  2EDP A;  2PNT A;  1U39 A;  3STJ A;  2OS6 A;  1N6D A;  5HFE A;  2CSJ A;  3QJN A;  4Q2N A;  2KPL A;  2G2L A;  2JIK A;  3K50 A;  4K76 A;  1IU0 A;  2JOA A;  2YTW A;  2EAQ A;  2P3W A;  3NCV A;  5E6P B;  2KOJ A;  3OU0 A;  3JXT A;  3RL8 A;  2LC7 A;  4NXP A;  2KAW A;  1Z86 A;  2ZPM A;  1V6B A;  3TSZ A;  4RI0 A;  2LUI A;  1VCW A;  3CS0 A;  3SHU A;  3QE1 A;  4NXR A;  4Q3H A;  4MPA A;  4PQW A;  3GDV A;  1L6O A;  2KRG A;  5D13 A;  2MHO A;  1UHP A;  4KFV A;  1N7F A;  2ENO A;  1WIF A;  3L4F D;  5GLJ A;  5HET A;  1MC7 A;  3KZE A;  2EXG A;  2AWU A;  1X6D A;  2KJP A;  2F0A A;  2L4T A;  2R3Y A;  2L97 A;  2VWR A;  1G9O A;  3CC0 A;  1LCY A;  3EGG C;  2JRE A;  2BYG A;  3ZRT A;  1UJU A;  1VB7 A;  1OZI A;  1X5R A;  2HE2 A;  3PV5 A;  5F3X A;  2KOM A;  4IC6 A;  4N6X A;  5G1E A;  5HEY A;  1U38 A;  2LC6 A;  1SOT A;  3SFJ A;  1UEW A;  2Z17 A;  3O46 A;  5B6L A;  2UZC A;  3OTP A;  3KZD A;  5FB8 C;  1TQ3 A;  1N7E A;  2QBW A;  4NMO A;  2M0V A;  2RCZ A;  4F8K A;  1UM7 A;  4L8N A;  3HPM A;  3TMH A;  1K32 A;  3R69 A;  1WJL A;  4H11 A;  1UF1 A;  1UJD A;  3MH6 A;  3PDV A;  1R6J A;  5IL9 A;  1U37 A;  4R2Z A;  5EYZ A;  2L4S A;  2KV8 A;  4O06 A;  2LOB A;  2OSG A;  2QKU A;  2AIN A;  4JOG A;  4Q2O A;  3DJ3 A;  2YUY A;  2GEF A;  2EDZ A;  2EEI A;  4JOP A;  2DLU A;  4NXQ A;  2EHR A;  1YBO A;  1RGW A;  2PKT A;  2PA1 A;  3RLE A;  4GVD A;  3TSW A;  1V1T A;  2KQF A;  2AWW A;  3DJ1 A;  1W9E A;  1VAE A;  3QIK A;  1FCF A;  1WHD A;  1RY4 A;  1X9Z A;  2DAZ A;  2IWQ A;  4HOP B;  3GJ9 A;  4Z33 A;  1VJ6 A;  1MFL A;  2KBS A;  2WL7 A;  1QLC A;  2REY A;  3CBX A;  1ZOK A;  2EJY A;  2I6V A;  1WH1 A;  2H3M A;  3KDK A;  2QT5 A;  3LNY A;  5E11 A;  2D92 A;  3CYY A;  4JOK A;  4NMT A;  3PDZ A;  2DM8 A;  2EEH A;  3LNX A;  3PV4 A;  1X8S A;  2K20 A;  2K1Z A;  1N6E A;  3ID4 A;  5HFD A;  1Q3P A;  3EGH C;  2OGP A;  5HFC A;  5HJ1 A;  2QKT A;  1QAV B;  2FNE A;  4E3B A;  1UEZ A;  4K72 A;  2HGA A;  2G5M B;  3GSL A;  1UFX A;  2DC2 A;  2M0T A;  3NGH A;  5GND A;  3VQF A;  1PDR A;  3HPK A;  4NMQ A;  2VSP A;  1T2M A;  1UEP A;  2V90 A;  1ZUB A;  4UU6 A;  5E21 A;  1P1E A;  3QDO A;  4NMR A;  5G1D A;  1Y8T A;  2GZV A;  5HF4 A;  3KHF A;  4P2A B;  1UEQ A;  3MH7 A;  2PZD A;  1BE9 A;  2W4F A;  3B76 A;  3ID1 A;  2IWO A;  2M0U A;  5HFB A;  1WI2 A;  2EEG A;  1XZ9 A;  3I1E A;  1KY9 A;  1WFG A;  2I4S A;  2X7Z A;  2JIL A;  4OEO A;  2EV8 A;  1WHA A;  3NFK A;  4P0C A;  2PKU A;  2KA9 A;  3SOE A;  2Q3G A;  4WYU A;  2OZF A;  2VZ5 A;  4UU5 A;  4Q2Q A;  2OCS A;  1V5Q A;  1D5G A;  2MX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...