2Q9VA

Crystal structure of the c890s mutant of the 4th pdz domain of human membrane associated guanylate kinase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
SMEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELISVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRQTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated guanylate kinase.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2q9vA00
1N6FA 5HETA 5A2PA 2LC6A 1KWAA 4F8KA 2VZ5A 4OEOA 2KJPA 3ID1A 2FNEA 4P2AB 1VAEA 5HJ1A 2Q3GA 3SHWA 1Q3OA 1QAUA 3HPKA 1MFGA 2I0LA 2D90A 3QIKA 4IC6A 1GQ5A 2KJDA 4JOGA 3CYYA 2DAZA 4YDPA 5I7ZA 1X5RA 1SOZA 5G1DA 5GNDA 2EDVA 1G9OA 3WKMA 1U39A 3ZRTA 2QT5A 2G2LA 2JILA 4XHVA 2I6VA 3DJ3A 1NF3C 2PA1A 1TP3A 2EEHA 1OBYA 2EV8A 5HF4A 2KG2A 1N7EA 4OAJA 1T2MA 2K20A 3K82A 5F67A 1FC6A 1IHJA 4YYXA 3ID2A 1X45A 1OBXA 1FC9A 1VJ6A 2V90A 1U38A 3GDUA 3SFJA 2UZCA 3CS0A 2FCFA 2KA9A 1RGRA 3MH4A 1IU2A 2H2BA 3EGHC 2OGPA 1TE0A 3PDZA 2DB5A 2F0AA 2EGNA 3R68A 2EGKA 2MHOA 1WJLA 1MC7A 3CH8A 4NXQA 4E3BA 2OS6A 3PV2A 3QJMA 4KFVA 4K78A 1UFXA 3LNXA 3TSVA 2IWNA 1X5NA 1UEPA 1QLCA 1QAVA 3PS4A 1X6DA 2AINA 3VQFA 4Z33A 2HE2A 2EHRA 2YUYA 3OTPA 4NXRA 5H3JA 1UEWA 1GQ4A 4E34A 3EGGC 2DC2A 2DKRA 2VPHA 1N7TA 4REYA 4NMSA 4PQWA 1N6EA 3GCOA 2RRMA 3K1RA 4P0CA 5F3XA 2FE5A 1B8QA 2I0IA 3VQGA 2KBSA 5EYZA 2YTWA 4JOKA 5HEBA 5D13A 2KAWA 1TP5A 3DJAA 3SOEA 2OSGA 4JORA 4NMVA 4NMOA 4KFWA 1SOTA 1LCYA 4MPAA 2D92A 3LNYA 3RLEA 1Z87A 1K32A 2DLSA 1M5ZA 2W4FA 2AWWA 3CC0A 3PDVA 2P3WA 4WYTA 1W9QA 4NXPA 4AMHA 2F5YA 3ID4A 3O5NA 1QAVB 1RY4A 1MFLA 1N7FA 3CBYA 3SUZA 4N6XA 2JXOA 1WF8A 3B76A 1KY9A 2L4TA 5E21A 4NMPA 2QBWA 3TSWA 2OMJA 2CSSA 4R2ZA 2OQSA 2KRGA 4JOEA 3TMHA 2V1WA 4Q2NA 5FHTA 3R0HA 2IWQA 4G69A 2M3MA 3FY5A 4GHNA 1RZXA 2MX6A 1WHAA 2DM8A 2KV8A 3KZEA 2QKVA 4NMTA 2G5MB 3NFKA 1N6DA 2M0VA 5G1EA 4K6YA 3STJA 4O06A 3R69A 3WKLA 3O46A 2JREA 4K72A 4Q6HA 2VSVA 1I16A 4HOPA 2I04A 3GDSA 3E17A 3QGLA 2JINA 3AXAA 4Q2PA 3DJ1A 5HFEA 1L6OA 3HVQC 3ID3A 1I92A 2RCZA 2EGOA 1UEQA 1UM1A 3K50A 5HF1A 2CSJA 2H3LA 3RL8A 4LMMA 4H11A 2IWOA 2EJYA 2OCSA 4K75A 4EDJA 2H2CA 2R3YA 3I1EA 1FCFA 1P1EA 2M0UA 2EAQA 2CS5A 2PDZA 2PKUA 2QKUA 2ZPMA 1UITA 5HEYA 2L4SA 2PZDA 1W9OA 1V6BA 3KHFA 4E35A 3PV4A 1V5LA 2ENOA 1XZ9A 1UJVA 2AWXA 2JWEA 1Y7NA 1WHDA 1NTEA 4NNLA 1UHPA 2HGAA 1N99A 2H3MA 1YBOA 2IWPA 3DIWA 5HFDA 1BFEA 2KL1A 1UJUA 3TSZA 4HOPB 1OZIA 2EEJA 3MH6A 1V1TA 1UJDA 3QO6A 3DORA 4Z8JA 2VSPA 4L8NA 2EXGA 2YT8A 2REYA 2Z9IA 2LOBA 3SHUA 2KYLA 3MH7A 5E1YA 3RL7A 3KZDA 2EDPA 3BPUA 2DJTA 1WI4A 1X5QA 4WYUA 3QJNA 2O2TA 4Q3HA 1VA8A 5E6PB 5HDYA 1Y8TA 2Q9VA 4FGMA 5E22A 2EEGA 2DLUA 1V62A 3GGEA 5HEDA 3OU0A 1WG6A 1P1DA 1UEZA 2KJKA 2K1ZA 4OEPA 1PDRA 4RI0A 1WH1A 4UU5A 1RGWA 4K76A 1ZUBA 3GJ9A 2I1NA 2PNTA 2Z17A 1GM1A 5DTHA 1TQ3A 2EEIA 3L4FD 3GDVA 2E7KA 1OBZA 1VCWA 3I4WA 5EZ0A 4JL7A 1U37A 4NMRA 1WI2A 5HFBA 3QDOA 2I4SA 2L97A 1Q7XA 3JXTA 2WL7A 1X8SA 1U3BA 2D8IA 4NNMA 2W7RA 1VB7A 3GSLA 1Q3PA 1FC7A 2KOHA 2FN5A 2KPLA 2AWUA 2EDZA 2KOJA 2QKTA 5FB8C 2KOMA 1D5GA 2M0ZA 5B6LA 1R6JA 2QG1A 2VWRA 5GLJA 1ZOKA 3QE1A 4Q2OA 4JOHA 3PV5A 3I18A 1WFGA 1WFVA 3NGHA 1KEFA 4NMQA 5HFFA 5HFCA 1UM7A 1V5QA 1Z86A 2HE4A 2M0TA 2GZVA 2PKTA 2JOAA 2KPKA 4UU6A 3GCNA 2OPGA 2VRFA 3CBZA 4GVCA 4Q2QA 2ZPLA 2LA8A 2R4HA 1W9EA 2M10A 2LC7A 3CBXA 2LUIA 1BE9A 2YT7A 3HPMA 2X7ZA 1IU0A 1WIFA 2JIKA 4JOPA 2KQFA 4JOJA 5JXBA 1UF1A 4JOFA 4GVDA 4Q6SA 2YUBA 3NFLA 1WF7A 2DMZA 5E11A 2OZFA 2BYGA
chains in the Genus database with same CATH superfamily
1N6FA 5HETA 5A2PA 2LC6A 1KWAA 4F8KA 2VZ5A 4OEOA 4FLNA 2KJPA 3ID1A 2FNEA 4P2AB 1VAEA 5HJ1A 2Q3GA 3SHWA 1Q3OA 1QAUA 3HPKA 1MFGA 2I0LA 2D90A 3QIKA 4IC6A 1GQ5A 2KJDA 4JOGA 3CYYA 2DAZA 4YDPA 5I7ZA 1X5RA 1SOZA 5G1DA 5GNDA 2EDVA 1G9OA 3WKMA 1U39A 3ZRTA 2QT5A 2G2LA 2JILA 4XHVA 2I6VA 3DJ3A 1NF3C 2PA1A 1TP3A 2EEHA 1OBYA 2EV8A 5HF4A 2KG2A 1N7EA 4OAJA 1T2MA 2K20A 3K82A 5F67A 1FC6A 1IHJA 4YYXA 3ID2A 1X45A 1OBXA 1FC9A 1VJ6A 3NCVA 2V90A 1U38A 3GDUA 3SFJA 2UZCA 3CS0A 2FCFA 5B42A 2KA9A 1RGRA 3MH4A 1IU2A 2H2BA 3EGHC 2OGPA 1TE0A 3PDZA 2DB5A 2F0AA 2EGNA 3R68A 2EGKA 2MHOA 1WJLA 1MC7A 3CH8A 4NXQA 4E3BA 2JSNA 2OS6A 3PV2A 3QJMA 4KFVA 4K78A 1UFXA 3LNXA 3TSVA 2IWNA 1X5NA 1UEPA 1QLCA 1QAVA 3PS4A 1X6DA 2AINA 3VQFA 4Z33A 2HE2A 2EHRA 2YUYA 3OTPA 4NXRA 5H3JA 1UEWA 1GQ4A 4E34A 3EGGC 2DC2A 2DKRA 2VPHA 1N7TA 4REYA 4NMSA 4PQWA 1N6EA 3GCOA 2RRMA 3K1RA 4P0CA 5F3XA 2FE5A 1B8QA 2I0IA 3VQGA 2KBSA 5EYZA 2YTWA 4JOKA 5HEBA 5D13A 2KAWA 1TP5A 3DJAA 3SOEA 2OSGA 4JORA 4NMVA 4NMOA 4KFWA 1SOTA 1LCYA 4MPAA 2D92A 3LNYA 3RLEA 1Z87A 1K32A 2DLSA 1M5ZA 2W4FA 2AWWA 3CC0A 3PDVA 2P3WA 4WYTA 1W9QA 4NXPA 4AMHA 2F5YA 3ID4A 3O5NA 1QAVB 1RY4A 1MFLA 1N7FA 3CBYA 3SUZA 4N6XA 2JXOA 1WF8A 4JJ0A 3B76A 1KY9A 2L4TA 5E21A 4NMPA 2QBWA 3TSWA 2OMJA 2CSSA 4R2ZA 2OQSA 2KRGA 4JOEA 3TMHA 2V1WA 4Q2NA 5FHTA 3R0HA 2IWQA 4G69A 2M3MA 3FY5A 4GHNA 1RZXA 2MX6A 1WHAA 2DM8A 2KV8A 3KZEA 2QKVA 4NMTA 2G5MB 3NFKA 1N6DA 2M0VA 5G1EA 4K6YA 3STJA 4O06A 3R69A 3WKLA 3O46A 2JREA 4K72A 4Q6HA 2VSVA 1I16A 4HOPA 2I04A 3GDSA 3E17A 3QGLA 2JINA 3AXAA 4Q2PA 3DJ1A 5HFEA 1L6OA 3HVQC 3ID3A 1I92A 2RCZA 2EGOA 1UEQA 1UM1A 3K50A 5HF1A 2CSJA 2H3LA 3RL8A 4LMMA 4H11A 2IWOA 2EJYA 2OCSA 4K75A 4EDJA 2H2CA 2R3YA 3I1EA 5ILBA 1FCFA 1P1EA 2M0UA 2EAQA 2CS5A 2PDZA 2PKUA 2QKUA 2ZPMA 1UITA 5HEYA 2L4SA 2PZDA 1W9OA 1V6BA 3KHFA 4E35A 3PV4A 1V5LA 2ENOA 1XZ9A 1UJVA 2AWXA 2JWEA 1Y7NA 1WHDA 1NTEA 4NNLA 1UHPA 2HGAA 1N99A 2H3MA 1YBOA 2IWPA 3DIWA 5HFDA 1BFEA 2KL1A 1UJUA 3TSZA 4HOPB 1OZIA 2EEJA 3MH6A 1V1TA 1UJDA 3GABA 3QO6A 3DORA 4Z8JA 2VSPA 4L8NA 2EXGA 2YT8A 2REYA 2Z9IA 2LOBA 3SHUA 2KYLA 3MH7A 5E1YA 3RL7A 3KZDA 2EDPA 3BPUA 2DJTA 1WI4A 1X5QA 4WYUA 3QJNA 4JJ3A 2O2TA 4Q3HA 1VA8A 5E6PB 5HDYA 1Y8TA 2Q9VA 4FGMA 5E22A 2EEGA 2DLUA 1V62A 3GGEA 5HEDA 3OU0A 1WG6A 1P1DA 1UEZA 2KJKA 2K1ZA 4OEPA 1PDRA 4RI0A 1WH1A 4UU5A 1RGWA 4K76A 1ZUBA 3GJ9A 2I1NA 2PNTA 2Z17A 1GM1A 5DTHA 1TQ3A 2EEIA 3L4FD 3GDVA 2E7KA 1OBZA 3KDKA 1VCWA 3I4WA 5EZ0A 4JL7A 1U37A 4NMRA 1WI2A 5HFBA 3QDOA 2I4SA 2L97A 1Q7XA 3JXTA 2WL7A 1X8SA 1U3BA 2D8IA 4NNMA 2W7RA 1VB7A 3GSLA 1Q3PA 1FC7A 2KOHA 2FN5A 2KPLA 2AWUA 2EDZA 2KOJA 2QKTA 5FB8C 2KOMA 1D5GA 2M0ZA 5B6LA 1R6JA 2QG1A 2VWRA 5GLJA 1ZOKA 3QE1A 4Q2OA 4JOHA 3PV5A 3I18A 1WFGA 1WFVA 3NGHA 1KEFA 4NMQA 5HFFA 5HFCA 1UM7A 1V5QA 1Z86A 2HE4A 2M0TA 2GZVA 2PKTA 2JOAA 2KPKA 4UU6A 3GCNA 2OPGA 3KDGA 2VRFA 3CBZA 4GVCA 4Q2QA 2ZPLA 2LA8A 2GEFA 2R4HA 1W9EA 2M10A 2LC7A 3CBXA 2LUIA 1BE9A 2YT7A 3HPMA 2X7ZA 1X9ZA 5IL9A 1IU0A 1WIFA 2JIKA 4JOPA 2KQFA 4JOJA 5JXBA 1UF1A 4JOFA 4GVDA 4Q6SA 2YUBA 3NFLA 1WF7A 2DMZA 5E11A 2OZFA 2BYGA
chains in the Genus database with same CATH topology
1N6FA 5HETA 5A2PA 2LC6A 1KWAA 4F8KA 2VZ5A 4OEOA 4FLNA 2KJPA 3ID1A 2FNEA 4P2AB 1VAEA 5HJ1A 2Q3GA 3SHWA 1Q3OA 1QAUA 3HPKA 1MFGA 2I0LA 2D90A 3QIKA 4IC6A 1GQ5A 2KJDA 4JOGA 3CYYA 2DAZA 4YDPA 5I7ZA 1X5RA 1SOZA 5G1DA 5GNDA 2EDVA 1G9OA 3WKMA 1U39A 3ZRTA 2QT5A 2G2LA 2JILA 4XHVA 2I6VA 3DJ3A 1NF3C 2PA1A 1TP3A 2EEHA 1OBYA 2EV8A 5HF4A 2KG2A 1N7EA 4OAJA 1T2MA 2K20A 3K82A 5F67A 1FC6A 1IHJA 4YYXA 3ID2A 1X45A 1OBXA 1FC9A 1VJ6A 3NCVA 2V90A 1U38A 3GDUA 3SFJA 2UZCA 3CS0A 2FCFA 5B42A 2KA9A 1RGRA 3MH4A 1IU2A 2H2BA 3EGHC 2OGPA 1TE0A 3PDZA 2DB5A 2F0AA 2EGNA 3R68A 2EGKA 2MHOA 1WJLA 1MC7A 3CH8A 4NXQA 4E3BA 2JSNA 2OS6A 3PV2A 3QJMA 4KFVA 4K78A 1UFXA 3LNXA 3TSVA 2IWNA 1X5NA 1UEPA 1QLCA 1QAVA 3PS4A 1X6DA 2AINA 3VQFA 4Z33A 2HE2A 2EHRA 2YUYA 3OTPA 4NXRA 5H3JA 1UEWA 1GQ4A 4E34A 3EGGC 2DC2A 2DKRA 2VPHA 1N7TA 4REYA 4NMSA 4PQWA 1N6EA 3GCOA 2RRMA 3K1RA 4P0CA 5F3XA 2FE5A 1B8QA 2I0IA 3VQGA 2KBSA 5EYZA 2YTWA 4JOKA 5HEBA 5D13A 2KAWA 1TP5A 3DJAA 3SOEA 2OSGA 4JORA 4NMVA 4NMOA 4KFWA 1SOTA 1LCYA 4MPAA 2D92A 3LNYA 3RLEA 1Z87A 1K32A 2DLSA 1M5ZA 2W4FA 2AWWA 3CC0A 3PDVA 2P3WA 4WYTA 1W9QA 4NXPA 4AMHA 2F5YA 3ID4A 3O5NA 1QAVB 1RY4A 1MFLA 1N7FA 3CBYA 3SUZA 4N6XA 2JXOA 1WF8A 4JJ0A 3B76A 1KY9A 2L4TA 5E21A 4NMPA 2QBWA 3TSWA 2OMJA 2CSSA 4R2ZA 2OQSA 2KRGA 4JOEA 3TMHA 2V1WA 4Q2NA 5FHTA 3R0HA 2IWQA 4G69A 2M3MA 3FY5A 4GHNA 1RZXA 2MX6A 1WHAA 2DM8A 2KV8A 3KZEA 2QKVA 4NMTA 2G5MB 3NFKA 1N6DA 2M0VA 5G1EA 4K6YA 3STJA 4O06A 3R69A 3WKLA 3O46A 2JREA 4K72A 4Q6HA 2VSVA 1I16A 4HOPA 2I04A 3GDSA 3E17A 3QGLA 2JINA 3AXAA 4Q2PA 3DJ1A 5HFEA 1L6OA 3HVQC 3ID3A 1I92A 2RCZA 2EGOA 1UEQA 1UM1A 3K50A 5HF1A 2CSJA 2H3LA 3RL8A 4LMMA 4H11A 2IWOA 2EJYA 2OCSA 4K75A 4EDJA 2H2CA 2R3YA 3I1EA 5ILBA 1FCFA 1P1EA 2M0UA 2EAQA 2CS5A 2PDZA 2PKUA 2QKUA 2ZPMA 1UITA 5HEYA 2L4SA 2PZDA 1W9OA 1V6BA 3KHFA 4E35A 3PV4A 1V5LA 2ENOA 1XZ9A 1UJVA 2AWXA 2JWEA 1Y7NA 1WHDA 1NTEA 4NNLA 1UHPA 2HGAA 1N99A 2H3MA 1YBOA 2IWPA 3DIWA 5HFDA 1BFEA 2KL1A 1UJUA 3TSZA 4HOPB 1OZIA 2EEJA 3MH6A 1V1TA 1UJDA 3GABA 3QO6A 3DORA 4Z8JA 2VSPA 4L8NA 2EXGA 2YT8A 2REYA 2Z9IA 2LOBA 3SHUA 2KYLA 3MH7A 5E1YA 3RL7A 3KZDA 2EDPA 3BPUA 2DJTA 1WI4A 1X5QA 4WYUA 3QJNA 4JJ3A 2O2TA 4Q3HA 1VA8A 5E6PB 5HDYA 1Y8TA 2Q9VA 4FGMA 5E22A 2EEGA 2DLUA 1V62A 3GGEA 5HEDA 3OU0A 1WG6A 1P1DA 1UEZA 2KJKA 2K1ZA 4OEPA 1PDRA 4RI0A 1WH1A 4UU5A 1RGWA 4K76A 1ZUBA 3GJ9A 2I1NA 2PNTA 2Z17A 1GM1A 5DTHA 1TQ3A 2EEIA 3L4FD 3GDVA 2E7KA 1OBZA 3KDKA 1VCWA 3I4WA 5EZ0A 4JL7A 1U37A 4NMRA 1WI2A 5HFBA 3QDOA 2I4SA 2L97A 1Q7XA 3JXTA 2WL7A 1X8SA 1U3BA 2D8IA 4NNMA 2W7RA 1VB7A 3GSLA 1Q3PA 1FC7A 2KOHA 2FN5A 2KPLA 2AWUA 2EDZA 2KOJA 2QKTA 5FB8C 2KOMA 1D5GA 2M0ZA 5B6LA 1R6JA 2QG1A 2VWRA 5GLJA 1ZOKA 3QE1A 4Q2OA 4JOHA 3PV5A 3I18A 1WFGA 1WFVA 3NGHA 1KEFA 4NMQA 5HFFA 5HFCA 1UM7A 1V5QA 1Z86A 2HE4A 2M0TA 2GZVA 2PKTA 2JOAA 2KPKA 4UU6A 3GCNA 2OPGA 3KDGA 2VRFA 3CBZA 4GVCA 4Q2QA 2ZPLA 2LA8A 2GEFA 2R4HA 1W9EA 2M10A 2LC7A 3CBXA 2LUIA 1BE9A 2YT7A 3HPMA 2X7ZA 1X9ZA 5IL9A 1IU0A 1WIFA 2JIKA 4JOPA 2KQFA 4JOJA 5JXBA 1UF1A 4JOFA 4GVDA 4Q6SA 2YUBA 3NFLA 1WF7A 2DMZA 5E11A 2OZFA 2BYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6F A;  5HET A;  5A2P A;  2LC6 A;  1KWA A;  4F8K A;  2VZ5 A;  4OEO A;  2KJP A;  3ID1 A;  2FNE A;  4P2A B;  1VAE A;  5HJ1 A;  2Q3G A;  3SHW A;  1Q3O A;  1QAU A;  3HPK A;  1MFG A;  2I0L A;  2D90 A;  3QIK A;  4IC6 A;  1GQ5 A;  2KJD A;  4JOG A;  3CYY A;  2DAZ A;  4YDP A;  5I7Z A;  1X5R A;  1SOZ A;  5G1D A;  5GND A;  2EDV A;  1G9O A;  3WKM A;  1U39 A;  3ZRT A;  2QT5 A;  2G2L A;  2JIL A;  4XHV A;  2I6V A;  3DJ3 A;  1NF3 C;  2PA1 A;  1TP3 A;  2EEH A;  1OBY A;  2EV8 A;  5HF4 A;  2KG2 A;  1N7E A;  4OAJ A;  1T2M A;  2K20 A;  3K82 A;  5F67 A;  1FC6 A;  1IHJ A;  4YYX A;  3ID2 A;  1X45 A;  1OBX A;  1FC9 A;  1VJ6 A;  2V90 A;  1U38 A;  3GDU A;  3SFJ A;  2UZC A;  3CS0 A;  2FCF A;  2KA9 A;  1RGR A;  3MH4 A;  1IU2 A;  2H2B A;  3EGH C;  2OGP A;  1TE0 A;  3PDZ A;  2DB5 A;  2F0A A;  2EGN A;  3R68 A;  2EGK A;  2MHO A;  1WJL A;  1MC7 A;  3CH8 A;  4NXQ A;  4E3B A;  2OS6 A;  3PV2 A;  3QJM A;  4KFV A;  4K78 A;  1UFX A;  3LNX A;  3TSV A;  2IWN A;  1X5N A;  1UEP A;  1QLC A;  1QAV A;  3PS4 A;  1X6D A;  2AIN A;  3VQF A;  4Z33 A;  2HE2 A;  2EHR A;  2YUY A;  3OTP A;  4NXR A;  5H3J A;  1UEW A;  1GQ4 A;  4E34 A;  3EGG C;  2DC2 A;  2DKR A;  2VPH A;  1N7T A;  4REY A;  4NMS A;  4PQW A;  1N6E A;  3GCO A;  2RRM A;  3K1R A;  4P0C A;  5F3X A;  2FE5 A;  1B8Q A;  2I0I A;  3VQG A;  2KBS A;  5EYZ A;  2YTW A;  4JOK A;  5HEB A;  5D13 A;  2KAW A;  1TP5 A;  3DJA A;  3SOE A;  2OSG A;  4JOR A;  4NMV A;  4NMO A;  4KFW A;  1SOT A;  1LCY A;  4MPA A;  2D92 A;  3LNY A;  3RLE A;  1Z87 A;  1K32 A;  2DLS A;  1M5Z A;  2W4F A;  2AWW A;  3CC0 A;  3PDV A;  2P3W A;  4WYT A;  1W9Q A;  4NXP A;  4AMH A;  2F5Y A;  3ID4 A;  3O5N A;  1QAV B;  1RY4 A;  1MFL A;  1N7F A;  3CBY A;  3SUZ A;  4N6X A;  2JXO A;  1WF8 A;  3B76 A;  1KY9 A;  2L4T A;  5E21 A;  4NMP A;  2QBW A;  3TSW A;  2OMJ A;  2CSS A;  4R2Z A;  2OQS A;  2KRG A;  4JOE A;  3TMH A;  2V1W A;  4Q2N A;  5FHT A;  3R0H A;  2IWQ A;  4G69 A;  2M3M A;  3FY5 A;  4GHN A;  1RZX A;  2MX6 A;  1WHA A;  2DM8 A;  2KV8 A;  3KZE A;  2QKV A;  4NMT A;  2G5M B;  3NFK A;  1N6D A;  2M0V A;  5G1E A;  4K6Y A;  3STJ A;  4O06 A;  3R69 A;  3WKL A;  3O46 A;  2JRE A;  4K72 A;  4Q6H A;  2VSV A;  1I16 A;  4HOP A;  2I04 A;  3GDS A;  3E17 A;  3QGL A;  2JIN A;  3AXA A;  4Q2P A;  3DJ1 A;  5HFE A;  1L6O A;  3HVQ C;  3ID3 A;  1I92 A;  2RCZ A;  2EGO A;  1UEQ A;  1UM1 A;  3K50 A;  5HF1 A;  2CSJ A;  2H3L A;  3RL8 A;  4LMM A;  4H11 A;  2IWO A;  2EJY A;  2OCS A;  4K75 A;  4EDJ A;  2H2C A;  2R3Y A;  3I1E A;  1FCF A;  1P1E A;  2M0U A;  2EAQ A;  2CS5 A;  2PDZ A;  2PKU A;  2QKU A;  2ZPM A;  1UIT A;  5HEY A;  2L4S A;  2PZD A;  1W9O A;  1V6B A;  3KHF A;  4E35 A;  3PV4 A;  1V5L A;  2ENO A;  1XZ9 A;  1UJV A;  2AWX A;  2JWE A;  1Y7N A;  1WHD A;  1NTE A;  4NNL A;  1UHP A;  2HGA A;  1N99 A;  2H3M A;  1YBO A;  2IWP A;  3DIW A;  5HFD A;  1BFE A;  2KL1 A;  1UJU A;  3TSZ A;  4HOP B;  1OZI A;  2EEJ A;  3MH6 A;  1V1T A;  1UJD A;  3QO6 A;  3DOR A;  4Z8J A;  2VSP A;  4L8N A;  2EXG A;  2YT8 A;  2REY A;  2Z9I A;  2LOB A;  3SHU A;  2KYL A;  3MH7 A;  5E1Y A;  3RL7 A;  3KZD A;  2EDP A;  3BPU A;  2DJT A;  1WI4 A;  1X5Q A;  4WYU A;  3QJN A;  2O2T A;  4Q3H A;  1VA8 A;  5E6P B;  5HDY A;  1Y8T A;  2Q9V A;  4FGM A;  5E22 A;  2EEG A;  2DLU A;  1V62 A;  3GGE A;  5HED A;  3OU0 A;  1WG6 A;  1P1D A;  1UEZ A;  2KJK A;  2K1Z A;  4OEP A;  1PDR A;  4RI0 A;  1WH1 A;  4UU5 A;  1RGW A;  4K76 A;  1ZUB A;  3GJ9 A;  2I1N A;  2PNT A;  2Z17 A;  1GM1 A;  5DTH A;  1TQ3 A;  2EEI A;  3L4F D;  3GDV A;  2E7K A;  1OBZ A;  1VCW A;  3I4W A;  5EZ0 A;  4JL7 A;  1U37 A;  4NMR A;  1WI2 A;  5HFB A;  3QDO A;  2I4S A;  2L97 A;  1Q7X A;  3JXT A;  2WL7 A;  1X8S A;  1U3B A;  2D8I A;  4NNM A;  2W7R A;  1VB7 A;  3GSL A;  1Q3P A;  1FC7 A;  2KOH A;  2FN5 A;  2KPL A;  2AWU A;  2EDZ A;  2KOJ A;  2QKT A;  5FB8 C;  2KOM A;  1D5G A;  2M0Z A;  5B6L A;  1R6J A;  2QG1 A;  2VWR A;  5GLJ A;  1ZOK A;  3QE1 A;  4Q2O A;  4JOH A;  3PV5 A;  3I18 A;  1WFG A;  1WFV A;  3NGH A;  1KEF A;  4NMQ A;  5HFF A;  5HFC A;  1UM7 A;  1V5Q A;  1Z86 A;  2HE4 A;  2M0T A;  2GZV A;  2PKT A;  2JOA A;  2KPK A;  4UU6 A;  3GCN A;  2OPG A;  2VRF A;  3CBZ A;  4GVC A;  4Q2Q A;  2ZPL A;  2LA8 A;  2R4H A;  1W9E A;  2M10 A;  2LC7 A;  3CBX A;  2LUI A;  1BE9 A;  2YT7 A;  3HPM A;  2X7Z A;  1IU0 A;  1WIF A;  2JIK A;  4JOP A;  2KQF A;  4JOJ A;  5JXB A;  1UF1 A;  4JOF A;  4GVD A;  4Q6S A;  2YUB A;  3NFL A;  1WF7 A;  2DMZ A;  5E11 A;  2OZF A;  2BYG A; 
#chains in the Genus database with same CATH topology
 1N6F A;  5HET A;  5A2P A;  2LC6 A;  1KWA A;  4F8K A;  2VZ5 A;  4OEO A;  4FLN A;  2KJP A;  3ID1 A;  2FNE A;  4P2A B;  1VAE A;  5HJ1 A;  2Q3G A;  3SHW A;  1Q3O A;  1QAU A;  3HPK A;  1MFG A;  2I0L A;  2D90 A;  3QIK A;  4IC6 A;  1GQ5 A;  2KJD A;  4JOG A;  3CYY A;  2DAZ A;  4YDP A;  5I7Z A;  1X5R A;  1SOZ A;  5G1D A;  5GND A;  2EDV A;  1G9O A;  3WKM A;  1U39 A;  3ZRT A;  2QT5 A;  2G2L A;  2JIL A;  4XHV A;  2I6V A;  3DJ3 A;  1NF3 C;  2PA1 A;  1TP3 A;  2EEH A;  1OBY A;  2EV8 A;  5HF4 A;  2KG2 A;  1N7E A;  4OAJ A;  1T2M A;  2K20 A;  3K82 A;  5F67 A;  1FC6 A;  1IHJ A;  4YYX A;  3ID2 A;  1X45 A;  1OBX A;  1FC9 A;  1VJ6 A;  3NCV A;  2V90 A;  1U38 A;  3GDU A;  3SFJ A;  2UZC A;  3CS0 A;  2FCF A;  5B42 A;  2KA9 A;  1RGR A;  3MH4 A;  1IU2 A;  2H2B A;  3EGH C;  2OGP A;  1TE0 A;  3PDZ A;  2DB5 A;  2F0A A;  2EGN A;  3R68 A;  2EGK A;  2MHO A;  1WJL A;  1MC7 A;  3CH8 A;  4NXQ A;  4E3B A;  2JSN A;  2OS6 A;  3PV2 A;  3QJM A;  4KFV A;  4K78 A;  1UFX A;  3LNX A;  3TSV A;  2IWN A;  1X5N A;  1UEP A;  1QLC A;  1QAV A;  3PS4 A;  1X6D A;  2AIN A;  3VQF A;  4Z33 A;  2HE2 A;  2EHR A;  2YUY A;  3OTP A;  4NXR A;  5H3J A;  1UEW A;  1GQ4 A;  4E34 A;  3EGG C;  2DC2 A;  2DKR A;  2VPH A;  1N7T A;  4REY A;  4NMS A;  4PQW A;  1N6E A;  3GCO A;  2RRM A;  3K1R A;  4P0C A;  5F3X A;  2FE5 A;  1B8Q A;  2I0I A;  3VQG A;  2KBS A;  5EYZ A;  2YTW A;  4JOK A;  5HEB A;  5D13 A;  2KAW A;  1TP5 A;  3DJA A;  3SOE A;  2OSG A;  4JOR A;  4NMV A;  4NMO A;  4KFW A;  1SOT A;  1LCY A;  4MPA A;  2D92 A;  3LNY A;  3RLE A;  1Z87 A;  1K32 A;  2DLS A;  1M5Z A;  2W4F A;  2AWW A;  3CC0 A;  3PDV A;  2P3W A;  4WYT A;  1W9Q A;  4NXP A;  4AMH A;  2F5Y A;  3ID4 A;  3O5N A;  1QAV B;  1RY4 A;  1MFL A;  1N7F A;  3CBY A;  3SUZ A;  4N6X A;  2JXO A;  1WF8 A;  4JJ0 A;  3B76 A;  1KY9 A;  2L4T A;  5E21 A;  4NMP A;  2QBW A;  3TSW A;  2OMJ A;  2CSS A;  4R2Z A;  2OQS A;  2KRG A;  4JOE A;  3TMH A;  2V1W A;  4Q2N A;  5FHT A;  3R0H A;  2IWQ A;  4G69 A;  2M3M A;  3FY5 A;  4GHN A;  1RZX A;  2MX6 A;  1WHA A;  2DM8 A;  2KV8 A;  3KZE A;  2QKV A;  4NMT A;  2G5M B;  3NFK A;  1N6D A;  2M0V A;  5G1E A;  4K6Y A;  3STJ A;  4O06 A;  3R69 A;  3WKL A;  3O46 A;  2JRE A;  4K72 A;  4Q6H A;  2VSV A;  1I16 A;  4HOP A;  2I04 A;  3GDS A;  3E17 A;  3QGL A;  2JIN A;  3AXA A;  4Q2P A;  3DJ1 A;  5HFE A;  1L6O A;  3HVQ C;  3ID3 A;  1I92 A;  2RCZ A;  2EGO A;  1UEQ A;  1UM1 A;  3K50 A;  5HF1 A;  2CSJ A;  2H3L A;  3RL8 A;  4LMM A;  4H11 A;  2IWO A;  2EJY A;  2OCS A;  4K75 A;  4EDJ A;  2H2C A;  2R3Y A;  3I1E A;  5ILB A;  1FCF A;  1P1E A;  2M0U A;  2EAQ A;  2CS5 A;  2PDZ A;  2PKU A;  2QKU A;  2ZPM A;  1UIT A;  5HEY A;  2L4S A;  2PZD A;  1W9O A;  1V6B A;  3KHF A;  4E35 A;  3PV4 A;  1V5L A;  2ENO A;  1XZ9 A;  1UJV A;  2AWX A;  2JWE A;  1Y7N A;  1WHD A;  1NTE A;  4NNL A;  1UHP A;  2HGA A;  1N99 A;  2H3M A;  1YBO A;  2IWP A;  3DIW A;  5HFD A;  1BFE A;  2KL1 A;  1UJU A;  3TSZ A;  4HOP B;  1OZI A;  2EEJ A;  3MH6 A;  1V1T A;  1UJD A;  3GAB A;  3QO6 A;  3DOR A;  4Z8J A;  2VSP A;  4L8N A;  2EXG A;  2YT8 A;  2REY A;  2Z9I A;  2LOB A;  3SHU A;  2KYL A;  3MH7 A;  5E1Y A;  3RL7 A;  3KZD A;  2EDP A;  3BPU A;  2DJT A;  1WI4 A;  1X5Q A;  4WYU A;  3QJN A;  4JJ3 A;  2O2T A;  4Q3H A;  1VA8 A;  5E6P B;  5HDY A;  1Y8T A;  2Q9V A;  4FGM A;  5E22 A;  2EEG A;  2DLU A;  1V62 A;  3GGE A;  5HED A;  3OU0 A;  1WG6 A;  1P1D A;  1UEZ A;  2KJK A;  2K1Z A;  4OEP A;  1PDR A;  4RI0 A;  1WH1 A;  4UU5 A;  1RGW A;  4K76 A;  1ZUB A;  3GJ9 A;  2I1N A;  2PNT A;  2Z17 A;  1GM1 A;  5DTH A;  1TQ3 A;  2EEI A;  3L4F D;  3GDV A;  2E7K A;  1OBZ A;  3KDK A;  1VCW A;  3I4W A;  5EZ0 A;  4JL7 A;  1U37 A;  4NMR A;  1WI2 A;  5HFB A;  3QDO A;  2I4S A;  2L97 A;  1Q7X A;  3JXT A;  2WL7 A;  1X8S A;  1U3B A;  2D8I A;  4NNM A;  2W7R A;  1VB7 A;  3GSL A;  1Q3P A;  1FC7 A;  2KOH A;  2FN5 A;  2KPL A;  2AWU A;  2EDZ A;  2KOJ A;  2QKT A;  5FB8 C;  2KOM A;  1D5G A;  2M0Z A;  5B6L A;  1R6J A;  2QG1 A;  2VWR A;  5GLJ A;  1ZOK A;  3QE1 A;  4Q2O A;  4JOH A;  3PV5 A;  3I18 A;  1WFG A;  1WFV A;  3NGH A;  1KEF A;  4NMQ A;  5HFF A;  5HFC A;  1UM7 A;  1V5Q A;  1Z86 A;  2HE4 A;  2M0T A;  2GZV A;  2PKT A;  2JOA A;  2KPK A;  4UU6 A;  3GCN A;  2OPG A;  3KDG A;  2VRF A;  3CBZ A;  4GVC A;  4Q2Q A;  2ZPL A;  2LA8 A;  2GEF A;  2R4H A;  1W9E A;  2M10 A;  2LC7 A;  3CBX A;  2LUI A;  1BE9 A;  2YT7 A;  3HPM A;  2X7Z A;  1X9Z A;  5IL9 A;  1IU0 A;  1WIF A;  2JIK A;  4JOP A;  2KQF A;  4JOJ A;  5JXB A;  1UF1 A;  4JOF A;  4GVD A;  4Q6S A;  2YUB A;  3NFL A;  1WF7 A;  2DMZ A;  5E11 A;  2OZF A;  2BYG A; 
#chains in the Genus database with same CATH homology
 1N6F A;  5HET A;  5A2P A;  2LC6 A;  1KWA A;  4F8K A;  2VZ5 A;  4OEO A;  4FLN A;  2KJP A;  3ID1 A;  2FNE A;  4P2A B;  1VAE A;  5HJ1 A;  2Q3G A;  3SHW A;  1Q3O A;  1QAU A;  3HPK A;  1MFG A;  2I0L A;  2D90 A;  3QIK A;  4IC6 A;  1GQ5 A;  2KJD A;  4JOG A;  3CYY A;  2DAZ A;  4YDP A;  5I7Z A;  1X5R A;  1SOZ A;  5G1D A;  5GND A;  2EDV A;  1G9O A;  3WKM A;  1U39 A;  3ZRT A;  2QT5 A;  2G2L A;  2JIL A;  4XHV A;  2I6V A;  3DJ3 A;  1NF3 C;  2PA1 A;  1TP3 A;  2EEH A;  1OBY A;  2EV8 A;  5HF4 A;  2KG2 A;  1N7E A;  4OAJ A;  1T2M A;  2K20 A;  3K82 A;  5F67 A;  1FC6 A;  1IHJ A;  4YYX A;  3ID2 A;  1X45 A;  1OBX A;  1FC9 A;  1VJ6 A;  3NCV A;  2V90 A;  1U38 A;  3GDU A;  3SFJ A;  2UZC A;  3CS0 A;  2FCF A;  5B42 A;  2KA9 A;  1RGR A;  3MH4 A;  1IU2 A;  2H2B A;  3EGH C;  2OGP A;  1TE0 A;  3PDZ A;  2DB5 A;  2F0A A;  2EGN A;  3R68 A;  2EGK A;  2MHO A;  1WJL A;  1MC7 A;  3CH8 A;  4NXQ A;  4E3B A;  2JSN A;  2OS6 A;  3PV2 A;  3QJM A;  4KFV A;  4K78 A;  1UFX A;  3LNX A;  3TSV A;  2IWN A;  1X5N A;  1UEP A;  1QLC A;  1QAV A;  3PS4 A;  1X6D A;  2AIN A;  3VQF A;  4Z33 A;  2HE2 A;  2EHR A;  2YUY A;  3OTP A;  4NXR A;  5H3J A;  1UEW A;  1GQ4 A;  4E34 A;  3EGG C;  2DC2 A;  2DKR A;  2VPH A;  1N7T A;  4REY A;  4NMS A;  4PQW A;  1N6E A;  3GCO A;  2RRM A;  3K1R A;  4P0C A;  5F3X A;  2FE5 A;  1B8Q A;  2I0I A;  3VQG A;  2KBS A;  5EYZ A;  2YTW A;  4JOK A;  5HEB A;  5D13 A;  2KAW A;  1TP5 A;  3DJA A;  3SOE A;  2OSG A;  4JOR A;  4NMV A;  4NMO A;  4KFW A;  1SOT A;  1LCY A;  4MPA A;  2D92 A;  3LNY A;  3RLE A;  1Z87 A;  1K32 A;  2DLS A;  1M5Z A;  2W4F A;  2AWW A;  3CC0 A;  3PDV A;  2P3W A;  4WYT A;  1W9Q A;  4NXP A;  4AMH A;  2F5Y A;  3ID4 A;  3O5N A;  1QAV B;  1RY4 A;  1MFL A;  1N7F A;  3CBY A;  3SUZ A;  4N6X A;  2JXO A;  1WF8 A;  4JJ0 A;  3B76 A;  1KY9 A;  2L4T A;  5E21 A;  4NMP A;  2QBW A;  3TSW A;  2OMJ A;  2CSS A;  4R2Z A;  2OQS A;  2KRG A;  4JOE A;  3TMH A;  2V1W A;  4Q2N A;  5FHT A;  3R0H A;  2IWQ A;  4G69 A;  2M3M A;  3FY5 A;  4GHN A;  1RZX A;  2MX6 A;  1WHA A;  2DM8 A;  2KV8 A;  3KZE A;  2QKV A;  4NMT A;  2G5M B;  3NFK A;  1N6D A;  2M0V A;  5G1E A;  4K6Y A;  3STJ A;  4O06 A;  3R69 A;  3WKL A;  3O46 A;  2JRE A;  4K72 A;  4Q6H A;  2VSV A;  1I16 A;  4HOP A;  2I04 A;  3GDS A;  3E17 A;  3QGL A;  2JIN A;  3AXA A;  4Q2P A;  3DJ1 A;  5HFE A;  1L6O A;  3HVQ C;  3ID3 A;  1I92 A;  2RCZ A;  2EGO A;  1UEQ A;  1UM1 A;  3K50 A;  5HF1 A;  2CSJ A;  2H3L A;  3RL8 A;  4LMM A;  4H11 A;  2IWO A;  2EJY A;  2OCS A;  4K75 A;  4EDJ A;  2H2C A;  2R3Y A;  3I1E A;  5ILB A;  1FCF A;  1P1E A;  2M0U A;  2EAQ A;  2CS5 A;  2PDZ A;  2PKU A;  2QKU A;  2ZPM A;  1UIT A;  5HEY A;  2L4S A;  2PZD A;  1W9O A;  1V6B A;  3KHF A;  4E35 A;  3PV4 A;  1V5L A;  2ENO A;  1XZ9 A;  1UJV A;  2AWX A;  2JWE A;  1Y7N A;  1WHD A;  1NTE A;  4NNL A;  1UHP A;  2HGA A;  1N99 A;  2H3M A;  1YBO A;  2IWP A;  3DIW A;  5HFD A;  1BFE A;  2KL1 A;  1UJU A;  3TSZ A;  4HOP B;  1OZI A;  2EEJ A;  3MH6 A;  1V1T A;  1UJD A;  3GAB A;  3QO6 A;  3DOR A;  4Z8J A;  2VSP A;  4L8N A;  2EXG A;  2YT8 A;  2REY A;  2Z9I A;  2LOB A;  3SHU A;  2KYL A;  3MH7 A;  5E1Y A;  3RL7 A;  3KZD A;  2EDP A;  3BPU A;  2DJT A;  1WI4 A;  1X5Q A;  4WYU A;  3QJN A;  4JJ3 A;  2O2T A;  4Q3H A;  1VA8 A;  5E6P B;  5HDY A;  1Y8T A;  2Q9V A;  4FGM A;  5E22 A;  2EEG A;  2DLU A;  1V62 A;  3GGE A;  5HED A;  3OU0 A;  1WG6 A;  1P1D A;  1UEZ A;  2KJK A;  2K1Z A;  4OEP A;  1PDR A;  4RI0 A;  1WH1 A;  4UU5 A;  1RGW A;  4K76 A;  1ZUB A;  3GJ9 A;  2I1N A;  2PNT A;  2Z17 A;  1GM1 A;  5DTH A;  1TQ3 A;  2EEI A;  3L4F D;  3GDV A;  2E7K A;  1OBZ A;  3KDK A;  1VCW A;  3I4W A;  5EZ0 A;  4JL7 A;  1U37 A;  4NMR A;  1WI2 A;  5HFB A;  3QDO A;  2I4S A;  2L97 A;  1Q7X A;  3JXT A;  2WL7 A;  1X8S A;  1U3B A;  2D8I A;  4NNM A;  2W7R A;  1VB7 A;  3GSL A;  1Q3P A;  1FC7 A;  2KOH A;  2FN5 A;  2KPL A;  2AWU A;  2EDZ A;  2KOJ A;  2QKT A;  5FB8 C;  2KOM A;  1D5G A;  2M0Z A;  5B6L A;  1R6J A;  2QG1 A;  2VWR A;  5GLJ A;  1ZOK A;  3QE1 A;  4Q2O A;  4JOH A;  3PV5 A;  3I18 A;  1WFG A;  1WFV A;  3NGH A;  1KEF A;  4NMQ A;  5HFF A;  5HFC A;  1UM7 A;  1V5Q A;  1Z86 A;  2HE4 A;  2M0T A;  2GZV A;  2PKT A;  2JOA A;  2KPK A;  4UU6 A;  3GCN A;  2OPG A;  3KDG A;  2VRF A;  3CBZ A;  4GVC A;  4Q2Q A;  2ZPL A;  2LA8 A;  2GEF A;  2R4H A;  1W9E A;  2M10 A;  2LC7 A;  3CBX A;  2LUI A;  1BE9 A;  2YT7 A;  3HPM A;  2X7Z A;  1X9Z A;  5IL9 A;  1IU0 A;  1WIF A;  2JIK A;  4JOP A;  2KQF A;  4JOJ A;  5JXB A;  1UF1 A;  4JOF A;  4GVD A;  4Q6S A;  2YUB A;  3NFL A;  1WF7 A;  2DMZ A;  5E11 A;  2OZF A;  2BYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...