2AWWA

Synapse associated protein 97 pdz2 domain variant c378g with c-terminal glur-a peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTSIVEGGAAHKDGKLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synapse associated protein 97
publication title Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2awwA00
2KG2A 3LNXA 2OPGA 5HETA 2EAQA 1QAVA 1GQ5A 4K75A 2JINA 1UITA 4N6XA 3PV5A 2IWNA 1U39A 1BE9A 1V62A 2PA1A 3EGHC 3I1EA 1UM7A 4PQWA 4NNMA 2EDVA 3HVQC 1Z86A 4Q2OA 3TSZA 2D92A 5G1DA 3PS4A 3R68A 3GJ9A 4UU5A 2I4SA 2JIKA 1OBYA 3CBYA 2KYLA 3QJMA 2OS6A 1UM1A 1Z87A 3JXTA 2HE2A 2E7KA 2KJPA 3ID2A 3QGLA 1ZUBA 1V1TA 4XHVA 2R3YA 3HPMA 5GNDA 2CS5A 1UJUA 5I7ZA 4K72A 3NFLA 3CS0A 3O5NA 4KFVA 5G1EA 1OBZA 2QKVA 2H2CA 2CSSA 4JL7A 4NXPA 2EDPA 2AWXA 4G69A 3SOEA 1BFEA 3E17A 4RI0A 3DORA 2KOJA 4Q2PA 3SUZA 2PKUA 1M5ZA 2DJTA 3TSVA 2BYGA 3WKLA 5HEDA 4F8KA 4YYXA 3RL7A 4NXRA 2EHRA 1D5GA 1VCWA 4JOHA 3AXAA 1Q7XA 2RRMA 2EEGA 2D90A 2MHOA 3K1RA 3CBXA 1LCYA 2JOAA 2R4HA 2DKRA 1WFGA 2OZFA 1VB7A 1W9QA 1W9EA 5JXBA 2QKTA 4YDPA 3RL8A 1UEZA 1FC6A 4LMMA 3QIKA 2Q9VA 2H3LA 2VZ5A 1U37A 1SOZA 2VRFA 1OZIA 1P1DA 3WKMA 4Q2QA 1WI2A 5EYZA 1UEPA 1WHAA 3EGGC 1I16A 2QKUA 1U3BA 3GSLA 2FNEA 3QE1A 2LA8A 3PV2A 2Q3GA 2KBSA 1G9OA 2K1ZA 1WJLA 1P1EA 2UZCA 1TP5A 3B76A 4GVCA 2EDZA 2KJDA 4Q6SA 2QBWA 2I1NA 4Q2NA 1X5RA 2V90A 3QDOA 1SOTA 3KZDA 1V5LA 2G5MB 3VQGA 2KV8A 2QT5A 1N6EA 5EZ0A 1FCFA 3K50A 3ID3A 2IWOA 1X5QA 2P3WA 2I6VA 1V5QA 3BPUA 2M3MA 3K82A 1IU2A 3ID1A 3MH6A 4OAJA 3PV4A 4K78A 1N6FA 3SHUA 3R0HA 1KEFA 1TQ3A 2DB5A 4FGMA 4UU6A 1GQ4A 2M10A 4JOKA 5HFBA 5H3JA 1ZOKA 2DLSA 4GVDA 1I92A 4NMVA 5HEYA 2GZVA 2KAWA 5HFCA 3NFKA 2PDZA 4NMPA 2EJYA 2X7ZA 1NTEA 2YUBA 1KY9A 2RCZA 3PDVA 4Q6HA 1UF1A 1N6DA 2FE5A 2DM8A 2LOBA 1TE0A 1UJDA 2PKTA 2OQSA 2M0ZA 4JOEA 2L4SA 1N99A 2HGAA 2H2BA 3OTPA 1QLCA 1V6BA 2EV8A 1UJVA 2KRGA 1WIFA 1IU0A 2JILA 2JWEA 4Q3HA 5DTHA 2EEHA 2IWQA 1W9OA 2DMZA 5HFFA 5HFEA 3TMHA 2EGKA 2KJKA 1MFGA 2EXGA 5F67A 3VQFA 5E6PB 1Y7NA 2JREA 4WYTA 2QG1A 3I4WA 1QAUA 1UFXA 5HEBA 2OCSA 2EEJA 3PDZA 1WI4A 3QJNA 2EEIA 1GM1A 4NMOA 1K32A 1WF8A 4L8NA 5FB8C 4NMTA 2PZDA 1Y8TA 1MFLA 4P2AB 2HE4A 3CH8A 4O06A 2YUYA 2CSJA 2OGPA 4NNLA 3DJAA 3ID4A 2AWUA 4IC6A 1X45A 3ZRTA 5E21A 3R69A 4JORA 3MH4A 1X8SA 2F5YA 4KFWA 2LC7A 5F3XA 2VSPA 1WFVA 1B8QA 2YT8A 2O2TA 2L4TA 4NMSA 1VAEA 3CYYA 1Q3PA 1MC7A 2MX6A 4NXQA 2LC6A 4REYA 5E22A 4MPAA 1UEWA 2DC2A 3TSWA 1L6OA 1Q3OA 1WHDA 2ENOA 1IHJA 4JOGA 3NGHA 3DIWA 2W4FA 4Z8JA 4HOPA 4OEOA 4P0CA 2YTWA 2I0LA 3QO6A 2JXOA 3SFJA 2REYA 2V1WA 4E34A 1XZ9A 3HPKA 4NMQA 2M0TA 1RGRA 1N7EA 4Z33A 1X5NA 2Z9IA 3I18A 5D13A 1WF7A 4K76A 3RLEA 2OSGA 3GDUA 1WG6A 3KZEA 5E11A 2KA9A 2H3MA 4NMRA 3GDVA 2KQFA 1YBOA 1UEQA 2DLUA 5HF4A 5HFDA 3GGEA 2VSVA 1N7FA 1WH1A 2F0AA 3GCOA 1TP3A 2LUIA 4GHNA 3OU0A 2VPHA 1FC7A 4AMHA 1N7TA 2IWPA 3DJ3A 2YT7A 2KPLA 3STJA 5HDYA 3GCNA 2M0VA 5A2PA 3DJ1A 1QAVB 4JOPA 2Z17A 1R6JA 1UHPA 4E3BA 2KOMA 3FY5A 2DAZA 1U38A 3O46A 1OBXA 4OEPA 5GLJA 1RZXA 4HOPB 3GDSA 3LNYA 4EDJA 3L4FD 2G2LA 3CC0A 1T2MA 2I0IA 2D8IA 4H11A 1NF3C 3CBZA 1RGWA 2KL1A 5HF1A 1VA8A 1KWAA 4WYUA 4JOFA 1PDRA 1VJ6A 1RY4A 2L97A 1X6DA 2ZPMA 5HJ1A 2FN5A 4JOJA 2ZPLA 3KHFA 3MH7A 2AINA 2FCFA 5B6LA 2VWRA 2W7RA 2AWWA 5FHTA 4E35A 2PNTA 3SHWA 4K6YA 2EGOA 2EGNA 2OMJA 2KPKA 1FC9A 2M0UA 2K20A 2WL7A 2I04A 4R2ZA 2KOHA 5E1YA
chains in the Genus database with same CATH superfamily
2KG2A 3LNXA 2OPGA 5IL9A 5HETA 2EAQA 1QAVA 1GQ5A 4K75A 2JINA 1UITA 4N6XA 3PV5A 2IWNA 1U39A 1BE9A 1V62A 2PA1A 3EGHC 3I1EA 1UM7A 4PQWA 4NNMA 2EDVA 3HVQC 1Z86A 4Q2OA 3TSZA 2D92A 5G1DA 3PS4A 3R68A 3GJ9A 4UU5A 2I4SA 2JIKA 1OBYA 3CBYA 2KYLA 3QJMA 2OS6A 1UM1A 1Z87A 3JXTA 2HE2A 2E7KA 2KJPA 3ID2A 3QGLA 1ZUBA 1V1TA 4XHVA 2R3YA 3HPMA 5GNDA 2CS5A 1UJUA 5I7ZA 4K72A 3NFLA 3CS0A 2JSNA 3O5NA 4KFVA 5G1EA 1OBZA 3KDKA 2QKVA 2H2CA 2CSSA 4JL7A 4NXPA 2EDPA 2AWXA 4G69A 3SOEA 1BFEA 3E17A 4RI0A 3DORA 2KOJA 4Q2PA 3SUZA 3KDGA 2PKUA 1M5ZA 2DJTA 3TSVA 2BYGA 3WKLA 5HEDA 4F8KA 4YYXA 3RL7A 4NXRA 2EHRA 1D5GA 1VCWA 4JOHA 3AXAA 1Q7XA 2RRMA 2EEGA 2D90A 2MHOA 3K1RA 3CBXA 1LCYA 2JOAA 2R4HA 2DKRA 1WFGA 2OZFA 1VB7A 1W9QA 1W9EA 5JXBA 2QKTA 4YDPA 3RL8A 1UEZA 1FC6A 4LMMA 3QIKA 2Q9VA 2H3LA 2VZ5A 1U37A 1SOZA 2VRFA 1OZIA 1P1DA 3WKMA 4Q2QA 1WI2A 5EYZA 1UEPA 1WHAA 3EGGC 1I16A 2QKUA 1U3BA 3GSLA 2FNEA 3QE1A 2LA8A 3PV2A 2Q3GA 2KBSA 1G9OA 2K1ZA 1WJLA 1P1EA 2UZCA 1TP5A 3B76A 4GVCA 2EDZA 2KJDA 4Q6SA 2QBWA 2I1NA 4Q2NA 1X5RA 2V90A 3QDOA 1SOTA 3KZDA 1V5LA 2G5MB 2GEFA 3VQGA 2KV8A 2QT5A 1N6EA 5EZ0A 1FCFA 3K50A 3ID3A 2IWOA 1X5QA 2P3WA 2I6VA 1V5QA 3BPUA 2M3MA 4JJ3A 3K82A 1IU2A 3ID1A 3MH6A 4OAJA 3PV4A 4K78A 1N6FA 3SHUA 3R0HA 1KEFA 1TQ3A 2DB5A 4FGMA 4UU6A 1GQ4A 2M10A 4JOKA 5HFBA 5H3JA 1ZOKA 2DLSA 4GVDA 1I92A 4NMVA 5HEYA 2GZVA 2KAWA 5HFCA 3NFKA 2PDZA 4NMPA 2EJYA 2X7ZA 1NTEA 2YUBA 1KY9A 2RCZA 3PDVA 4Q6HA 1UF1A 1N6DA 2FE5A 2DM8A 2LOBA 1TE0A 1UJDA 2PKTA 2OQSA 2M0ZA 4JOEA 2L4SA 3NCVA 1N99A 2HGAA 2H2BA 3OTPA 1QLCA 1V6BA 2EV8A 1UJVA 2KRGA 1WIFA 1IU0A 2JILA 2JWEA 4Q3HA 5DTHA 2EEHA 2IWQA 1W9OA 2DMZA 5HFFA 5HFEA 3TMHA 2EGKA 2KJKA 1MFGA 2EXGA 5F67A 3VQFA 5E6PB 1Y7NA 2JREA 4WYTA 2QG1A 3I4WA 1QAUA 1UFXA 5HEBA 2OCSA 2EEJA 3PDZA 1WI4A 3QJNA 2EEIA 3GABA 1GM1A 4NMOA 1K32A 1WF8A 4L8NA 5FB8C 4NMTA 2PZDA 1Y8TA 1MFLA 4P2AB 2HE4A 3CH8A 4O06A 2YUYA 2CSJA 2OGPA 4NNLA 3DJAA 3ID4A 2AWUA 4IC6A 1X45A 3ZRTA 5E21A 3R69A 4JORA 3MH4A 1X8SA 2F5YA 4KFWA 2LC7A 5F3XA 2VSPA 1WFVA 1B8QA 2YT8A 5ILBA 1X9ZA 2O2TA 2L4TA 4NMSA 1VAEA 3CYYA 1Q3PA 1MC7A 2MX6A 4NXQA 2LC6A 4REYA 5E22A 4MPAA 1UEWA 2DC2A 3TSWA 1L6OA 1Q3OA 1WHDA 2ENOA 1IHJA 4JOGA 3NGHA 3DIWA 2W4FA 4Z8JA 4HOPA 4OEOA 4P0CA 2YTWA 2I0LA 3QO6A 2JXOA 3SFJA 2REYA 2V1WA 4E34A 1XZ9A 4FLNA 3HPKA 4NMQA 2M0TA 1RGRA 1N7EA 4Z33A 1X5NA 2Z9IA 3I18A 5D13A 1WF7A 4K76A 3RLEA 2OSGA 3GDUA 1WG6A 3KZEA 4JJ0A 5E11A 2KA9A 2H3MA 4NMRA 3GDVA 2KQFA 1YBOA 1UEQA 2DLUA 5HF4A 5HFDA 3GGEA 2VSVA 1N7FA 1WH1A 2F0AA 3GCOA 1TP3A 2LUIA 4GHNA 3OU0A 2VPHA 1FC7A 4AMHA 1N7TA 2IWPA 3DJ3A 2YT7A 2KPLA 3STJA 5HDYA 3GCNA 2M0VA 5A2PA 3DJ1A 1QAVB 4JOPA 2Z17A 1R6JA 1UHPA 4E3BA 2KOMA 3FY5A 2DAZA 1U38A 3O46A 1OBXA 4OEPA 5GLJA 1RZXA 4HOPB 3GDSA 3LNYA 4EDJA 3L4FD 2G2LA 3CC0A 1T2MA 2I0IA 2D8IA 4H11A 1NF3C 3CBZA 1RGWA 2KL1A 5HF1A 1VA8A 1KWAA 4WYUA 4JOFA 1PDRA 1VJ6A 1RY4A 2L97A 1X6DA 2ZPMA 5HJ1A 2FN5A 4JOJA 2ZPLA 3KHFA 3MH7A 2AINA 2FCFA 5B42A 5B6LA 2VWRA 2W7RA 2AWWA 5FHTA 4E35A 2PNTA 3SHWA 4K6YA 2EGOA 2EGNA 2OMJA 2KPKA 1FC9A 2M0UA 2K20A 2WL7A 2I04A 4R2ZA 2KOHA 5E1YA
chains in the Genus database with same CATH topology
2KG2A 3LNXA 2OPGA 5IL9A 5HETA 2EAQA 1QAVA 1GQ5A 4K75A 2JINA 1UITA 4N6XA 3PV5A 2IWNA 1U39A 1BE9A 1V62A 2PA1A 3EGHC 3I1EA 1UM7A 4PQWA 4NNMA 2EDVA 3HVQC 1Z86A 4Q2OA 3TSZA 2D92A 5G1DA 3PS4A 3R68A 3GJ9A 4UU5A 2I4SA 2JIKA 1OBYA 3CBYA 2KYLA 3QJMA 2OS6A 1UM1A 1Z87A 3JXTA 2HE2A 2E7KA 2KJPA 3ID2A 3QGLA 1ZUBA 1V1TA 4XHVA 2R3YA 3HPMA 5GNDA 2CS5A 1UJUA 5I7ZA 4K72A 3NFLA 3CS0A 2JSNA 3O5NA 4KFVA 5G1EA 1OBZA 3KDKA 2QKVA 2H2CA 2CSSA 4JL7A 4NXPA 2EDPA 2AWXA 4G69A 3SOEA 1BFEA 3E17A 4RI0A 3DORA 2KOJA 4Q2PA 3SUZA 3KDGA 2PKUA 1M5ZA 2DJTA 3TSVA 2BYGA 3WKLA 5HEDA 4F8KA 4YYXA 3RL7A 4NXRA 2EHRA 1D5GA 1VCWA 4JOHA 3AXAA 1Q7XA 2RRMA 2EEGA 2D90A 2MHOA 3K1RA 3CBXA 1LCYA 2JOAA 2R4HA 2DKRA 1WFGA 2OZFA 1VB7A 1W9QA 1W9EA 5JXBA 2QKTA 4YDPA 3RL8A 1UEZA 1FC6A 4LMMA 3QIKA 2Q9VA 2H3LA 2VZ5A 1U37A 1SOZA 2VRFA 1OZIA 1P1DA 3WKMA 4Q2QA 1WI2A 5EYZA 1UEPA 1WHAA 3EGGC 1I16A 2QKUA 1U3BA 3GSLA 2FNEA 3QE1A 2LA8A 3PV2A 2Q3GA 2KBSA 1G9OA 2K1ZA 1WJLA 1P1EA 2UZCA 1TP5A 3B76A 4GVCA 2EDZA 2KJDA 4Q6SA 2QBWA 2I1NA 4Q2NA 1X5RA 2V90A 3QDOA 1SOTA 3KZDA 1V5LA 2G5MB 2GEFA 3VQGA 2KV8A 2QT5A 1N6EA 5EZ0A 1FCFA 3K50A 3ID3A 2IWOA 1X5QA 2P3WA 2I6VA 1V5QA 3BPUA 2M3MA 4JJ3A 3K82A 1IU2A 3ID1A 3MH6A 4OAJA 3PV4A 4K78A 1N6FA 3SHUA 3R0HA 1KEFA 1TQ3A 2DB5A 4FGMA 4UU6A 1GQ4A 2M10A 4JOKA 5HFBA 5H3JA 1ZOKA 2DLSA 4GVDA 1I92A 4NMVA 5HEYA 2GZVA 2KAWA 5HFCA 3NFKA 2PDZA 4NMPA 2EJYA 2X7ZA 1NTEA 2YUBA 1KY9A 2RCZA 3PDVA 4Q6HA 1UF1A 1N6DA 2FE5A 2DM8A 2LOBA 1TE0A 1UJDA 2PKTA 2OQSA 2M0ZA 4JOEA 2L4SA 3NCVA 1N99A 2HGAA 2H2BA 3OTPA 1QLCA 1V6BA 2EV8A 1UJVA 2KRGA 1WIFA 1IU0A 2JILA 2JWEA 4Q3HA 5DTHA 2EEHA 2IWQA 1W9OA 2DMZA 5HFFA 5HFEA 3TMHA 2EGKA 2KJKA 1MFGA 2EXGA 5F67A 3VQFA 5E6PB 1Y7NA 2JREA 4WYTA 2QG1A 3I4WA 1QAUA 1UFXA 5HEBA 2OCSA 2EEJA 3PDZA 1WI4A 3QJNA 2EEIA 3GABA 1GM1A 4NMOA 1K32A 1WF8A 4L8NA 5FB8C 4NMTA 2PZDA 1Y8TA 1MFLA 4P2AB 2HE4A 3CH8A 4O06A 2YUYA 2CSJA 2OGPA 4NNLA 3DJAA 3ID4A 2AWUA 4IC6A 1X45A 3ZRTA 5E21A 3R69A 4JORA 3MH4A 1X8SA 2F5YA 4KFWA 2LC7A 5F3XA 2VSPA 1WFVA 1B8QA 2YT8A 5ILBA 1X9ZA 2O2TA 2L4TA 4NMSA 1VAEA 3CYYA 1Q3PA 1MC7A 2MX6A 4NXQA 2LC6A 4REYA 5E22A 4MPAA 1UEWA 2DC2A 3TSWA 1L6OA 1Q3OA 1WHDA 2ENOA 1IHJA 4JOGA 3NGHA 3DIWA 2W4FA 4Z8JA 4HOPA 4OEOA 4P0CA 2YTWA 2I0LA 3QO6A 2JXOA 3SFJA 2REYA 2V1WA 4E34A 1XZ9A 4FLNA 3HPKA 4NMQA 2M0TA 1RGRA 1N7EA 4Z33A 1X5NA 2Z9IA 3I18A 5D13A 1WF7A 4K76A 3RLEA 2OSGA 3GDUA 1WG6A 3KZEA 4JJ0A 5E11A 2KA9A 2H3MA 4NMRA 3GDVA 2KQFA 1YBOA 1UEQA 2DLUA 5HF4A 5HFDA 3GGEA 2VSVA 1N7FA 1WH1A 2F0AA 3GCOA 1TP3A 2LUIA 4GHNA 3OU0A 2VPHA 1FC7A 4AMHA 1N7TA 2IWPA 3DJ3A 2YT7A 2KPLA 3STJA 5HDYA 3GCNA 2M0VA 5A2PA 3DJ1A 1QAVB 4JOPA 2Z17A 1R6JA 1UHPA 4E3BA 2KOMA 3FY5A 2DAZA 1U38A 3O46A 1OBXA 4OEPA 5GLJA 1RZXA 4HOPB 3GDSA 3LNYA 4EDJA 3L4FD 2G2LA 3CC0A 1T2MA 2I0IA 2D8IA 4H11A 1NF3C 3CBZA 1RGWA 2KL1A 5HF1A 1VA8A 1KWAA 4WYUA 4JOFA 1PDRA 1VJ6A 1RY4A 2L97A 1X6DA 2ZPMA 5HJ1A 2FN5A 4JOJA 2ZPLA 3KHFA 3MH7A 2AINA 2FCFA 5B42A 5B6LA 2VWRA 2W7RA 2AWWA 5FHTA 4E35A 2PNTA 3SHWA 4K6YA 2EGOA 2EGNA 2OMJA 2KPKA 1FC9A 2M0UA 2K20A 2WL7A 2I04A 4R2ZA 2KOHA 5E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG2 A;  3LNX A;  2OPG A;  5HET A;  2EAQ A;  1QAV A;  1GQ5 A;  4K75 A;  2JIN A;  1UIT A;  4N6X A;  3PV5 A;  2IWN A;  1U39 A;  1BE9 A;  1V62 A;  2PA1 A;  3EGH C;  3I1E A;  1UM7 A;  4PQW A;  4NNM A;  2EDV A;  3HVQ C;  1Z86 A;  4Q2O A;  3TSZ A;  2D92 A;  5G1D A;  3PS4 A;  3R68 A;  3GJ9 A;  4UU5 A;  2I4S A;  2JIK A;  1OBY A;  3CBY A;  2KYL A;  3QJM A;  2OS6 A;  1UM1 A;  1Z87 A;  3JXT A;  2HE2 A;  2E7K A;  2KJP A;  3ID2 A;  3QGL A;  1ZUB A;  1V1T A;  4XHV A;  2R3Y A;  3HPM A;  5GND A;  2CS5 A;  1UJU A;  5I7Z A;  4K72 A;  3NFL A;  3CS0 A;  3O5N A;  4KFV A;  5G1E A;  1OBZ A;  2QKV A;  2H2C A;  2CSS A;  4JL7 A;  4NXP A;  2EDP A;  2AWX A;  4G69 A;  3SOE A;  1BFE A;  3E17 A;  4RI0 A;  3DOR A;  2KOJ A;  4Q2P A;  3SUZ A;  2PKU A;  1M5Z A;  2DJT A;  3TSV A;  2BYG A;  3WKL A;  5HED A;  4F8K A;  4YYX A;  3RL7 A;  4NXR A;  2EHR A;  1D5G A;  1VCW A;  4JOH A;  3AXA A;  1Q7X A;  2RRM A;  2EEG A;  2D90 A;  2MHO A;  3K1R A;  3CBX A;  1LCY A;  2JOA A;  2R4H A;  2DKR A;  1WFG A;  2OZF A;  1VB7 A;  1W9Q A;  1W9E A;  5JXB A;  2QKT A;  4YDP A;  3RL8 A;  1UEZ A;  1FC6 A;  4LMM A;  3QIK A;  2Q9V A;  2H3L A;  2VZ5 A;  1U37 A;  1SOZ A;  2VRF A;  1OZI A;  1P1D A;  3WKM A;  4Q2Q A;  1WI2 A;  5EYZ A;  1UEP A;  1WHA A;  3EGG C;  1I16 A;  2QKU A;  1U3B A;  3GSL A;  2FNE A;  3QE1 A;  2LA8 A;  3PV2 A;  2Q3G A;  2KBS A;  1G9O A;  2K1Z A;  1WJL A;  1P1E A;  2UZC A;  1TP5 A;  3B76 A;  4GVC A;  2EDZ A;  2KJD A;  4Q6S A;  2QBW A;  2I1N A;  4Q2N A;  1X5R A;  2V90 A;  3QDO A;  1SOT A;  3KZD A;  1V5L A;  2G5M B;  3VQG A;  2KV8 A;  2QT5 A;  1N6E A;  5EZ0 A;  1FCF A;  3K50 A;  3ID3 A;  2IWO A;  1X5Q A;  2P3W A;  2I6V A;  1V5Q A;  3BPU A;  2M3M A;  3K82 A;  1IU2 A;  3ID1 A;  3MH6 A;  4OAJ A;  3PV4 A;  4K78 A;  1N6F A;  3SHU A;  3R0H A;  1KEF A;  1TQ3 A;  2DB5 A;  4FGM A;  4UU6 A;  1GQ4 A;  2M10 A;  4JOK A;  5HFB A;  5H3J A;  1ZOK A;  2DLS A;  4GVD A;  1I92 A;  4NMV A;  5HEY A;  2GZV A;  2KAW A;  5HFC A;  3NFK A;  2PDZ A;  4NMP A;  2EJY A;  2X7Z A;  1NTE A;  2YUB A;  1KY9 A;  2RCZ A;  3PDV A;  4Q6H A;  1UF1 A;  1N6D A;  2FE5 A;  2DM8 A;  2LOB A;  1TE0 A;  1UJD A;  2PKT A;  2OQS A;  2M0Z A;  4JOE A;  2L4S A;  1N99 A;  2HGA A;  2H2B A;  3OTP A;  1QLC A;  1V6B A;  2EV8 A;  1UJV A;  2KRG A;  1WIF A;  1IU0 A;  2JIL A;  2JWE A;  4Q3H A;  5DTH A;  2EEH A;  2IWQ A;  1W9O A;  2DMZ A;  5HFF A;  5HFE A;  3TMH A;  2EGK A;  2KJK A;  1MFG A;  2EXG A;  5F67 A;  3VQF A;  5E6P B;  1Y7N A;  2JRE A;  4WYT A;  2QG1 A;  3I4W A;  1QAU A;  1UFX A;  5HEB A;  2OCS A;  2EEJ A;  3PDZ A;  1WI4 A;  3QJN A;  2EEI A;  1GM1 A;  4NMO A;  1K32 A;  1WF8 A;  4L8N A;  5FB8 C;  4NMT A;  2PZD A;  1Y8T A;  1MFL A;  4P2A B;  2HE4 A;  3CH8 A;  4O06 A;  2YUY A;  2CSJ A;  2OGP A;  4NNL A;  3DJA A;  3ID4 A;  2AWU A;  4IC6 A;  1X45 A;  3ZRT A;  5E21 A;  3R69 A;  4JOR A;  3MH4 A;  1X8S A;  2F5Y A;  4KFW A;  2LC7 A;  5F3X A;  2VSP A;  1WFV A;  1B8Q A;  2YT8 A;  2O2T A;  2L4T A;  4NMS A;  1VAE A;  3CYY A;  1Q3P A;  1MC7 A;  2MX6 A;  4NXQ A;  2LC6 A;  4REY A;  5E22 A;  4MPA A;  1UEW A;  2DC2 A;  3TSW A;  1L6O A;  1Q3O A;  1WHD A;  2ENO A;  1IHJ A;  4JOG A;  3NGH A;  3DIW A;  2W4F A;  4Z8J A;  4HOP A;  4OEO A;  4P0C A;  2YTW A;  2I0L A;  3QO6 A;  2JXO A;  3SFJ A;  2REY A;  2V1W A;  4E34 A;  1XZ9 A;  3HPK A;  4NMQ A;  2M0T A;  1RGR A;  1N7E A;  4Z33 A;  1X5N A;  2Z9I A;  3I18 A;  5D13 A;  1WF7 A;  4K76 A;  3RLE A;  2OSG A;  3GDU A;  1WG6 A;  3KZE A;  5E11 A;  2KA9 A;  2H3M A;  4NMR A;  3GDV A;  2KQF A;  1YBO A;  1UEQ A;  2DLU A;  5HF4 A;  5HFD A;  3GGE A;  2VSV A;  1N7F A;  1WH1 A;  2F0A A;  3GCO A;  1TP3 A;  2LUI A;  4GHN A;  3OU0 A;  2VPH A;  1FC7 A;  4AMH A;  1N7T A;  2IWP A;  3DJ3 A;  2YT7 A;  2KPL A;  3STJ A;  5HDY A;  3GCN A;  2M0V A;  5A2P A;  3DJ1 A;  1QAV B;  4JOP A;  2Z17 A;  1R6J A;  1UHP A;  4E3B A;  2KOM A;  3FY5 A;  2DAZ A;  1U38 A;  3O46 A;  1OBX A;  4OEP A;  5GLJ A;  1RZX A;  4HOP B;  3GDS A;  3LNY A;  4EDJ A;  3L4F D;  2G2L A;  3CC0 A;  1T2M A;  2I0I A;  2D8I A;  4H11 A;  1NF3 C;  3CBZ A;  1RGW A;  2KL1 A;  5HF1 A;  1VA8 A;  1KWA A;  4WYU A;  4JOF A;  1PDR A;  1VJ6 A;  1RY4 A;  2L97 A;  1X6D A;  2ZPM A;  5HJ1 A;  2FN5 A;  4JOJ A;  2ZPL A;  3KHF A;  3MH7 A;  2AIN A;  2FCF A;  5B6L A;  2VWR A;  2W7R A;  2AWW A;  5FHT A;  4E35 A;  2PNT A;  3SHW A;  4K6Y A;  2EGO A;  2EGN A;  2OMJ A;  2KPK A;  1FC9 A;  2M0U A;  2K20 A;  2WL7 A;  2I04 A;  4R2Z A;  2KOH A;  5E1Y A; 
#chains in the Genus database with same CATH topology
 2KG2 A;  3LNX A;  2OPG A;  5IL9 A;  5HET A;  2EAQ A;  1QAV A;  1GQ5 A;  4K75 A;  2JIN A;  1UIT A;  4N6X A;  3PV5 A;  2IWN A;  1U39 A;  1BE9 A;  1V62 A;  2PA1 A;  3EGH C;  3I1E A;  1UM7 A;  4PQW A;  4NNM A;  2EDV A;  3HVQ C;  1Z86 A;  4Q2O A;  3TSZ A;  2D92 A;  5G1D A;  3PS4 A;  3R68 A;  3GJ9 A;  4UU5 A;  2I4S A;  2JIK A;  1OBY A;  3CBY A;  2KYL A;  3QJM A;  2OS6 A;  1UM1 A;  1Z87 A;  3JXT A;  2HE2 A;  2E7K A;  2KJP A;  3ID2 A;  3QGL A;  1ZUB A;  1V1T A;  4XHV A;  2R3Y A;  3HPM A;  5GND A;  2CS5 A;  1UJU A;  5I7Z A;  4K72 A;  3NFL A;  3CS0 A;  2JSN A;  3O5N A;  4KFV A;  5G1E A;  1OBZ A;  3KDK A;  2QKV A;  2H2C A;  2CSS A;  4JL7 A;  4NXP A;  2EDP A;  2AWX A;  4G69 A;  3SOE A;  1BFE A;  3E17 A;  4RI0 A;  3DOR A;  2KOJ A;  4Q2P A;  3SUZ A;  3KDG A;  2PKU A;  1M5Z A;  2DJT A;  3TSV A;  2BYG A;  3WKL A;  5HED A;  4F8K A;  4YYX A;  3RL7 A;  4NXR A;  2EHR A;  1D5G A;  1VCW A;  4JOH A;  3AXA A;  1Q7X A;  2RRM A;  2EEG A;  2D90 A;  2MHO A;  3K1R A;  3CBX A;  1LCY A;  2JOA A;  2R4H A;  2DKR A;  1WFG A;  2OZF A;  1VB7 A;  1W9Q A;  1W9E A;  5JXB A;  2QKT A;  4YDP A;  3RL8 A;  1UEZ A;  1FC6 A;  4LMM A;  3QIK A;  2Q9V A;  2H3L A;  2VZ5 A;  1U37 A;  1SOZ A;  2VRF A;  1OZI A;  1P1D A;  3WKM A;  4Q2Q A;  1WI2 A;  5EYZ A;  1UEP A;  1WHA A;  3EGG C;  1I16 A;  2QKU A;  1U3B A;  3GSL A;  2FNE A;  3QE1 A;  2LA8 A;  3PV2 A;  2Q3G A;  2KBS A;  1G9O A;  2K1Z A;  1WJL A;  1P1E A;  2UZC A;  1TP5 A;  3B76 A;  4GVC A;  2EDZ A;  2KJD A;  4Q6S A;  2QBW A;  2I1N A;  4Q2N A;  1X5R A;  2V90 A;  3QDO A;  1SOT A;  3KZD A;  1V5L A;  2G5M B;  2GEF A;  3VQG A;  2KV8 A;  2QT5 A;  1N6E A;  5EZ0 A;  1FCF A;  3K50 A;  3ID3 A;  2IWO A;  1X5Q A;  2P3W A;  2I6V A;  1V5Q A;  3BPU A;  2M3M A;  4JJ3 A;  3K82 A;  1IU2 A;  3ID1 A;  3MH6 A;  4OAJ A;  3PV4 A;  4K78 A;  1N6F A;  3SHU A;  3R0H A;  1KEF A;  1TQ3 A;  2DB5 A;  4FGM A;  4UU6 A;  1GQ4 A;  2M10 A;  4JOK A;  5HFB A;  5H3J A;  1ZOK A;  2DLS A;  4GVD A;  1I92 A;  4NMV A;  5HEY A;  2GZV A;  2KAW A;  5HFC A;  3NFK A;  2PDZ A;  4NMP A;  2EJY A;  2X7Z A;  1NTE A;  2YUB A;  1KY9 A;  2RCZ A;  3PDV A;  4Q6H A;  1UF1 A;  1N6D A;  2FE5 A;  2DM8 A;  2LOB A;  1TE0 A;  1UJD A;  2PKT A;  2OQS A;  2M0Z A;  4JOE A;  2L4S A;  3NCV A;  1N99 A;  2HGA A;  2H2B A;  3OTP A;  1QLC A;  1V6B A;  2EV8 A;  1UJV A;  2KRG A;  1WIF A;  1IU0 A;  2JIL A;  2JWE A;  4Q3H A;  5DTH A;  2EEH A;  2IWQ A;  1W9O A;  2DMZ A;  5HFF A;  5HFE A;  3TMH A;  2EGK A;  2KJK A;  1MFG A;  2EXG A;  5F67 A;  3VQF A;  5E6P B;  1Y7N A;  2JRE A;  4WYT A;  2QG1 A;  3I4W A;  1QAU A;  1UFX A;  5HEB A;  2OCS A;  2EEJ A;  3PDZ A;  1WI4 A;  3QJN A;  2EEI A;  3GAB A;  1GM1 A;  4NMO A;  1K32 A;  1WF8 A;  4L8N A;  5FB8 C;  4NMT A;  2PZD A;  1Y8T A;  1MFL A;  4P2A B;  2HE4 A;  3CH8 A;  4O06 A;  2YUY A;  2CSJ A;  2OGP A;  4NNL A;  3DJA A;  3ID4 A;  2AWU A;  4IC6 A;  1X45 A;  3ZRT A;  5E21 A;  3R69 A;  4JOR A;  3MH4 A;  1X8S A;  2F5Y A;  4KFW A;  2LC7 A;  5F3X A;  2VSP A;  1WFV A;  1B8Q A;  2YT8 A;  5ILB A;  1X9Z A;  2O2T A;  2L4T A;  4NMS A;  1VAE A;  3CYY A;  1Q3P A;  1MC7 A;  2MX6 A;  4NXQ A;  2LC6 A;  4REY A;  5E22 A;  4MPA A;  1UEW A;  2DC2 A;  3TSW A;  1L6O A;  1Q3O A;  1WHD A;  2ENO A;  1IHJ A;  4JOG A;  3NGH A;  3DIW A;  2W4F A;  4Z8J A;  4HOP A;  4OEO A;  4P0C A;  2YTW A;  2I0L A;  3QO6 A;  2JXO A;  3SFJ A;  2REY A;  2V1W A;  4E34 A;  1XZ9 A;  4FLN A;  3HPK A;  4NMQ A;  2M0T A;  1RGR A;  1N7E A;  4Z33 A;  1X5N A;  2Z9I A;  3I18 A;  5D13 A;  1WF7 A;  4K76 A;  3RLE A;  2OSG A;  3GDU A;  1WG6 A;  3KZE A;  4JJ0 A;  5E11 A;  2KA9 A;  2H3M A;  4NMR A;  3GDV A;  2KQF A;  1YBO A;  1UEQ A;  2DLU A;  5HF4 A;  5HFD A;  3GGE A;  2VSV A;  1N7F A;  1WH1 A;  2F0A A;  3GCO A;  1TP3 A;  2LUI A;  4GHN A;  3OU0 A;  2VPH A;  1FC7 A;  4AMH A;  1N7T A;  2IWP A;  3DJ3 A;  2YT7 A;  2KPL A;  3STJ A;  5HDY A;  3GCN A;  2M0V A;  5A2P A;  3DJ1 A;  1QAV B;  4JOP A;  2Z17 A;  1R6J A;  1UHP A;  4E3B A;  2KOM A;  3FY5 A;  2DAZ A;  1U38 A;  3O46 A;  1OBX A;  4OEP A;  5GLJ A;  1RZX A;  4HOP B;  3GDS A;  3LNY A;  4EDJ A;  3L4F D;  2G2L A;  3CC0 A;  1T2M A;  2I0I A;  2D8I A;  4H11 A;  1NF3 C;  3CBZ A;  1RGW A;  2KL1 A;  5HF1 A;  1VA8 A;  1KWA A;  4WYU A;  4JOF A;  1PDR A;  1VJ6 A;  1RY4 A;  2L97 A;  1X6D A;  2ZPM A;  5HJ1 A;  2FN5 A;  4JOJ A;  2ZPL A;  3KHF A;  3MH7 A;  2AIN A;  2FCF A;  5B42 A;  5B6L A;  2VWR A;  2W7R A;  2AWW A;  5FHT A;  4E35 A;  2PNT A;  3SHW A;  4K6Y A;  2EGO A;  2EGN A;  2OMJ A;  2KPK A;  1FC9 A;  2M0U A;  2K20 A;  2WL7 A;  2I04 A;  4R2Z A;  2KOH A;  5E1Y A; 
#chains in the Genus database with same CATH homology
 2KG2 A;  3LNX A;  2OPG A;  5IL9 A;  5HET A;  2EAQ A;  1QAV A;  1GQ5 A;  4K75 A;  2JIN A;  1UIT A;  4N6X A;  3PV5 A;  2IWN A;  1U39 A;  1BE9 A;  1V62 A;  2PA1 A;  3EGH C;  3I1E A;  1UM7 A;  4PQW A;  4NNM A;  2EDV A;  3HVQ C;  1Z86 A;  4Q2O A;  3TSZ A;  2D92 A;  5G1D A;  3PS4 A;  3R68 A;  3GJ9 A;  4UU5 A;  2I4S A;  2JIK A;  1OBY A;  3CBY A;  2KYL A;  3QJM A;  2OS6 A;  1UM1 A;  1Z87 A;  3JXT A;  2HE2 A;  2E7K A;  2KJP A;  3ID2 A;  3QGL A;  1ZUB A;  1V1T A;  4XHV A;  2R3Y A;  3HPM A;  5GND A;  2CS5 A;  1UJU A;  5I7Z A;  4K72 A;  3NFL A;  3CS0 A;  2JSN A;  3O5N A;  4KFV A;  5G1E A;  1OBZ A;  3KDK A;  2QKV A;  2H2C A;  2CSS A;  4JL7 A;  4NXP A;  2EDP A;  2AWX A;  4G69 A;  3SOE A;  1BFE A;  3E17 A;  4RI0 A;  3DOR A;  2KOJ A;  4Q2P A;  3SUZ A;  3KDG A;  2PKU A;  1M5Z A;  2DJT A;  3TSV A;  2BYG A;  3WKL A;  5HED A;  4F8K A;  4YYX A;  3RL7 A;  4NXR A;  2EHR A;  1D5G A;  1VCW A;  4JOH A;  3AXA A;  1Q7X A;  2RRM A;  2EEG A;  2D90 A;  2MHO A;  3K1R A;  3CBX A;  1LCY A;  2JOA A;  2R4H A;  2DKR A;  1WFG A;  2OZF A;  1VB7 A;  1W9Q A;  1W9E A;  5JXB A;  2QKT A;  4YDP A;  3RL8 A;  1UEZ A;  1FC6 A;  4LMM A;  3QIK A;  2Q9V A;  2H3L A;  2VZ5 A;  1U37 A;  1SOZ A;  2VRF A;  1OZI A;  1P1D A;  3WKM A;  4Q2Q A;  1WI2 A;  5EYZ A;  1UEP A;  1WHA A;  3EGG C;  1I16 A;  2QKU A;  1U3B A;  3GSL A;  2FNE A;  3QE1 A;  2LA8 A;  3PV2 A;  2Q3G A;  2KBS A;  1G9O A;  2K1Z A;  1WJL A;  1P1E A;  2UZC A;  1TP5 A;  3B76 A;  4GVC A;  2EDZ A;  2KJD A;  4Q6S A;  2QBW A;  2I1N A;  4Q2N A;  1X5R A;  2V90 A;  3QDO A;  1SOT A;  3KZD A;  1V5L A;  2G5M B;  2GEF A;  3VQG A;  2KV8 A;  2QT5 A;  1N6E A;  5EZ0 A;  1FCF A;  3K50 A;  3ID3 A;  2IWO A;  1X5Q A;  2P3W A;  2I6V A;  1V5Q A;  3BPU A;  2M3M A;  4JJ3 A;  3K82 A;  1IU2 A;  3ID1 A;  3MH6 A;  4OAJ A;  3PV4 A;  4K78 A;  1N6F A;  3SHU A;  3R0H A;  1KEF A;  1TQ3 A;  2DB5 A;  4FGM A;  4UU6 A;  1GQ4 A;  2M10 A;  4JOK A;  5HFB A;  5H3J A;  1ZOK A;  2DLS A;  4GVD A;  1I92 A;  4NMV A;  5HEY A;  2GZV A;  2KAW A;  5HFC A;  3NFK A;  2PDZ A;  4NMP A;  2EJY A;  2X7Z A;  1NTE A;  2YUB A;  1KY9 A;  2RCZ A;  3PDV A;  4Q6H A;  1UF1 A;  1N6D A;  2FE5 A;  2DM8 A;  2LOB A;  1TE0 A;  1UJD A;  2PKT A;  2OQS A;  2M0Z A;  4JOE A;  2L4S A;  3NCV A;  1N99 A;  2HGA A;  2H2B A;  3OTP A;  1QLC A;  1V6B A;  2EV8 A;  1UJV A;  2KRG A;  1WIF A;  1IU0 A;  2JIL A;  2JWE A;  4Q3H A;  5DTH A;  2EEH A;  2IWQ A;  1W9O A;  2DMZ A;  5HFF A;  5HFE A;  3TMH A;  2EGK A;  2KJK A;  1MFG A;  2EXG A;  5F67 A;  3VQF A;  5E6P B;  1Y7N A;  2JRE A;  4WYT A;  2QG1 A;  3I4W A;  1QAU A;  1UFX A;  5HEB A;  2OCS A;  2EEJ A;  3PDZ A;  1WI4 A;  3QJN A;  2EEI A;  3GAB A;  1GM1 A;  4NMO A;  1K32 A;  1WF8 A;  4L8N A;  5FB8 C;  4NMT A;  2PZD A;  1Y8T A;  1MFL A;  4P2A B;  2HE4 A;  3CH8 A;  4O06 A;  2YUY A;  2CSJ A;  2OGP A;  4NNL A;  3DJA A;  3ID4 A;  2AWU A;  4IC6 A;  1X45 A;  3ZRT A;  5E21 A;  3R69 A;  4JOR A;  3MH4 A;  1X8S A;  2F5Y A;  4KFW A;  2LC7 A;  5F3X A;  2VSP A;  1WFV A;  1B8Q A;  2YT8 A;  5ILB A;  1X9Z A;  2O2T A;  2L4T A;  4NMS A;  1VAE A;  3CYY A;  1Q3P A;  1MC7 A;  2MX6 A;  4NXQ A;  2LC6 A;  4REY A;  5E22 A;  4MPA A;  1UEW A;  2DC2 A;  3TSW A;  1L6O A;  1Q3O A;  1WHD A;  2ENO A;  1IHJ A;  4JOG A;  3NGH A;  3DIW A;  2W4F A;  4Z8J A;  4HOP A;  4OEO A;  4P0C A;  2YTW A;  2I0L A;  3QO6 A;  2JXO A;  3SFJ A;  2REY A;  2V1W A;  4E34 A;  1XZ9 A;  4FLN A;  3HPK A;  4NMQ A;  2M0T A;  1RGR A;  1N7E A;  4Z33 A;  1X5N A;  2Z9I A;  3I18 A;  5D13 A;  1WF7 A;  4K76 A;  3RLE A;  2OSG A;  3GDU A;  1WG6 A;  3KZE A;  4JJ0 A;  5E11 A;  2KA9 A;  2H3M A;  4NMR A;  3GDV A;  2KQF A;  1YBO A;  1UEQ A;  2DLU A;  5HF4 A;  5HFD A;  3GGE A;  2VSV A;  1N7F A;  1WH1 A;  2F0A A;  3GCO A;  1TP3 A;  2LUI A;  4GHN A;  3OU0 A;  2VPH A;  1FC7 A;  4AMH A;  1N7T A;  2IWP A;  3DJ3 A;  2YT7 A;  2KPL A;  3STJ A;  5HDY A;  3GCN A;  2M0V A;  5A2P A;  3DJ1 A;  1QAV B;  4JOP A;  2Z17 A;  1R6J A;  1UHP A;  4E3B A;  2KOM A;  3FY5 A;  2DAZ A;  1U38 A;  3O46 A;  1OBX A;  4OEP A;  5GLJ A;  1RZX A;  4HOP B;  3GDS A;  3LNY A;  4EDJ A;  3L4F D;  2G2L A;  3CC0 A;  1T2M A;  2I0I A;  2D8I A;  4H11 A;  1NF3 C;  3CBZ A;  1RGW A;  2KL1 A;  5HF1 A;  1VA8 A;  1KWA A;  4WYU A;  4JOF A;  1PDR A;  1VJ6 A;  1RY4 A;  2L97 A;  1X6D A;  2ZPM A;  5HJ1 A;  2FN5 A;  4JOJ A;  2ZPL A;  3KHF A;  3MH7 A;  2AIN A;  2FCF A;  5B42 A;  5B6L A;  2VWR A;  2W7R A;  2AWW A;  5FHT A;  4E35 A;  2PNT A;  3SHW A;  4K6Y A;  2EGO A;  2EGN A;  2OMJ A;  2KPK A;  1FC9 A;  2M0U A;  2K20 A;  2WL7 A;  2I04 A;  4R2Z A;  2KOH A;  5E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...