1UJDA

Solution structure of rsgi ruh-003, a pdz domain of hypothetical kiaa0559 protein from human cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
117
structure length
117
Chain Sequence
GSSGSSGHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRLDLNMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0559 protein
publication title Solution Structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 9
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ujdA00
1UEZA 1N7FA 3QJNA 2EDPA 1X8SA 2KA9A 1WH1A 4NMOA 1T2MA 1U3BA 4E35A 4UU6A 2Z17A 5A2PA 3TSWA 3GSLA 2DAZA 2MHOA 4NMQA 1GM1A 1V6BA 2F5YA 2R4HA 2OSGA 3SHWA 3WKMA 2IWQA 1UM7A 1UF1A 5EZ0A 2CSSA 3QJMA 2VWRA 3QO6A 1N6DA 2EDVA 2KOMA 5I7ZA 3L4FD 5D13A 3PV4A 4FGMA 5E21A 1G9OA 5EYZA 2EGOA 3SHUA 3WKLA 4EDJA 1I92A 5E11A 4PQWA 2RCZA 2QKUA 3R68A 4P0CA 1X6DA 2KG2A 3GCOA 2E7KA 4GVDA 1M5ZA 3ID3A 3DJAA 2PDZA 1OBXA 3PV2A 5H3JA 3TSZA 2EEGA 2DC2A 2KPLA 1XZ9A 5HFBA 5HJ1A 5HFEA 4Q2OA 4NXRA 4OEOA 1N6FA 1KWAA 1OBYA 2QT5A 1K32A 5G1EA 1VJ6A 2W7RA 2Q3GA 2H2CA 4Q6HA 2PKUA 1WI4A 3PDVA 4K72A 2EGNA 2QBWA 1FC7A 1Z86A 3GJ9A 1QAVB 1N99A 1GQ4A 5HF4A 1YBOA 3QDOA 2VSVA 4G69A 1RGRA 5FB8C 3ZRTA 3PDZA 2D8IA 3DJ3A 1V5QA 1U39A 2CSJA 3MH6A 3CBYA 2H2BA 4NMRA 1WFGA 1VCWA 4F8KA 2PZDA 4JOJA 1OZIA 5F67A 5G1DA 2RRMA 1WIFA 2I1NA 3OTPA 3SUZA 1KY9A 3B76A 2KYLA 2YT7A 2EJYA 3QIKA 2P3WA 1Z87A 2AWXA 2M3MA 4JOPA 4HOPB 2LA8A 2JIKA 3NFKA 2OZFA 3I18A 2K1ZA 2IWNA 3O46A 2DKRA 4JOHA 3LNYA 1N7EA 2M10A 2DMZA 3QGLA 3I1EA 4E34A 3CBZA 2YUYA 3DORA 2M0TA 4YYXA 4NXQA 3TSVA 1KEFA 1W9EA 3NFLA 3ID2A 1WFVA 3MH7A 2DJTA 1NTEA 4IC6A 2KOJA 4H11A 2PKTA 4Q2NA 3VQFA 2JREA 1Q7XA 1PDRA 2CS5A 1P1DA 5HFFA 3JXTA 4WYUA 2JINA 1GQ5A 4KFWA 2I04A 1V1TA 3NGHA 5FHTA 4JL7A 1MFGA 1BE9A 1V62A 2EGKA 2MX6A 2H3LA 2LC7A 2HE2A 1WHAA 1B8QA 1QLCA 1FCFA 4E3BA 1P1EA 3CBXA 2K20A 4KFVA 4Q6SA 3I4WA 3DJ1A 2EDZA 3HPMA 3BPUA 4UU5A 2EAQA 1UJDA 4R2ZA 2D92A 2EEIA 2VSPA 1OBZA 1ZUBA 3GDVA 3PV5A 5HEDA 5B6LA 5E22A 2QKTA 1MC7A 2PNTA 4JORA 1RY4A 2OCSA 2M0ZA 1Q3PA 2QKVA 2EEJA 2VPHA 1SOZA 5HDYA 4RI0A 2OQSA 2OMJA 1D5GA 2KRGA 4O06A 5E6PB 2BYGA 2DLUA 2ENOA 1UM1A 3SOEA 3FY5A 2HE4A 4K75A 4NXPA 2OS6A 4NMTA 1VB7A 4JOKA 1WHDA 3PS4A 1SOTA 1WF8A 1LCYA 3SFJA 2FE5A 2I4SA 2JWEA 4YDPA 2I6VA 1U37A 5HFCA 4Q3HA 3CS0A 2YTWA 4Z33A 3R0HA 1R6JA 1UJVA 4GHNA 3K82A 4XHVA 1U38A 3DIWA 1V5LA 2FCFA 5E1YA 1UJUA 2L97A 3CH8A 2EV8A 2FNEA 3EGGC 1IHJA 1TQ3A 2REYA 2LC6A 4NNLA 2I0IA 2GZVA 2D90A 1W9QA 1N7TA 2DM8A 4NMVA 4OEPA 2KJDA 2JXOA 2EXGA 2EHRA 2G5MB 4GVCA 1RZXA 4Q2PA 1IU2A 5HFDA 1L6OA 1QAVA 4K6YA 2Z9IA 1X45A 2X7ZA 2OPGA 2VRFA 3RL8A 3LNXA 2O2TA 4P2AB 3K1RA 1UFXA 3VQGA 2UZCA 2KAWA 5DTHA 1NF3C 5HF1A 1I16A 2AWUA 4N6XA 2WL7A 2PA1A 4JOGA 3MH4A 2V90A 1VA8A 2KQFA 4MPAA 2IWPA 3KZDA 2EEHA 4JOFA 2LOBA 2KPKA 2V1WA 4LMMA 3RLEA 3O5NA 2Q9VA 3KZEA 2VZ5A 1UEWA 3GDUA 2H3MA 4Q2QA 4JOEA 1N6EA 3GGEA 4WYTA 1VAEA 1IU0A 5F3XA 1BFEA 4HOPA 2YT8A 2G2LA 2KV8A 2ZPLA 2JOAA 2R3YA 1FC9A 4K78A 1WJLA 3AXAA 3CC0A 3ID4A 3QE1A 4K76A 2LUIA 2I0LA 3ID1A 4Z8JA 3EGHC 1FC6A 3GDSA 1UITA 5JXBA 3HPKA 1X5NA 3STJA 3OU0A 2FN5A 1QAUA 2L4TA 2OGPA 3CYYA 1Y8TA 3E17A 1RGWA 1ZOKA 3HVQC 1UHPA 2DLSA 5HETA 2ZPMA 3K50A 4L8NA 2KJPA 2AINA 5HEYA 4REYA 4NNMA 1TP3A 2QG1A 4OAJA 1X5RA 2W4FA 1X5QA 1MFLA 5GLJA 5HEBA 2KOHA 2KL1A 2KJKA 1W9OA 2M0UA 5GNDA 3TMHA 3R69A 1TE0A 1Y7NA 4NMSA 2DB5A 2IWOA 2M0VA 2L4SA 3RL7A 4NMPA 1WI2A 3GCNA 1WF7A 1UEPA 2AWWA 1UEQA 1WG6A 1TP5A 1Q3OA 3KHFA 2JILA 2HGAA 2KBSA 4AMHA 2YUBA 2F0AA
chains in the Genus database with same CATH superfamily
1UEZA 1N7FA 3QJNA 2EDPA 1X8SA 2KA9A 1WH1A 4NMOA 1T2MA 1U3BA 4E35A 4UU6A 2Z17A 5A2PA 3KDGA 3TSWA 3GSLA 2DAZA 2MHOA 4NMQA 1GM1A 1V6BA 2F5YA 2R4HA 2OSGA 3SHWA 3WKMA 2IWQA 1UM7A 1UF1A 5EZ0A 2CSSA 3QJMA 2VWRA 3QO6A 1N6DA 2EDVA 2KOMA 5I7ZA 3L4FD 5D13A 3PV4A 4FGMA 5E21A 1G9OA 5EYZA 2EGOA 3SHUA 3WKLA 4EDJA 1I92A 5E11A 4PQWA 2RCZA 2QKUA 3R68A 4P0CA 5IL9A 1X6DA 2KG2A 3GCOA 2E7KA 4GVDA 1M5ZA 3ID3A 3DJAA 2PDZA 1OBXA 3PV2A 5H3JA 3TSZA 2EEGA 2DC2A 2KPLA 1XZ9A 5HFBA 5HJ1A 2GEFA 5HFEA 4Q2OA 4NXRA 4OEOA 1N6FA 1KWAA 1OBYA 2QT5A 1K32A 5G1EA 1VJ6A 2W7RA 2Q3GA 2H2CA 4Q6HA 2PKUA 1WI4A 3PDVA 4K72A 2EGNA 2QBWA 1FC7A 5B42A 1Z86A 3GJ9A 1QAVB 1N99A 1GQ4A 5HF4A 1YBOA 3QDOA 2VSVA 4G69A 1RGRA 5FB8C 3ZRTA 3PDZA 2D8IA 3DJ3A 1V5QA 1U39A 2CSJA 3MH6A 3CBYA 2H2BA 4NMRA 4FLNA 1WFGA 1VCWA 4F8KA 2PZDA 4JOJA 1OZIA 5F67A 5G1DA 2RRMA 1WIFA 2I1NA 3OTPA 3SUZA 1KY9A 3B76A 2KYLA 2YT7A 2EJYA 3QIKA 2P3WA 1Z87A 2AWXA 2M3MA 4JOPA 4HOPB 2LA8A 2JIKA 3NFKA 3GABA 2OZFA 3I18A 2K1ZA 2IWNA 3O46A 2DKRA 4JOHA 3LNYA 1N7EA 2M10A 2DMZA 3QGLA 3I1EA 4E34A 3CBZA 2YUYA 3DORA 5ILBA 2M0TA 4YYXA 4NXQA 3TSVA 1KEFA 1W9EA 3NFLA 3ID2A 1WFVA 3MH7A 2DJTA 1NTEA 4IC6A 2KOJA 4H11A 2PKTA 4Q2NA 3VQFA 2JREA 1Q7XA 1PDRA 2CS5A 1P1DA 5HFFA 3JXTA 4WYUA 2JINA 1GQ5A 4KFWA 2I04A 1V1TA 3NGHA 5FHTA 4JL7A 1MFGA 1BE9A 1V62A 2EGKA 2MX6A 2H3LA 2LC7A 2HE2A 1WHAA 1B8QA 1QLCA 1FCFA 4E3BA 1P1EA 3CBXA 2K20A 4KFVA 4Q6SA 3I4WA 3DJ1A 2EDZA 3HPMA 3BPUA 4UU5A 2EAQA 1UJDA 4R2ZA 2D92A 2EEIA 2VSPA 1OBZA 1ZUBA 3GDVA 3PV5A 5HEDA 5B6LA 5E22A 2QKTA 1MC7A 2PNTA 4JORA 1RY4A 2OCSA 2M0ZA 1Q3PA 2QKVA 2EEJA 2VPHA 1SOZA 5HDYA 4RI0A 2OQSA 2OMJA 1D5GA 2KRGA 4O06A 5E6PB 2BYGA 2DLUA 2ENOA 1UM1A 3SOEA 3FY5A 2HE4A 4K75A 4NXPA 2OS6A 4NMTA 1VB7A 4JOKA 1WHDA 3PS4A 1SOTA 1WF8A 1LCYA 3SFJA 2FE5A 2I4SA 2JWEA 4YDPA 2I6VA 1U37A 5HFCA 4Q3HA 3CS0A 2YTWA 4Z33A 3R0HA 1R6JA 1UJVA 4GHNA 3K82A 4XHVA 1U38A 3DIWA 1V5LA 1X9ZA 2FCFA 5E1YA 1UJUA 2L97A 3CH8A 2EV8A 2FNEA 3EGGC 1IHJA 1TQ3A 2REYA 2LC6A 4NNLA 2I0IA 2GZVA 2D90A 1W9QA 1N7TA 2DM8A 4NMVA 4OEPA 2KJDA 2JXOA 2EXGA 2EHRA 2G5MB 4GVCA 1RZXA 4Q2PA 1IU2A 5HFDA 1L6OA 1QAVA 4K6YA 2Z9IA 1X45A 2X7ZA 2OPGA 2VRFA 3RL8A 3LNXA 2O2TA 4P2AB 3K1RA 1UFXA 3VQGA 2UZCA 2KAWA 5DTHA 1NF3C 5HF1A 2JSNA 1I16A 2AWUA 4N6XA 2WL7A 2PA1A 4JOGA 3MH4A 2V90A 1VA8A 2KQFA 4MPAA 2IWPA 3KZDA 2EEHA 4JOFA 2LOBA 2KPKA 2V1WA 4LMMA 3RLEA 3O5NA 2Q9VA 3KZEA 2VZ5A 1UEWA 3GDUA 2H3MA 4Q2QA 4JOEA 1N6EA 3GGEA 4WYTA 1VAEA 1IU0A 5F3XA 1BFEA 4HOPA 2YT8A 2G2LA 2KV8A 2ZPLA 2JOAA 2R3YA 1FC9A 4K78A 1WJLA 3AXAA 3CC0A 3ID4A 3QE1A 4K76A 2LUIA 2I0LA 3ID1A 4Z8JA 4JJ0A 3EGHC 1FC6A 3GDSA 1UITA 5JXBA 3HPKA 1X5NA 3STJA 3OU0A 2FN5A 1QAUA 2L4TA 2OGPA 3CYYA 1Y8TA 3E17A 1RGWA 1ZOKA 3HVQC 1UHPA 2DLSA 5HETA 2ZPMA 3K50A 4L8NA 2KJPA 2AINA 5HEYA 4REYA 4NNMA 1TP3A 2QG1A 4OAJA 4JJ3A 1X5RA 2W4FA 1X5QA 1MFLA 5GLJA 5HEBA 2KOHA 2KL1A 2KJKA 1W9OA 2M0UA 5GNDA 3TMHA 3R69A 1TE0A 1Y7NA 4NMSA 3KDKA 2DB5A 2IWOA 2M0VA 3NCVA 2L4SA 3RL7A 4NMPA 1WI2A 3GCNA 1WF7A 1UEPA 2AWWA 1UEQA 1WG6A 1TP5A 1Q3OA 3KHFA 2JILA 2HGAA 2KBSA 4AMHA 2YUBA 2F0AA
chains in the Genus database with same CATH topology
1UEZA 1N7FA 3QJNA 2EDPA 1X8SA 2KA9A 1WH1A 4NMOA 1T2MA 1U3BA 4E35A 4UU6A 2Z17A 5A2PA 3KDGA 3TSWA 3GSLA 2DAZA 2MHOA 4NMQA 1GM1A 1V6BA 2F5YA 2R4HA 2OSGA 3SHWA 3WKMA 2IWQA 1UM7A 1UF1A 5EZ0A 2CSSA 3QJMA 2VWRA 3QO6A 1N6DA 2EDVA 2KOMA 5I7ZA 3L4FD 5D13A 3PV4A 4FGMA 5E21A 1G9OA 5EYZA 2EGOA 3SHUA 3WKLA 4EDJA 1I92A 5E11A 4PQWA 2RCZA 2QKUA 3R68A 4P0CA 5IL9A 1X6DA 2KG2A 3GCOA 2E7KA 4GVDA 1M5ZA 3ID3A 3DJAA 2PDZA 1OBXA 3PV2A 5H3JA 3TSZA 2EEGA 2DC2A 2KPLA 1XZ9A 5HFBA 5HJ1A 2GEFA 5HFEA 4Q2OA 4NXRA 4OEOA 1N6FA 1KWAA 1OBYA 2QT5A 1K32A 5G1EA 1VJ6A 2W7RA 2Q3GA 2H2CA 4Q6HA 2PKUA 1WI4A 3PDVA 4K72A 2EGNA 2QBWA 1FC7A 5B42A 1Z86A 3GJ9A 1QAVB 1N99A 1GQ4A 5HF4A 1YBOA 3QDOA 2VSVA 4G69A 1RGRA 5FB8C 3ZRTA 3PDZA 2D8IA 3DJ3A 1V5QA 1U39A 2CSJA 3MH6A 3CBYA 2H2BA 4NMRA 4FLNA 1WFGA 1VCWA 4F8KA 2PZDA 4JOJA 1OZIA 5F67A 5G1DA 2RRMA 1WIFA 2I1NA 3OTPA 3SUZA 1KY9A 3B76A 2KYLA 2YT7A 2EJYA 3QIKA 2P3WA 1Z87A 2AWXA 2M3MA 4JOPA 4HOPB 2LA8A 2JIKA 3NFKA 3GABA 2OZFA 3I18A 2K1ZA 2IWNA 3O46A 2DKRA 4JOHA 3LNYA 1N7EA 2M10A 2DMZA 3QGLA 3I1EA 4E34A 3CBZA 2YUYA 3DORA 5ILBA 2M0TA 4YYXA 4NXQA 3TSVA 1KEFA 1W9EA 3NFLA 3ID2A 1WFVA 3MH7A 2DJTA 1NTEA 4IC6A 2KOJA 4H11A 2PKTA 4Q2NA 3VQFA 2JREA 1Q7XA 1PDRA 2CS5A 1P1DA 5HFFA 3JXTA 4WYUA 2JINA 1GQ5A 4KFWA 2I04A 1V1TA 3NGHA 5FHTA 4JL7A 1MFGA 1BE9A 1V62A 2EGKA 2MX6A 2H3LA 2LC7A 2HE2A 1WHAA 1B8QA 1QLCA 1FCFA 4E3BA 1P1EA 3CBXA 2K20A 4KFVA 4Q6SA 3I4WA 3DJ1A 2EDZA 3HPMA 3BPUA 4UU5A 2EAQA 1UJDA 4R2ZA 2D92A 2EEIA 2VSPA 1OBZA 1ZUBA 3GDVA 3PV5A 5HEDA 5B6LA 5E22A 2QKTA 1MC7A 2PNTA 4JORA 1RY4A 2OCSA 2M0ZA 1Q3PA 2QKVA 2EEJA 2VPHA 1SOZA 5HDYA 4RI0A 2OQSA 2OMJA 1D5GA 2KRGA 4O06A 5E6PB 2BYGA 2DLUA 2ENOA 1UM1A 3SOEA 3FY5A 2HE4A 4K75A 4NXPA 2OS6A 4NMTA 1VB7A 4JOKA 1WHDA 3PS4A 1SOTA 1WF8A 1LCYA 3SFJA 2FE5A 2I4SA 2JWEA 4YDPA 2I6VA 1U37A 5HFCA 4Q3HA 3CS0A 2YTWA 4Z33A 3R0HA 1R6JA 1UJVA 4GHNA 3K82A 4XHVA 1U38A 3DIWA 1V5LA 1X9ZA 2FCFA 5E1YA 1UJUA 2L97A 3CH8A 2EV8A 2FNEA 3EGGC 1IHJA 1TQ3A 2REYA 2LC6A 4NNLA 2I0IA 2GZVA 2D90A 1W9QA 1N7TA 2DM8A 4NMVA 4OEPA 2KJDA 2JXOA 2EXGA 2EHRA 2G5MB 4GVCA 1RZXA 4Q2PA 1IU2A 5HFDA 1L6OA 1QAVA 4K6YA 2Z9IA 1X45A 2X7ZA 2OPGA 2VRFA 3RL8A 3LNXA 2O2TA 4P2AB 3K1RA 1UFXA 3VQGA 2UZCA 2KAWA 5DTHA 1NF3C 5HF1A 2JSNA 1I16A 2AWUA 4N6XA 2WL7A 2PA1A 4JOGA 3MH4A 2V90A 1VA8A 2KQFA 4MPAA 2IWPA 3KZDA 2EEHA 4JOFA 2LOBA 2KPKA 2V1WA 4LMMA 3RLEA 3O5NA 2Q9VA 3KZEA 2VZ5A 1UEWA 3GDUA 2H3MA 4Q2QA 4JOEA 1N6EA 3GGEA 4WYTA 1VAEA 1IU0A 5F3XA 1BFEA 4HOPA 2YT8A 2G2LA 2KV8A 2ZPLA 2JOAA 2R3YA 1FC9A 4K78A 1WJLA 3AXAA 3CC0A 3ID4A 3QE1A 4K76A 2LUIA 2I0LA 3ID1A 4Z8JA 4JJ0A 3EGHC 1FC6A 3GDSA 1UITA 5JXBA 3HPKA 1X5NA 3STJA 3OU0A 2FN5A 1QAUA 2L4TA 2OGPA 3CYYA 1Y8TA 3E17A 1RGWA 1ZOKA 3HVQC 1UHPA 2DLSA 5HETA 2ZPMA 3K50A 4L8NA 2KJPA 2AINA 5HEYA 4REYA 4NNMA 1TP3A 2QG1A 4OAJA 4JJ3A 1X5RA 2W4FA 1X5QA 1MFLA 5GLJA 5HEBA 2KOHA 2KL1A 2KJKA 1W9OA 2M0UA 5GNDA 3TMHA 3R69A 1TE0A 1Y7NA 4NMSA 3KDKA 2DB5A 2IWOA 2M0VA 3NCVA 2L4SA 3RL7A 4NMPA 1WI2A 3GCNA 1WF7A 1UEPA 2AWWA 1UEQA 1WG6A 1TP5A 1Q3OA 3KHFA 2JILA 2HGAA 2KBSA 4AMHA 2YUBA 2F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEZ A;  1N7F A;  3QJN A;  2EDP A;  1X8S A;  2KA9 A;  1WH1 A;  4NMO A;  1T2M A;  1U3B A;  4E35 A;  4UU6 A;  2Z17 A;  5A2P A;  3TSW A;  3GSL A;  2DAZ A;  2MHO A;  4NMQ A;  1GM1 A;  1V6B A;  2F5Y A;  2R4H A;  2OSG A;  3SHW A;  3WKM A;  2IWQ A;  1UM7 A;  1UF1 A;  5EZ0 A;  2CSS A;  3QJM A;  2VWR A;  3QO6 A;  1N6D A;  2EDV A;  2KOM A;  5I7Z A;  3L4F D;  5D13 A;  3PV4 A;  4FGM A;  5E21 A;  1G9O A;  5EYZ A;  2EGO A;  3SHU A;  3WKL A;  4EDJ A;  1I92 A;  5E11 A;  4PQW A;  2RCZ A;  2QKU A;  3R68 A;  4P0C A;  1X6D A;  2KG2 A;  3GCO A;  2E7K A;  4GVD A;  1M5Z A;  3ID3 A;  3DJA A;  2PDZ A;  1OBX A;  3PV2 A;  5H3J A;  3TSZ A;  2EEG A;  2DC2 A;  2KPL A;  1XZ9 A;  5HFB A;  5HJ1 A;  5HFE A;  4Q2O A;  4NXR A;  4OEO A;  1N6F A;  1KWA A;  1OBY A;  2QT5 A;  1K32 A;  5G1E A;  1VJ6 A;  2W7R A;  2Q3G A;  2H2C A;  4Q6H A;  2PKU A;  1WI4 A;  3PDV A;  4K72 A;  2EGN A;  2QBW A;  1FC7 A;  1Z86 A;  3GJ9 A;  1QAV B;  1N99 A;  1GQ4 A;  5HF4 A;  1YBO A;  3QDO A;  2VSV A;  4G69 A;  1RGR A;  5FB8 C;  3ZRT A;  3PDZ A;  2D8I A;  3DJ3 A;  1V5Q A;  1U39 A;  2CSJ A;  3MH6 A;  3CBY A;  2H2B A;  4NMR A;  1WFG A;  1VCW A;  4F8K A;  2PZD A;  4JOJ A;  1OZI A;  5F67 A;  5G1D A;  2RRM A;  1WIF A;  2I1N A;  3OTP A;  3SUZ A;  1KY9 A;  3B76 A;  2KYL A;  2YT7 A;  2EJY A;  3QIK A;  2P3W A;  1Z87 A;  2AWX A;  2M3M A;  4JOP A;  4HOP B;  2LA8 A;  2JIK A;  3NFK A;  2OZF A;  3I18 A;  2K1Z A;  2IWN A;  3O46 A;  2DKR A;  4JOH A;  3LNY A;  1N7E A;  2M10 A;  2DMZ A;  3QGL A;  3I1E A;  4E34 A;  3CBZ A;  2YUY A;  3DOR A;  2M0T A;  4YYX A;  4NXQ A;  3TSV A;  1KEF A;  1W9E A;  3NFL A;  3ID2 A;  1WFV A;  3MH7 A;  2DJT A;  1NTE A;  4IC6 A;  2KOJ A;  4H11 A;  2PKT A;  4Q2N A;  3VQF A;  2JRE A;  1Q7X A;  1PDR A;  2CS5 A;  1P1D A;  5HFF A;  3JXT A;  4WYU A;  2JIN A;  1GQ5 A;  4KFW A;  2I04 A;  1V1T A;  3NGH A;  5FHT A;  4JL7 A;  1MFG A;  1BE9 A;  1V62 A;  2EGK A;  2MX6 A;  2H3L A;  2LC7 A;  2HE2 A;  1WHA A;  1B8Q A;  1QLC A;  1FCF A;  4E3B A;  1P1E A;  3CBX A;  2K20 A;  4KFV A;  4Q6S A;  3I4W A;  3DJ1 A;  2EDZ A;  3HPM A;  3BPU A;  4UU5 A;  2EAQ A;  1UJD A;  4R2Z A;  2D92 A;  2EEI A;  2VSP A;  1OBZ A;  1ZUB A;  3GDV A;  3PV5 A;  5HED A;  5B6L A;  5E22 A;  2QKT A;  1MC7 A;  2PNT A;  4JOR A;  1RY4 A;  2OCS A;  2M0Z A;  1Q3P A;  2QKV A;  2EEJ A;  2VPH A;  1SOZ A;  5HDY A;  4RI0 A;  2OQS A;  2OMJ A;  1D5G A;  2KRG A;  4O06 A;  5E6P B;  2BYG A;  2DLU A;  2ENO A;  1UM1 A;  3SOE A;  3FY5 A;  2HE4 A;  4K75 A;  4NXP A;  2OS6 A;  4NMT A;  1VB7 A;  4JOK A;  1WHD A;  3PS4 A;  1SOT A;  1WF8 A;  1LCY A;  3SFJ A;  2FE5 A;  2I4S A;  2JWE A;  4YDP A;  2I6V A;  1U37 A;  5HFC A;  4Q3H A;  3CS0 A;  2YTW A;  4Z33 A;  3R0H A;  1R6J A;  1UJV A;  4GHN A;  3K82 A;  4XHV A;  1U38 A;  3DIW A;  1V5L A;  2FCF A;  5E1Y A;  1UJU A;  2L97 A;  3CH8 A;  2EV8 A;  2FNE A;  3EGG C;  1IHJ A;  1TQ3 A;  2REY A;  2LC6 A;  4NNL A;  2I0I A;  2GZV A;  2D90 A;  1W9Q A;  1N7T A;  2DM8 A;  4NMV A;  4OEP A;  2KJD A;  2JXO A;  2EXG A;  2EHR A;  2G5M B;  4GVC A;  1RZX A;  4Q2P A;  1IU2 A;  5HFD A;  1L6O A;  1QAV A;  4K6Y A;  2Z9I A;  1X45 A;  2X7Z A;  2OPG A;  2VRF A;  3RL8 A;  3LNX A;  2O2T A;  4P2A B;  3K1R A;  1UFX A;  3VQG A;  2UZC A;  2KAW A;  5DTH A;  1NF3 C;  5HF1 A;  1I16 A;  2AWU A;  4N6X A;  2WL7 A;  2PA1 A;  4JOG A;  3MH4 A;  2V90 A;  1VA8 A;  2KQF A;  4MPA A;  2IWP A;  3KZD A;  2EEH A;  4JOF A;  2LOB A;  2KPK A;  2V1W A;  4LMM A;  3RLE A;  3O5N A;  2Q9V A;  3KZE A;  2VZ5 A;  1UEW A;  3GDU A;  2H3M A;  4Q2Q A;  4JOE A;  1N6E A;  3GGE A;  4WYT A;  1VAE A;  1IU0 A;  5F3X A;  1BFE A;  4HOP A;  2YT8 A;  2G2L A;  2KV8 A;  2ZPL A;  2JOA A;  2R3Y A;  1FC9 A;  4K78 A;  1WJL A;  3AXA A;  3CC0 A;  3ID4 A;  3QE1 A;  4K76 A;  2LUI A;  2I0L A;  3ID1 A;  4Z8J A;  3EGH C;  1FC6 A;  3GDS A;  1UIT A;  5JXB A;  3HPK A;  1X5N A;  3STJ A;  3OU0 A;  2FN5 A;  1QAU A;  2L4T A;  2OGP A;  3CYY A;  1Y8T A;  3E17 A;  1RGW A;  1ZOK A;  3HVQ C;  1UHP A;  2DLS A;  5HET A;  2ZPM A;  3K50 A;  4L8N A;  2KJP A;  2AIN A;  5HEY A;  4REY A;  4NNM A;  1TP3 A;  2QG1 A;  4OAJ A;  1X5R A;  2W4F A;  1X5Q A;  1MFL A;  5GLJ A;  5HEB A;  2KOH A;  2KL1 A;  2KJK A;  1W9O A;  2M0U A;  5GND A;  3TMH A;  3R69 A;  1TE0 A;  1Y7N A;  4NMS A;  2DB5 A;  2IWO A;  2M0V A;  2L4S A;  3RL7 A;  4NMP A;  1WI2 A;  3GCN A;  1WF7 A;  1UEP A;  2AWW A;  1UEQ A;  1WG6 A;  1TP5 A;  1Q3O A;  3KHF A;  2JIL A;  2HGA A;  2KBS A;  4AMH A;  2YUB A;  2F0A A; 
#chains in the Genus database with same CATH topology
 1UEZ A;  1N7F A;  3QJN A;  2EDP A;  1X8S A;  2KA9 A;  1WH1 A;  4NMO A;  1T2M A;  1U3B A;  4E35 A;  4UU6 A;  2Z17 A;  5A2P A;  3KDG A;  3TSW A;  3GSL A;  2DAZ A;  2MHO A;  4NMQ A;  1GM1 A;  1V6B A;  2F5Y A;  2R4H A;  2OSG A;  3SHW A;  3WKM A;  2IWQ A;  1UM7 A;  1UF1 A;  5EZ0 A;  2CSS A;  3QJM A;  2VWR A;  3QO6 A;  1N6D A;  2EDV A;  2KOM A;  5I7Z A;  3L4F D;  5D13 A;  3PV4 A;  4FGM A;  5E21 A;  1G9O A;  5EYZ A;  2EGO A;  3SHU A;  3WKL A;  4EDJ A;  1I92 A;  5E11 A;  4PQW A;  2RCZ A;  2QKU A;  3R68 A;  4P0C A;  5IL9 A;  1X6D A;  2KG2 A;  3GCO A;  2E7K A;  4GVD A;  1M5Z A;  3ID3 A;  3DJA A;  2PDZ A;  1OBX A;  3PV2 A;  5H3J A;  3TSZ A;  2EEG A;  2DC2 A;  2KPL A;  1XZ9 A;  5HFB A;  5HJ1 A;  2GEF A;  5HFE A;  4Q2O A;  4NXR A;  4OEO A;  1N6F A;  1KWA A;  1OBY A;  2QT5 A;  1K32 A;  5G1E A;  1VJ6 A;  2W7R A;  2Q3G A;  2H2C A;  4Q6H A;  2PKU A;  1WI4 A;  3PDV A;  4K72 A;  2EGN A;  2QBW A;  1FC7 A;  5B42 A;  1Z86 A;  3GJ9 A;  1QAV B;  1N99 A;  1GQ4 A;  5HF4 A;  1YBO A;  3QDO A;  2VSV A;  4G69 A;  1RGR A;  5FB8 C;  3ZRT A;  3PDZ A;  2D8I A;  3DJ3 A;  1V5Q A;  1U39 A;  2CSJ A;  3MH6 A;  3CBY A;  2H2B A;  4NMR A;  4FLN A;  1WFG A;  1VCW A;  4F8K A;  2PZD A;  4JOJ A;  1OZI A;  5F67 A;  5G1D A;  2RRM A;  1WIF A;  2I1N A;  3OTP A;  3SUZ A;  1KY9 A;  3B76 A;  2KYL A;  2YT7 A;  2EJY A;  3QIK A;  2P3W A;  1Z87 A;  2AWX A;  2M3M A;  4JOP A;  4HOP B;  2LA8 A;  2JIK A;  3NFK A;  3GAB A;  2OZF A;  3I18 A;  2K1Z A;  2IWN A;  3O46 A;  2DKR A;  4JOH A;  3LNY A;  1N7E A;  2M10 A;  2DMZ A;  3QGL A;  3I1E A;  4E34 A;  3CBZ A;  2YUY A;  3DOR A;  5ILB A;  2M0T A;  4YYX A;  4NXQ A;  3TSV A;  1KEF A;  1W9E A;  3NFL A;  3ID2 A;  1WFV A;  3MH7 A;  2DJT A;  1NTE A;  4IC6 A;  2KOJ A;  4H11 A;  2PKT A;  4Q2N A;  3VQF A;  2JRE A;  1Q7X A;  1PDR A;  2CS5 A;  1P1D A;  5HFF A;  3JXT A;  4WYU A;  2JIN A;  1GQ5 A;  4KFW A;  2I04 A;  1V1T A;  3NGH A;  5FHT A;  4JL7 A;  1MFG A;  1BE9 A;  1V62 A;  2EGK A;  2MX6 A;  2H3L A;  2LC7 A;  2HE2 A;  1WHA A;  1B8Q A;  1QLC A;  1FCF A;  4E3B A;  1P1E A;  3CBX A;  2K20 A;  4KFV A;  4Q6S A;  3I4W A;  3DJ1 A;  2EDZ A;  3HPM A;  3BPU A;  4UU5 A;  2EAQ A;  1UJD A;  4R2Z A;  2D92 A;  2EEI A;  2VSP A;  1OBZ A;  1ZUB A;  3GDV A;  3PV5 A;  5HED A;  5B6L A;  5E22 A;  2QKT A;  1MC7 A;  2PNT A;  4JOR A;  1RY4 A;  2OCS A;  2M0Z A;  1Q3P A;  2QKV A;  2EEJ A;  2VPH A;  1SOZ A;  5HDY A;  4RI0 A;  2OQS A;  2OMJ A;  1D5G A;  2KRG A;  4O06 A;  5E6P B;  2BYG A;  2DLU A;  2ENO A;  1UM1 A;  3SOE A;  3FY5 A;  2HE4 A;  4K75 A;  4NXP A;  2OS6 A;  4NMT A;  1VB7 A;  4JOK A;  1WHD A;  3PS4 A;  1SOT A;  1WF8 A;  1LCY A;  3SFJ A;  2FE5 A;  2I4S A;  2JWE A;  4YDP A;  2I6V A;  1U37 A;  5HFC A;  4Q3H A;  3CS0 A;  2YTW A;  4Z33 A;  3R0H A;  1R6J A;  1UJV A;  4GHN A;  3K82 A;  4XHV A;  1U38 A;  3DIW A;  1V5L A;  1X9Z A;  2FCF A;  5E1Y A;  1UJU A;  2L97 A;  3CH8 A;  2EV8 A;  2FNE A;  3EGG C;  1IHJ A;  1TQ3 A;  2REY A;  2LC6 A;  4NNL A;  2I0I A;  2GZV A;  2D90 A;  1W9Q A;  1N7T A;  2DM8 A;  4NMV A;  4OEP A;  2KJD A;  2JXO A;  2EXG A;  2EHR A;  2G5M B;  4GVC A;  1RZX A;  4Q2P A;  1IU2 A;  5HFD A;  1L6O A;  1QAV A;  4K6Y A;  2Z9I A;  1X45 A;  2X7Z A;  2OPG A;  2VRF A;  3RL8 A;  3LNX A;  2O2T A;  4P2A B;  3K1R A;  1UFX A;  3VQG A;  2UZC A;  2KAW A;  5DTH A;  1NF3 C;  5HF1 A;  2JSN A;  1I16 A;  2AWU A;  4N6X A;  2WL7 A;  2PA1 A;  4JOG A;  3MH4 A;  2V90 A;  1VA8 A;  2KQF A;  4MPA A;  2IWP A;  3KZD A;  2EEH A;  4JOF A;  2LOB A;  2KPK A;  2V1W A;  4LMM A;  3RLE A;  3O5N A;  2Q9V A;  3KZE A;  2VZ5 A;  1UEW A;  3GDU A;  2H3M A;  4Q2Q A;  4JOE A;  1N6E A;  3GGE A;  4WYT A;  1VAE A;  1IU0 A;  5F3X A;  1BFE A;  4HOP A;  2YT8 A;  2G2L A;  2KV8 A;  2ZPL A;  2JOA A;  2R3Y A;  1FC9 A;  4K78 A;  1WJL A;  3AXA A;  3CC0 A;  3ID4 A;  3QE1 A;  4K76 A;  2LUI A;  2I0L A;  3ID1 A;  4Z8J A;  4JJ0 A;  3EGH C;  1FC6 A;  3GDS A;  1UIT A;  5JXB A;  3HPK A;  1X5N A;  3STJ A;  3OU0 A;  2FN5 A;  1QAU A;  2L4T A;  2OGP A;  3CYY A;  1Y8T A;  3E17 A;  1RGW A;  1ZOK A;  3HVQ C;  1UHP A;  2DLS A;  5HET A;  2ZPM A;  3K50 A;  4L8N A;  2KJP A;  2AIN A;  5HEY A;  4REY A;  4NNM A;  1TP3 A;  2QG1 A;  4OAJ A;  4JJ3 A;  1X5R A;  2W4F A;  1X5Q A;  1MFL A;  5GLJ A;  5HEB A;  2KOH A;  2KL1 A;  2KJK A;  1W9O A;  2M0U A;  5GND A;  3TMH A;  3R69 A;  1TE0 A;  1Y7N A;  4NMS A;  3KDK A;  2DB5 A;  2IWO A;  2M0V A;  3NCV A;  2L4S A;  3RL7 A;  4NMP A;  1WI2 A;  3GCN A;  1WF7 A;  1UEP A;  2AWW A;  1UEQ A;  1WG6 A;  1TP5 A;  1Q3O A;  3KHF A;  2JIL A;  2HGA A;  2KBS A;  4AMH A;  2YUB A;  2F0A A; 
#chains in the Genus database with same CATH homology
 1UEZ A;  1N7F A;  3QJN A;  2EDP A;  1X8S A;  2KA9 A;  1WH1 A;  4NMO A;  1T2M A;  1U3B A;  4E35 A;  4UU6 A;  2Z17 A;  5A2P A;  3KDG A;  3TSW A;  3GSL A;  2DAZ A;  2MHO A;  4NMQ A;  1GM1 A;  1V6B A;  2F5Y A;  2R4H A;  2OSG A;  3SHW A;  3WKM A;  2IWQ A;  1UM7 A;  1UF1 A;  5EZ0 A;  2CSS A;  3QJM A;  2VWR A;  3QO6 A;  1N6D A;  2EDV A;  2KOM A;  5I7Z A;  3L4F D;  5D13 A;  3PV4 A;  4FGM A;  5E21 A;  1G9O A;  5EYZ A;  2EGO A;  3SHU A;  3WKL A;  4EDJ A;  1I92 A;  5E11 A;  4PQW A;  2RCZ A;  2QKU A;  3R68 A;  4P0C A;  5IL9 A;  1X6D A;  2KG2 A;  3GCO A;  2E7K A;  4GVD A;  1M5Z A;  3ID3 A;  3DJA A;  2PDZ A;  1OBX A;  3PV2 A;  5H3J A;  3TSZ A;  2EEG A;  2DC2 A;  2KPL A;  1XZ9 A;  5HFB A;  5HJ1 A;  2GEF A;  5HFE A;  4Q2O A;  4NXR A;  4OEO A;  1N6F A;  1KWA A;  1OBY A;  2QT5 A;  1K32 A;  5G1E A;  1VJ6 A;  2W7R A;  2Q3G A;  2H2C A;  4Q6H A;  2PKU A;  1WI4 A;  3PDV A;  4K72 A;  2EGN A;  2QBW A;  1FC7 A;  5B42 A;  1Z86 A;  3GJ9 A;  1QAV B;  1N99 A;  1GQ4 A;  5HF4 A;  1YBO A;  3QDO A;  2VSV A;  4G69 A;  1RGR A;  5FB8 C;  3ZRT A;  3PDZ A;  2D8I A;  3DJ3 A;  1V5Q A;  1U39 A;  2CSJ A;  3MH6 A;  3CBY A;  2H2B A;  4NMR A;  4FLN A;  1WFG A;  1VCW A;  4F8K A;  2PZD A;  4JOJ A;  1OZI A;  5F67 A;  5G1D A;  2RRM A;  1WIF A;  2I1N A;  3OTP A;  3SUZ A;  1KY9 A;  3B76 A;  2KYL A;  2YT7 A;  2EJY A;  3QIK A;  2P3W A;  1Z87 A;  2AWX A;  2M3M A;  4JOP A;  4HOP B;  2LA8 A;  2JIK A;  3NFK A;  3GAB A;  2OZF A;  3I18 A;  2K1Z A;  2IWN A;  3O46 A;  2DKR A;  4JOH A;  3LNY A;  1N7E A;  2M10 A;  2DMZ A;  3QGL A;  3I1E A;  4E34 A;  3CBZ A;  2YUY A;  3DOR A;  5ILB A;  2M0T A;  4YYX A;  4NXQ A;  3TSV A;  1KEF A;  1W9E A;  3NFL A;  3ID2 A;  1WFV A;  3MH7 A;  2DJT A;  1NTE A;  4IC6 A;  2KOJ A;  4H11 A;  2PKT A;  4Q2N A;  3VQF A;  2JRE A;  1Q7X A;  1PDR A;  2CS5 A;  1P1D A;  5HFF A;  3JXT A;  4WYU A;  2JIN A;  1GQ5 A;  4KFW A;  2I04 A;  1V1T A;  3NGH A;  5FHT A;  4JL7 A;  1MFG A;  1BE9 A;  1V62 A;  2EGK A;  2MX6 A;  2H3L A;  2LC7 A;  2HE2 A;  1WHA A;  1B8Q A;  1QLC A;  1FCF A;  4E3B A;  1P1E A;  3CBX A;  2K20 A;  4KFV A;  4Q6S A;  3I4W A;  3DJ1 A;  2EDZ A;  3HPM A;  3BPU A;  4UU5 A;  2EAQ A;  1UJD A;  4R2Z A;  2D92 A;  2EEI A;  2VSP A;  1OBZ A;  1ZUB A;  3GDV A;  3PV5 A;  5HED A;  5B6L A;  5E22 A;  2QKT A;  1MC7 A;  2PNT A;  4JOR A;  1RY4 A;  2OCS A;  2M0Z A;  1Q3P A;  2QKV A;  2EEJ A;  2VPH A;  1SOZ A;  5HDY A;  4RI0 A;  2OQS A;  2OMJ A;  1D5G A;  2KRG A;  4O06 A;  5E6P B;  2BYG A;  2DLU A;  2ENO A;  1UM1 A;  3SOE A;  3FY5 A;  2HE4 A;  4K75 A;  4NXP A;  2OS6 A;  4NMT A;  1VB7 A;  4JOK A;  1WHD A;  3PS4 A;  1SOT A;  1WF8 A;  1LCY A;  3SFJ A;  2FE5 A;  2I4S A;  2JWE A;  4YDP A;  2I6V A;  1U37 A;  5HFC A;  4Q3H A;  3CS0 A;  2YTW A;  4Z33 A;  3R0H A;  1R6J A;  1UJV A;  4GHN A;  3K82 A;  4XHV A;  1U38 A;  3DIW A;  1V5L A;  1X9Z A;  2FCF A;  5E1Y A;  1UJU A;  2L97 A;  3CH8 A;  2EV8 A;  2FNE A;  3EGG C;  1IHJ A;  1TQ3 A;  2REY A;  2LC6 A;  4NNL A;  2I0I A;  2GZV A;  2D90 A;  1W9Q A;  1N7T A;  2DM8 A;  4NMV A;  4OEP A;  2KJD A;  2JXO A;  2EXG A;  2EHR A;  2G5M B;  4GVC A;  1RZX A;  4Q2P A;  1IU2 A;  5HFD A;  1L6O A;  1QAV A;  4K6Y A;  2Z9I A;  1X45 A;  2X7Z A;  2OPG A;  2VRF A;  3RL8 A;  3LNX A;  2O2T A;  4P2A B;  3K1R A;  1UFX A;  3VQG A;  2UZC A;  2KAW A;  5DTH A;  1NF3 C;  5HF1 A;  2JSN A;  1I16 A;  2AWU A;  4N6X A;  2WL7 A;  2PA1 A;  4JOG A;  3MH4 A;  2V90 A;  1VA8 A;  2KQF A;  4MPA A;  2IWP A;  3KZD A;  2EEH A;  4JOF A;  2LOB A;  2KPK A;  2V1W A;  4LMM A;  3RLE A;  3O5N A;  2Q9V A;  3KZE A;  2VZ5 A;  1UEW A;  3GDU A;  2H3M A;  4Q2Q A;  4JOE A;  1N6E A;  3GGE A;  4WYT A;  1VAE A;  1IU0 A;  5F3X A;  1BFE A;  4HOP A;  2YT8 A;  2G2L A;  2KV8 A;  2ZPL A;  2JOA A;  2R3Y A;  1FC9 A;  4K78 A;  1WJL A;  3AXA A;  3CC0 A;  3ID4 A;  3QE1 A;  4K76 A;  2LUI A;  2I0L A;  3ID1 A;  4Z8J A;  4JJ0 A;  3EGH C;  1FC6 A;  3GDS A;  1UIT A;  5JXB A;  3HPK A;  1X5N A;  3STJ A;  3OU0 A;  2FN5 A;  1QAU A;  2L4T A;  2OGP A;  3CYY A;  1Y8T A;  3E17 A;  1RGW A;  1ZOK A;  3HVQ C;  1UHP A;  2DLS A;  5HET A;  2ZPM A;  3K50 A;  4L8N A;  2KJP A;  2AIN A;  5HEY A;  4REY A;  4NNM A;  1TP3 A;  2QG1 A;  4OAJ A;  4JJ3 A;  1X5R A;  2W4F A;  1X5Q A;  1MFL A;  5GLJ A;  5HEB A;  2KOH A;  2KL1 A;  2KJK A;  1W9O A;  2M0U A;  5GND A;  3TMH A;  3R69 A;  1TE0 A;  1Y7N A;  4NMS A;  3KDK A;  2DB5 A;  2IWO A;  2M0V A;  3NCV A;  2L4S A;  3RL7 A;  4NMP A;  1WI2 A;  3GCN A;  1WF7 A;  1UEP A;  2AWW A;  1UEQ A;  1WG6 A;  1TP5 A;  1Q3O A;  3KHF A;  2JIL A;  2HGA A;  2KBS A;  4AMH A;  2YUB A;  2F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...